Citrus Sinensis ID: 023260

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
MKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEGETKVKQQKKTKQLNGNFTIQCACSTNV
cHHHHHHHHcccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccccccccc
cccHHHHHEEcHccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHEHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcccccccEEEEccccccEEEEcccccccccEEEEEEccccc
MKAIADLLvdstdgegnnilhlagklappdrlnvvsgSALQMQRELLWFQAVKKVVPRKLAeaknkkgltpralfSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAAltvpggnkedtglpfflhnvsFKIFAVSNVISLVASTLSIVVFLSLvtpryaekdFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRsvfvsdylipkcktslfykegeTKVKQQKKTkqlngnftiqcacstnv
MKAIADLLVDSTDGEGNNILHlagklappdrLNVVSGSALQMQRELLWFQAVKKVVPRKLaeaknkkgltpralfseqhrDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEGETKVKQQkktkqlngnftiqcacstnv
MKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEGEtkvkqqkktkqLNGNFTIQCACSTNV
****************NNILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKL****************************WMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEG**************GNFTIQCA*****
****ADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFS***********KWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSD***********************************C******
MKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEGETKVKQQKKTKQLNGNFTIQCACSTNV
MKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEGETKVKQQKKTKQLNGNFTIQCACST**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEGETKVKQQKKTKQLNGNFTIQCACSTNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query285 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.463 0.223 0.333 1e-09
Q9ZU96532 Ankyrin repeat-containing no no 0.536 0.287 0.244 2e-05
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 74/141 (52%), Gaps = 9/141 (6%)

Query: 80  RDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAV 139
           ++L++   + + +  +S  +VA L ATV FAA  TVPGG+  D G    +   SFKIF +
Sbjct: 405 KELRKLHREGINNATNSVTVVAVLFATVAFAAIFTVPGGDNND-GSAVVVGRASFKIFFI 463

Query: 140 SNVISLVASTLSIVVFLSLVTPRY-AEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATS 198
            N ++L  S   +VV ++LV     AEK  + ++ +        +++A     V F A+S
Sbjct: 464 FNALALFTSLAVVVVQITLVRGETKAEKRVVEVINK-------LMWLASMCTSVAFLASS 516

Query: 199 FIVFTDGSTWIAILVIVVPSV 219
           +IV    + W A LV VV  V
Sbjct: 517 YIVVGRKNEWAAELVTVVGGV 537

Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
118488149354 unknown [Populus trichocarpa] 0.912 0.734 0.555 5e-73
224120494354 predicted protein [Populus trichocarpa] 0.912 0.734 0.555 9e-73
224120488 610 predicted protein [Populus trichocarpa] 0.912 0.426 0.551 4e-72
224120314354 predicted protein [Populus trichocarpa] 0.912 0.734 0.536 3e-71
225425076 563 PREDICTED: ankyrin repeat-containing pro 0.884 0.447 0.523 3e-68
297737987 1855 unnamed protein product [Vitis vinifera] 0.842 0.129 0.529 1e-67
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.842 0.141 0.529 2e-67
359472754 789 PREDICTED: ankyrin repeat-containing pro 0.842 0.304 0.529 2e-67
359473665 602 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.884 0.418 0.527 8e-67
297740805 702 unnamed protein product [Vitis vinifera] 0.842 0.341 0.525 4e-65
>gi|118488149|gb|ABK95894.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  280 bits (716), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 145/261 (55%), Positives = 184/261 (70%), Gaps = 1/261 (0%)

Query: 3   AIADLLVDSTDGEGNNILHLAGK-LAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLA 61
           +I +L+    D EGNN+LHLA K L  P RLN + G+ALQ+QRELLWF+ VKKVV  +  
Sbjct: 93  SIKNLITTYKDTEGNNMLHLAAKVLESPSRLNAIPGAALQLQRELLWFEEVKKVVQPRHI 152

Query: 62  EAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKE 121
           E KN  G TP ALF EQHRDL ++GE+WM+DTA SCM+VATLIATVVFAAA TVPGGN +
Sbjct: 153 EEKNFHGKTPGALFIEQHRDLMKEGEQWMRDTADSCMLVATLIATVVFAAAFTVPGGNFQ 212

Query: 122 DTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLG 181
           D G P FL  ++FK FA+S+ ISLV S  S++ FLS+ T RYAE++FL  LP +L +GL 
Sbjct: 213 DKGTPVFLKEIAFKFFAISDAISLVTSASSLLTFLSIRTSRYAEQNFLWSLPNRLIIGLT 272

