Citrus Sinensis ID: 023375


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
MFLAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
cccccccHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEcccEEEEEccEEEEccccEEccccEEEccccccccccccccccccccccEEEcccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEcccccEEEEcccccEEEcccccccccEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccc
cccccccHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEcEEEEEccccEEEccccEEcccEEEEEccccccHHHHHcccccccccEEEEcccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEccccEEEEccccEEEEccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MFLAGISEEEKSRLLHCVVvgggptgvefsgELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGivkdvdsqklilndgtevpyGLLVWstgvgpstlvksldlpkspggrigidewlrvpsvqdvfavgdcsgylestgktvLPALAQVAERQGKYLFSLLNRIgkagggransakdmelgdpfvyrhlgsmatIGRYKALVDLRQnkeskglslaGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVfgrdisri
MFLAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYAttqlsksgvrlvRGIVkdvdsqklilndgtevpYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAgggransakdmELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWattfvfgrdisri
MFLAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
************RLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGG*******MELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRD****
MFLAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDD*LR*YATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAG***********LGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
MFLAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
MFLAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGG********MELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query283 2.2.26 [Sep-21-2011]
Q8GWA1510 Alternative NAD(P)H dehyd yes no 0.992 0.550 0.836 1e-133
O80874508 Alternative NAD(P)H dehyd no no 0.985 0.549 0.827 1e-130
O43090551 Probable NADH-ubiquinone yes no 0.954 0.490 0.365 8e-46
Q55CD9451 Probable NADH dehydrogena yes no 0.918 0.576 0.375 5e-44
O14121551 Probable NADH-ubiquinone no no 0.957 0.491 0.338 7e-41
F2Z699582 External alternative NADH yes no 0.943 0.458 0.361 5e-31
P40215560 External NADH-ubiquinone yes no 0.929 0.469 0.359 6e-29
Q1JPL4571 NAD(P)H dehydrogenase B1, no no 0.551 0.273 0.387 1e-28
Q07500545 External NADH-ubiquinone no no 0.946 0.491 0.350 2e-28
P32340513 Rotenone-insensitive NADH no no 0.936 0.516 0.293 7e-24
>sp|Q8GWA1|NDA1_ARATH Alternative NAD(P)H dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 Back     alignment and function desciption
 Score =  473 bits (1218), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/281 (83%), Positives = 260/281 (92%)

Query: 3   LAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEI 62
           + GI E+EK RLLHCVVVGGGPTGVEFSGELSDFIM+DVRQRYSHVKD I VTLIEA +I
Sbjct: 230 VPGIGEDEKKRLLHCVVVGGGPTGVEFSGELSDFIMKDVRQRYSHVKDDIRVTLIEARDI 289

Query: 63  LSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTL 122
           LSSFDDRLRHYA  QL+KSGV+LVRGIVK+V  QKLIL+DGTEVPYG LVWSTGVGPS+ 
Sbjct: 290 LSSFDDRLRHYAIKQLNKSGVKLVRGIVKEVKPQKLILDDGTEVPYGPLVWSTGVGPSSF 349

Query: 123 VKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYL 182
           V+SLD PK PGGRIGIDEW+RVPSVQDVFA+GDCSGYLESTGK+ LPALAQVAER+GKYL
Sbjct: 350 VRSLDFPKDPGGRIGIDEWMRVPSVQDVFAIGDCSGYLESTGKSTLPALAQVAEREGKYL 409

Query: 183 FSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAG 242
            +L N +GKAGGGRANSAK+MELG+PFVY+HLGSMATIGRYKALVDLR++KE KG+S+AG
Sbjct: 410 ANLFNVMGKAGGGRANSAKEMELGEPFVYKHLGSMATIGRYKALVDLRESKEGKGISMAG 469

Query: 243 FLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI 283
           FLSW +WRSAYLTRVVSWRNRFYVA+NW TTFVFGRDISRI
Sbjct: 470 FLSWFIWRSAYLTRVVSWRNRFYVAINWLTTFVFGRDISRI 510