Query: 182 TLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFV 241
           TLFI+I AMMV F AT F+VF +     +I + VV S+P I F + HFRLF D++ S + 
Sbjct: 273 TLFISIGAMMVAFMATFFLVFGNKLLPYSIPIAVVASLPVIFFIWQHFRLFVDMIHSTYT 332

Query: 242 SDYLIPKCKTSLFYKEGETKV 262
           S  L    K+ LF K+ + KV
Sbjct: 333 SRSLFKPNKSPLFSKKLKPKV 353

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224120494|ref|XP_002331061.1| predicted protein [Populus trichocarpa] gi|222872991|gb|EEF10122.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120488|ref|XP_002331060.1| predicted protein [Populus trichocarpa] gi|222872990|gb|EEF10121.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120314|ref|XP_002331017.1| predicted protein [Populus trichocarpa] gi|222872947|gb|EEF10078.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225425076|ref|XP_002271486.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473665|ref|XP_003631341.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740805|emb|CBI30987.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.884 0.726 0.461 8.4e-58
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.849 0.421 0.453 3e-53
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.821 0.349 0.434 2.5e-49
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.814 0.371 0.434 1.6e-47
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.814 0.384 0.407 1.2e-44
TAIR|locus:2170081535 AT5G50140 "AT5G50140" [Arabido 0.575 0.306 0.258 1.9e-10
TAIR|locus:2020833616 AT1G03670 "AT1G03670" [Arabido 0.470 0.217 0.308 2.2e-10
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.463 0.223 0.347 5.8e-10
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.463 0.217 0.319 1.1e-09
TAIR|locus:2157553598 AT5G54710 "AT5G54710" [Arabido 0.519 0.247 0.283 4.2e-09
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 594 (214.2 bits), Expect = 8.4e-58, P = 8.4e-58
 Identities = 119/258 (46%), Positives = 178/258 (68%)

Query:     3 AIADLLVDSTDGEGN-NILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLA 61
             AI DL+    + E N N+LHL  +L PP+RL VVSG+ALQMQRE+LW++AVK++VPR   
Sbjct:    89 AIKDLIAMYKEKESNDNLLHLVARLPPPNRLQVVSGAALQMQREILWYKAVKEIVPRVYI 148

Query:    62 EAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNK- 120
             + KNKK      LF+++H +L+++GEKWMK+TA++C++V+TLIATVVFAAA T+PGGN  
Sbjct:   149 KTKNKKEEVAHDLFTKEHDNLRKEGEKWMKETATACILVSTLIATVVFAAAFTLPGGNDT 208

Query:   121 ----EDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKL 176
                 +  G P F     F++F +S+ ++L++S  SI++FLS++T RYAE  F + LP KL
Sbjct:   209 SGDIKTLGFPTFRKEFWFEVFIISDSVALLSSVTSIMIFLSILTSRYAEASFQTTLPTKL 268

Query:   177 YVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFFYLHFRLFDDIL 236
              +GL  LF++I +M++ F+AT  ++      W  IL++ V S  A+ F  LHF+L+ D L
Sbjct:   269 MLGLLALFVSIISMVLAFTATLILIRDQEPKWSLILLVYVASATALSFVVLHFQLWFDTL 328

Query:   237 RSVFVSDYLIPKCKTSLF 254
             RS ++S +L    K+ L+
Sbjct:   329 RSAYLSKFLFHGRKSGLY 346
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170081 AT5G50140 "AT5G50140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157553 AT5G54710 "AT5G54710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0152005601
SubName- Full=Putative uncharacterized protein; (354 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
pfam13962114 pfam13962, PGG, Domain of unknown function 1e-28
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score =  105 bits (264), Expect = 1e-28
 Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 13/121 (10%)

Query: 87  EKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDT-----GLPFFLHN-VSFKIFAVS 140
            +W++ T +S ++VATLIATV FAA  T PGG  +D      G P        FK F VS
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 141 NVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFI 200
           N I+ VAS +++++ L +V        F   LPR L   L  L++++ ++MV F+A S+ 
Sbjct: 61  NTIAFVASLVAVILLLYIV------PSFSRRLPR-LLALLTLLWLSLLSLMVAFAAGSYR 113