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: -EC: .EC: -
>sp|O80874|NDA2_ARATH Alternative NAD(P)H dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=1 SV=1 Back     alignment and function description
>sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 Back     alignment and function description
>sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 Back     alignment and function description
>sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 Back     alignment and function description
>sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 Back     alignment and function description
>sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 Back     alignment and function description
>sp|Q1JPL4|NDB1_ARATH NAD(P)H dehydrogenase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 Back     alignment and function description
>sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 Back     alignment and function description
>sp|P32340|NDI1_YEAST Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query283
357490831 566 hypothetical protein MTR_5g071250 [Medic 0.982 0.491 0.856 1e-134
449450824 505 PREDICTED: alternative NAD(P)H dehydroge 0.992 0.556 0.850 1e-133
356500874 485 PREDICTED: probable NADH dehydrogenase-l 0.992 0.579 0.836 1e-132
118488127 488 unknown [Populus trichocarpa] 0.992 0.575 0.854 1e-132
225434562 499 PREDICTED: probable NADH dehydrogenase [ 0.992 0.563 0.843 1e-132
356553084 485 PREDICTED: probable NADH dehydrogenase-l 0.992 0.579 0.832 1e-132
255560820 546 Rotenone-insensitive NADH-ubiquinone oxi 0.985 0.510 0.810 1e-132
21536893 510 putative NADH dehydrogenase (ubiquinone 0.992 0.550 0.839 1e-132
224104264 452 predicted protein [Populus trichocarpa] 0.992 0.621 0.854 1e-131
385274841 556 type II NAD(P)H dehydrogenase [Arum macu 0.985 0.501 0.802 1e-131
>gi|357490831|ref|XP_003615703.1| hypothetical protein MTR_5g071250 [Medicago truncatula] gi|355517038|gb|AES98661.1| hypothetical protein MTR_5g071250 [Medicago truncatula] Back     alignment and taxonomy information
 Score =  485 bits (1248), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/278 (85%), Positives = 262/278 (94%)

Query: 3   LAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEI 62
           + GISEEEK RLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRY+HVKDYIHVTLIEANEI
Sbjct: 221 VPGISEEEKKRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYAHVKDYIHVTLIEANEI 280

Query: 63  LSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTL 122
           LSSFDDRLRHYAT QL+KSGVRLVRGIVKDV  +K+ILNDGTEVPYGLLVWSTGVGPS  
Sbjct: 281 LSSFDDRLRHYATNQLTKSGVRLVRGIVKDVQEKKIILNDGTEVPYGLLVWSTGVGPSPF 340

Query: 123 VKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYL 182
           + SLDLPKSPGGRIGIDEWLRVPSVQD+F++GDCSG++ESTGK  LPALAQVAERQGKYL
Sbjct: 341 IHSLDLPKSPGGRIGIDEWLRVPSVQDIFSIGDCSGFVESTGKPTLPALAQVAERQGKYL 400

Query: 183 FSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAG 242
            +LLN++G+A GGRANS KD++LG+ FVY+HLGSMAT+G YKALVDLRQNK++KGLSLAG
Sbjct: 401 AALLNKVGEANGGRANSMKDIDLGNQFVYKHLGSMATVGSYKALVDLRQNKDAKGLSLAG 460

Query: 243 FLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDI 280
           FLSW VWRSAYLTRV+SWRNRFYVA+NWATTFVFGRDI
Sbjct: 461 FLSWFVWRSAYLTRVISWRNRFYVAINWATTFVFGRDI 498




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449450824|ref|XP_004143162.1| PREDICTED: alternative NAD(P)H dehydrogenase 1, mitochondrial-like [Cucumis sativus] gi|449523139|ref|XP_004168582.1| PREDICTED: alternative NAD(P)H dehydrogenase 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356500874|ref|XP_003519255.1| PREDICTED: probable NADH dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|118488127|gb|ABK95883.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225434562|ref|XP_002277505.1| PREDICTED: probable NADH dehydrogenase [Vitis vinifera] gi|297745883|emb|CBI15939.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553084|ref|XP_003544888.1| PREDICTED: probable NADH dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|255560820|ref|XP_002521423.1| Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial precursor, putative [Ricinus communis] gi|223539322|gb|EEF40913.1| Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|21536893|gb|AAM61225.1| putative NADH dehydrogenase (ubiquinone oxidoreductase) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224104264|ref|XP_002313376.1| predicted protein [Populus trichocarpa] gi|222849784|gb|EEE87331.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|385274841|dbj|BAM13875.1| type II NAD(P)H dehydrogenase [Arum maculatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query283
TAIR|locus:2007427510 NDA1 "AT1G07180" [Arabidopsis 0.985 0.547 0.842 9.6e-128
TAIR|locus:2045708508 NDA2 "AT2G29990" [Arabidopsis 0.985 0.549 0.827 3.4e-125
TAIR|locus:2123713571 NDB1 "AT4G28220" [Arabidopsis 0.547 0.271 0.390 4.5e-45
TAIR|locus:2119667580 NDB3 "AT4G21490" [Arabidopsis 0.547 0.267 0.398 2.5e-43
TAIR|locus:2051431582 NDB4 "AT2G20800" [Arabidopsis 0.540 0.262 0.407 2.8e-43
ASPGD|ASPL0000060585570 ndiF [Emericella nidulans (tax 0.628 0.312 0.381 4e-40
UNIPROTKB|G4N8E7587 MGG_06276 "Uncharacterized pro 0.614 0.296 0.379 1.1e-37
DICTYBASE|DDB_G0295661584 DDB_G0295661 "pyridine nucleot 0.639 0.309 0.353 4.2e-35
DICTYBASE|DDB_G0290197654 DDB_G0290197 "putative NADH de 0.367 0.159 0.4 6e-35
ASPGD|ASPL0000068060702 ndeA [Emericella nidulans (tax 0.614 0.247 0.328 7.1e-32
TAIR|locus:2007427 NDA1 "AT1G07180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1254 (446.5 bits), Expect = 9.6e-128, P = 9.6e-128
 Identities = 235/279 (84%), Positives = 259/279 (92%)

Query:     5 GISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILS 64
             GI E+EK RLLHCVVVGGGPTGVEFSGELSDFIM+DVRQRYSHVKD I VTLIEA +ILS
Sbjct:   232 GIGEDEKKRLLHCVVVGGGPTGVEFSGELSDFIMKDVRQRYSHVKDDIRVTLIEARDILS 291

Query:    65 SFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVK 124
             SFDDRLRHYA  QL+KSGV+LVRGIVK+V  QKLIL+DGTEVPYG LVWSTGVGPS+ V+
Sbjct:   292 SFDDRLRHYAIKQLNKSGVKLVRGIVKEVKPQKLILDDGTEVPYGPLVWSTGVGPSSFVR 351

Query:   125 SLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFS 184
             SLD PK PGGRIGIDEW+RVPSVQDVFA+GDCSGYLESTGK+ LPALAQVAER+GKYL +
Sbjct:   352 SLDFPKDPGGRIGIDEWMRVPSVQDVFAIGDCSGYLESTGKSTLPALAQVAEREGKYLAN 411

Query:   185 LLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFL 244
             L N +GKAGGGRANSAK+MELG+PFVY+HLGSMATIGRYKALVDLR++KE KG+S+AGFL
Sbjct:   412 LFNVMGKAGGGRANSAKEMELGEPFVYKHLGSMATIGRYKALVDLRESKEGKGISMAGFL 471

Query:   245 SWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI 283
             SW +WRSAYLTRVVSWRNRFYVA+NW TTFVFGRDISRI
Sbjct:   472 SWFIWRSAYLTRVVSWRNRFYVAINWLTTFVFGRDISRI 510




GO:0003954 "NADH dehydrogenase activity" evidence=ISS;IMP
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0071482 "cellular response to light stimulus" evidence=IEP
GO:0031304 "intrinsic to mitochondrial inner membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
TAIR|locus:2045708 NDA2 "AT2G29990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123713 NDB1 "AT4G28220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119667 NDB3 "AT4G21490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051431 NDB4 "AT2G20800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000060585 ndiF [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8E7 MGG_06276 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0295661 DDB_G0295661 "pyridine nucleotide-disulphide oxidoreductase, NAD-binding region domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290197 DDB_G0290197 "putative NADH dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000068060 ndeA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GWA1NDA1_ARATH1, ., 6, ., -, ., -0.83620.99290.5509yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 2e-97
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 5e-60
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 5e-20
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-19
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 2e-13
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 8e-11
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 5e-10
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 4e-08
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 8e-08
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 1e-07
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 3e-07
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 8e-07
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 2e-06
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 2e-06
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 5e-06
PRK14989 847 PRK14989, PRK14989, nitrite reductase subunit NirD 1e-05
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 2e-05
PLN02546558 PLN02546, PLN02546, glutathione reductase 2e-05
PLN02507499 PLN02507, PLN02507, glutathione reductase 5e-05
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 5e-05
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 6e-05
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 6e-05
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 2e-04
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 2e-04
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 3e-04
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 5e-04
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 0.004
TIGR02053463 TIGR02053, MerA, mercuric reductase 0.004
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
 Score =  292 bits (749), Expect = 2e-97
 Identities = 130/279 (46%), Positives = 172/279 (61%), Gaps = 22/279 (7%)

Query: 7   SEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEA-NEILSS 65
           S EE+ RLLH VVVGGGPTGVEF+ EL+DF   DVR     + +   VT++EA +E+L S
Sbjct: 166 SVEERKRLLHFVVVGGGPTGVEFAAELADFFRDDVRNLNPELVEECKVTVLEAGSEVLGS 225

Query: 66  FDDRLRHYATTQLSKSGVRLV-RGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVK 124
           FD  LR Y   +L + GV +  +  VK+V  ++++L DG  +P GL+VWSTGVGP  L K
Sbjct: 226 FDQALRKYGQRRLRRLGVDIRTKTAVKEVLDKEVVLKDGEVIPTGLVVWSTGVGPGPLTK 285

Query: 125 SLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFS 184
            L + K+  GRI +D+ LRV  + +VFA+GDC+    +  +  LP LAQVA +QG YL  
Sbjct: 286 QLKVDKTSRGRISVDDHLRVKPIPNVFALGDCA----ANEERPLPTLAQVASQQGVYLAK 341

Query: 185 LLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFL 244
             N          N  K   +  PFVYR LGS+A +G Y A+V L          L+GF 
Sbjct: 342 EFN----------NELKGKPMSKPFVYRSLGSLAYLGNYSAIVQL------GAFDLSGFK 385

Query: 245 SWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI 283
           + L WRSAYLT + SWR++ YV VNWA T +FGRDI+R 
Sbjct: 386 ALLFWRSAYLTILGSWRSKLYVLVNWAGTAIFGRDITRF 424


Length = 424

>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|184951 PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 283
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 99.94
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.93
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.93
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.92
PLN02507499 glutathione reductase 99.92
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.92
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.92
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.92
PRK07846451 mycothione reductase; Reviewed 99.91
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.91
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.91
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.91
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.91
PRK06116450 glutathione reductase; Validated 99.91
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.91
PRK06370463 mercuric reductase; Validated 99.9
PRK14727479 putative mercuric reductase; Provisional 99.9
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.9
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.9
PLN02546558 glutathione reductase 99.9
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.9
TIGR02053463 MerA mercuric reductase. This model represents the 99.9
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.9
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.9
PTZ00052499 thioredoxin reductase; Provisional 99.9
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.9
PRK13748561 putative mercuric reductase; Provisional 99.9
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.89
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.89
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.89
PRK14694468 putative mercuric reductase; Provisional 99.89
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.89
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.88
PTZ00058561 glutathione reductase; Provisional 99.88
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.88
PTZ00153659 lipoamide dehydrogenase; Provisional 99.87
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.87
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.86
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.86
PRK10262321 thioredoxin reductase; Provisional 99.84
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.84
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.83
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.83
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.82
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.82
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.82
PRK12831464 putative oxidoreductase; Provisional 99.8
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.8
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.8
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.79
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.79
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.79
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.77
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.76
PRK12814652 putative NADPH-dependent glutamate synthase small 99.76
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.76
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.75
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.74
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.74
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.73
PRK13984604 putative oxidoreductase; Provisional 99.71
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.7
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.68
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.67
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.66
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.65
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.65
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.64
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.58
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.5
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.48
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.42
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.39
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.35
PLN02852491 ferredoxin-NADP+ reductase 99.19
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.12
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.09
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 99.06
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.94
COG2081408 Predicted flavoproteins [General function predicti 98.9
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.88
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.88
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 98.87
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.83
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.82
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.82
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.79
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 98.78
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.78
PRK06116 450 glutathione reductase; Validated 98.77
KOG03992142 consensus Glutamate synthase [Amino acid transport 98.77
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.77
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.75
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 98.74
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.74
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.74
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.7
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.7
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.67
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 98.66
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.65
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.64
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 98.64
PRK10262321 thioredoxin reductase; Provisional 98.63
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 98.62
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.61
PRK06847375 hypothetical protein; Provisional 98.61
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.61
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 98.59
PLN02463 447 lycopene beta cyclase 98.58
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.57
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.54
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.54
PRK07845 466 flavoprotein disulfide reductase; Reviewed 98.54
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 98.53
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.52
PRK06370 463 mercuric reductase; Validated 98.51
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.5
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 98.48
PRK12831464 putative oxidoreductase; Provisional 98.48
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.48
TIGR02053 463 MerA mercuric reductase. This model represents the 98.47
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 98.47
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.45
PLN02852 491 ferredoxin-NADP+ reductase 98.44
PLN02546 558 glutathione reductase 98.44
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.43
PRK07236386 hypothetical protein; Provisional 98.43
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.42
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 98.41
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.38
KOG2755334 consensus Oxidoreductase [General function predict 98.37
KOG1336 478 consensus Monodehydroascorbate/ferredoxin reductas 98.36
PRK06567 1028 putative bifunctional glutamate synthase subunit b 98.35
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.34
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.34
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 98.33
PRK14694 468 putative mercuric reductase; Provisional 98.33
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 98.33
PRK06834 488 hypothetical protein; Provisional 98.32
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.31
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.31
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.31
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 98.28
PLN02697 529 lycopene epsilon cyclase 98.26
PLN02661357 Putative thiazole synthesis 98.26
PTZ00058 561 glutathione reductase; Provisional 98.23
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.22
PLN02507 499 glutathione reductase 98.21
PRK08163396 salicylate hydroxylase; Provisional 98.21
PRK07588391 hypothetical protein; Provisional 98.21
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.2
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.2
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.2
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.19
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.19
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 98.19
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.19
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 98.18
PRK13748 561 putative mercuric reductase; Provisional 98.16
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.14
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.14
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.14
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.14
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.12
PRK08244 493 hypothetical protein; Provisional 98.11
PRK05868372 hypothetical protein; Validated 98.1
PRK07846 451 mycothione reductase; Reviewed 98.1
PRK06184 502 hypothetical protein; Provisional 98.1
PTZ00188 506 adrenodoxin reductase; Provisional 98.09
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.09
PRK11728393 hydroxyglutarate oxidase; Provisional 98.08
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 98.08
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 98.06
PRK06753373 hypothetical protein; Provisional 98.06
PRK09126392 hypothetical protein; Provisional 98.06
PRK06567 1028 putative bifunctional glutamate synthase subunit b 98.05
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.05
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.04
PTZ00052 499 thioredoxin reductase; Provisional 98.04
PRK07190 487 hypothetical protein; Provisional 98.03
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.03
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.02
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.01
KOG0404322 consensus Thioredoxin reductase [Posttranslational 98.0
PRK10157428 putative oxidoreductase FixC; Provisional 98.0
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.99
PRK13984604 putative oxidoreductase; Provisional 97.99
PRK09897 534 hypothetical protein; Provisional 97.99
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.98
PRK08013400 oxidoreductase; Provisional 97.98
PRK07045388 putative monooxygenase; Reviewed 97.97
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.97
COG0579429 Predicted dehydrogenase [General function predicti 97.96
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.96
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 97.95
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.94
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.94
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 97.93
PRK06475400 salicylate hydroxylase; Provisional 97.92
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.92
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.91
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.91
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.9
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.9
PRK06996398 hypothetical protein; Provisional 97.89
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.89
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.88
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 97.88
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.88
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.87
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.87
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 97.86
PRK14727 479 putative mercuric reductase; Provisional 97.85
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.84
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.82
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.81
PRK06185407 hypothetical protein; Provisional 97.8
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.78
PRK10015 429 oxidoreductase; Provisional 97.78
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.78
KOG2755334 consensus Oxidoreductase [General function predict 97.77
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 97.75
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.75
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 97.73
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.72
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.72
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.7
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.69
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.66
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 97.65
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.64
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.64
PTZ00153 659 lipoamide dehydrogenase; Provisional 97.62
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.59
KOG2495 491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.59
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.59
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 97.58
PRK07538 413 hypothetical protein; Provisional 97.57
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.57
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.55
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 97.55
PRK06126 545 hypothetical protein; Provisional 97.51
PRK11445351 putative oxidoreductase; Provisional 97.45
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.44
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.43
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.42
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.39
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.39
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.38
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 97.38
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.36
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 97.35
PLN02985 514 squalene monooxygenase 97.3
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.26
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.26
PRK08401 466 L-aspartate oxidase; Provisional 97.22
PTZ00383497 malate:quinone oxidoreductase; Provisional 97.2
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.15
PRK08294 634 phenol 2-monooxygenase; Provisional 97.1
KOG1335 506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.1
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 97.06
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.05
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 96.94
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 96.82
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 96.72
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 96.69
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.66
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.63
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 96.58
KOG0405 478 consensus Pyridine nucleotide-disulphide oxidoredu 96.57
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 96.56
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.53
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 96.49
PRK07804 541 L-aspartate oxidase; Provisional 96.48
KOG2852 380 consensus Possible oxidoreductase [General functio 96.43
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 96.43
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.37
PRK08275 554 putative oxidoreductase; Provisional 96.36
PRK06175433 L-aspartate oxidase; Provisional 96.33
KOG1800 468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 96.33
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.32
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 96.31
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 96.3
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 96.28
PRK11883 451 protoporphyrinogen oxidase; Reviewed 96.25
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 96.23
PTZ00367 567 squalene epoxidase; Provisional 96.21
PRK15116268 sulfur acceptor protein CsdL; Provisional 96.18
COG3349 485 Uncharacterized conserved protein [Function unknow 96.13
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 96.03
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 96.0
PLN02268 435 probable polyamine oxidase 95.99
PRK07233 434 hypothetical protein; Provisional 95.98
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 95.97
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.94
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 95.9
PRK07208 479 hypothetical protein; Provisional 95.89
KOG2853 509 consensus Possible oxidoreductase [General functio 95.88
COG4529474 Uncharacterized protein conserved in bacteria [Fun 95.81
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 95.79
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 95.78
KOG4716 503 consensus Thioredoxin reductase [Posttranslational 95.71
PRK12416 463 