Query: 201 V 201
           V
Sbjct: 114 V 114

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 285
PF13962113 PGG: Domain of unknown function 99.95
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.19
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 96.79
KOG0510 929 consensus Ankyrin repeat protein [General function 96.71
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 96.35
KOG0508615 consensus Ankyrin repeat protein [General function 96.09
PHA02741169 hypothetical protein; Provisional 96.07
KOG4412226 consensus 26S proteasome regulatory complex, subun 95.94
PHA02946446 ankyin-like protein; Provisional 95.93
PHA03095471 ankyrin-like protein; Provisional 95.84
PHA02736154 Viral ankyrin protein; Provisional 95.77
PF1360630 Ank_3: Ankyrin repeat 95.73
PHA02798489 ankyrin-like protein; Provisional 95.71
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 95.68
PHA02736154 Viral ankyrin protein; Provisional 95.66
PHA02946 446 ankyin-like protein; Provisional 95.6
PHA02989494 ankyrin repeat protein; Provisional 95.53
KOG0514452 consensus Ankyrin repeat protein [General function 95.53
KOG0510 929 consensus Ankyrin repeat protein [General function 95.45
KOG0195448 consensus Integrin-linked kinase [Signal transduct 95.43
PHA02730 672 ankyrin-like protein; Provisional 95.23
PHA02741169 hypothetical protein; Provisional 94.89
KOG4412226 consensus 26S proteasome regulatory complex, subun 94.84
PHA02874434 ankyrin repeat protein; Provisional 94.77
PHA02859209 ankyrin repeat protein; Provisional 94.69
PHA02743166 Viral ankyrin protein; Provisional 94.67
KOG0512228 consensus Fetal globin-inducing factor (contains a 94.6
PHA02795437 ankyrin-like protein; Provisional 94.55
PHA03100480 ankyrin repeat protein; Provisional 94.5
PHA02716764 CPXV016; CPX019; EVM010; Provisional 94.32
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 93.95
PLN03192823 Voltage-dependent potassium channel; Provisional 93.92
PLN03192823 Voltage-dependent potassium channel; Provisional 93.57
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 93.53
PHA02743166 Viral ankyrin protein; Provisional 93.5
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 93.37
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 93.15
PHA02878477 ankyrin repeat protein; Provisional 93.12
PHA02792631 ankyrin-like protein; Provisional 92.73
KOG0522 560 consensus Ankyrin repeat protein [General function 92.68
PHA02876682 ankyrin repeat protein; Provisional 92.57
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 92.42
KOG0508 615 consensus Ankyrin repeat protein [General function 92.32
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 92.31
PHA02798 489 ankyrin-like protein; Provisional 92.11
PHA03095 471 ankyrin-like protein; Provisional 91.83
PHA02791284 ankyrin-like protein; Provisional 91.79
PHA02874434 ankyrin repeat protein; Provisional 91.78
PHA02876 682 ankyrin repeat protein; Provisional 91.72
KOG0514452 consensus Ankyrin repeat protein [General function 91.53
PHA02884300 ankyrin repeat protein; Provisional 91.33
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 91.15
PHA02791284 ankyrin-like protein; Provisional 91.12
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 91.03
PHA02875413 ankyrin repeat protein; Provisional 90.94
PHA02878477 ankyrin repeat protein; Provisional 90.73
TIGR00870 743 trp transient-receptor-potential calcium channel p 90.65
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 90.61
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 90.54
PHA02730672 ankyrin-like protein; Provisional 90.22
PHA02917661 ankyrin-like protein; Provisional 90.13
PHA02859209 ankyrin repeat protein; Provisional 90.06
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 89.43
PHA02875413 ankyrin repeat protein; Provisional 88.75
PHA02917 661 ankyrin-like protein; Provisional 88.72
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 87.37
KOG0705749 consensus GTPase-activating protein Centaurin gamm 87.2
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 85.99
PHA02792 631 ankyrin-like protein; Provisional 85.97
PHA03100 480 ankyrin repeat protein; Provisional 85.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 85.21
PHA02884300 ankyrin repeat protein; Provisional 84.96
PHA02989 494 ankyrin repeat protein; Provisional 84.91
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 84.73
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 83.46
>PF13962 PGG: Domain of unknown function Back     alignment and domain information 
Probab=99.95  E-value=3.4e-28  Score=197.41  Aligned_cols=109  Identities=41%  Similarity=0.682  Sum_probs=97.5

Q ss_pred             hHHhhhccccchHHHHHHHHHHHHhhhcCCCCCCCC---CCccccccCc-ceeeehhhhHHHHHHHHHHHHHHhhhcCcc
Q 023260           87 EKWMKDTASSCMIVATLIATVVFAAALTVPGGNKED---TGLPFFLHNV-SFKIFAVSNVISLVASTLSIVVFLSLVTPR  162 (285)
Q Consensus        87 ~~~~~~~~~sllvVA~LIATVtFaA~ft~PGG~~~~---~G~p~l~~~~-~F~~F~i~ntiAf~~S~~aill~lsil~sr  162 (285)
                      +||++|++|+++|||+||||||||||+|||||+|||   +|+|++.+++ .|++|+++|++||++|+++++++++.+   
T Consensus         1 ~~~~~~~~~~llVvAtLIATvtF~A~~tpPGG~~~~~~~~G~~il~~~~~~f~~F~~~nt~af~~S~~~i~~l~~~~---   77 (113)
T PF13962_consen    1 KKWLEDTRNSLLVVATLIATVTFQAAFTPPGGYWQDDDDAGTPILAKKPSAFKAFLISNTIAFFSSLAAIFLLISGL---   77 (113)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCccccccCCCCchhccccchhhhHHHHHHHHHHHHHHHHHHHHHHh---
Confidence            579999999999999999999999999999999875   6999998887 999999999999999999999887422   


Q ss_pred             hhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q 023260          163 YAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIV  201 (285)
Q Consensus       163 ~~~~df~~~l~~~l~~~~~~l~~si~~m~vAF~~g~~~v  201 (285)
                         +++.+..++.+..+..++++++.+|++||++|+|+|
T Consensus        78 ---~~~~~~~~~~~~~~~~~~~~a~~~~~~Af~~g~~~v  113 (113)
T PF13962_consen   78 ---DDFRRFLRRYLLIASVLMWIALISMMVAFAAGIYLV  113 (113)
T ss_pred             ---hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence               344555667788889999999999999999999875

>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 42.5 bits (99), Expect = 1e-04
 Identities = 46/283 (16%), Positives = 84/283 (29%), Gaps = 77/283 (27%)

Query: 23  AGK--LAPPDRLNVVSGSALQ--MQRELLWFQAVKKVVPRKLAEAKNK------KGLTPR 72
           +GK  +A    L+V     +Q  M  ++ W        P  + E   K         T R
Sbjct: 161 SGKTWVA----LDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSR 216

Query: 73  ALFSEQHRDLKEKGEKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNV 132
           +  S   +      +  ++           L+ +  +   L V             L NV
Sbjct: 217 SDHSSNIKLRIHSIQAELRR----------LLKSKPYENCLLV-------------LLNV 253

Query: 133 S----FKIFAVS----------NVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYV 178
                +  F +S           V   +++  +  + L   +      +  SLL + L  
Sbjct: 254 QNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDC 313

Query: 179 GLGTL----------FIA-IAAMMVVFSATSFIVFTDGSTW-----IAILVIVVPSVPAI 222
               L           ++ IA  +    AT          W       +  I+  S+  +
Sbjct: 314 RPQDLPREVLTTNPRRLSIIAESIRDGLATW-------DNWKHVNCDKLTTIIESSL-NV 365

Query: 223 LFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEGETKVKQQ 265
           L    + ++FD +  SVF     IP    SL + +        
Sbjct: 366 LEPAEYRKMFDRL--SVFPPSAHIPTILLSLIWFDVIKSDVMV 406

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 97.21
4gpm_A169 Engineered protein OR264; de novo protein, structu 97.1
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 97.07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 97.06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 96.96
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 96.96
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 96.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 96.89
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 96.87
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 96.72
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 96.66
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 96.64
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 96.58
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 96.47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 96.45
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 96.44
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 96.41
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 96.31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 96.3
1sw6_A327 Regulatory protein SWI6; transcription regulation, 96.28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 96.28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 96.26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 96.24
1awc_B153 Protein (GA binding protein beta 1); complex (tran 96.23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 96.2
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 96.18
4gpm_A169 Engineered protein OR264; de novo protein, structu 96.17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 96.15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 96.14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 96.13
3v30_A172 DNA-binding protein rfxank; structural genomics co 96.03
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 96.03
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 96.02
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 95.99
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 95.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 95.89
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 95.84
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 95.77
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 95.73
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 95.67
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 95.62
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 95.59
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 95.56
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 95.56
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 95.55
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 95.54
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 95.54
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 95.54
2rfa_A232 Transient receptor potential cation channel subfa 95.52
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 95.51
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 95.48
2etb_A256 Transient receptor potential cation channel subfam 95.43
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 95.41
3jxi_A260 Vanilloid receptor-related osmotically activated p 95.36
1sw6_A327 Regulatory protein SWI6; transcription regulation, 95.33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 95.32
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 95.3
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 95.29
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 95.29
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 95.26
3hra_A201 Ankyrin repeat family protein; structural protein; 95.24
3deo_A183 Signal recognition particle 43 kDa protein; chloro 95.21
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 95.2
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 95.14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 95.11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 95.07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 95.05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 95.05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 95.04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 95.03
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 95.02
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 95.0
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 94.99
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 94.94
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 94.93
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 94.81
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 94.73
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 94.7
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 94.67
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 94.57
2pnn_A273 Transient receptor potential cation channel subfa 94.54
3v30_A172 DNA-binding protein rfxank; structural genomics co 94.53
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 94.47
3hra_A201 Ankyrin repeat family protein; structural protein; 94.46
2rfa_A232 Transient receptor potential cation channel subfa 94.42
3v31_A167 Ankyrin repeat family A protein 2; structural geno 94.37
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 94.34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 94.23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 94.19
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 94.05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 93.95
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 93.92
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 93.85
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 93.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 93.81
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 93.57
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 93.54
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 92.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 92.77
3jxi_A260 Vanilloid receptor-related osmotically activated p 92.46
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 92.1
2etb_A256 Transient receptor potential cation channel subfam 92.09
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 91.98
2pnn_A273 Transient receptor potential cation channel subfa 91.95
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 91.78
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 91.16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 90.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 89.58
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 88.19
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 88.13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 87.91
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 84.85
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
Probab=97.21  E-value=6e-05  Score=55.52  Aligned_cols=51  Identities=27%  Similarity=0.407  Sum_probs=36.0

Q ss_pred             hccccCCCCchhhhhhhcCCCCccccccchhHHHHHHHHHHhhhhhhcCcchhhcccCCCCCccccchhh
Q 023260            9 VDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQ   78 (285)
Q Consensus         9 ~n~~D~~GNT~LHLAa~~~~~~~l~~~~gaalqm~~el~w~k~v~~~~~~~~~~~~N~dG~Tp~dif~~~   78 (285)
                      +|.+|.+|+||||+|+..++.+.++.+                ++.   ....+.+|++|.||.+.....
T Consensus        28 ~n~~d~~g~t~L~~A~~~~~~~~v~~L----------------l~~---ga~~~~~d~~g~t~l~~A~~~   78 (93)
T 1n0q_A           28 VNAKDKNGRTPLHLAARNGHLEVVKLL----------------LEA---GADVNAKDKNGRTPLHLAARN   78 (93)
T ss_dssp             TTCCCTTSCCHHHHHHHTTCHHHHHHH----------------HHT---TCCTTCCCTTSCCHHHHHHHT
T ss_pred             CcccCCCCCCHHHHHHHcCCHHHHHHH----------------HHc---CCCCCccCCCCCCHHHHHHHc
Confidence            588999999999999998864433211                111   124678899999998876543
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 97.61
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 97.52
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 97.35
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 97.31
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 97.29
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 97.18
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 97.17
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 97.09
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 96.93
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 96.9
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 96.75
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 96.73
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 96.67
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 96.63
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 96.47
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 96.44
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 96.38
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 96.28
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 96.25
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 96.25
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 96.22
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 96.21
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 95.99
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 95.67
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 94.87
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 94.85
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 94.78
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 93.79
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 92.79
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 92.13
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 91.23
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 91.22
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 86.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 86.1
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 83.36
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 80.93
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.61  E-value=7.2e-06  Score=62.52  Aligned_cols=18  Identities=22%  Similarity=0.156  Sum_probs=14.7

Q ss_pred             hhhcccCCCCCccccchh
Q 023260           60 LAEAKNKKGLTPRALFSE   77 (285)
Q Consensus        60 ~~~~~N~dG~Tp~dif~~   77 (285)
                      ..+.+|++|.||.++..+
T Consensus        93 d~~~~d~~G~t~l~~a~~  110 (118)
T d1myoa_          93 DKTVKGPDGLTALEATDN  110 (118)
T ss_dssp             CSSSSSSSTCCCCCTCSS
T ss_pred             cceeeCCCCCCHHHHHhH
Confidence            467889999999987744
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure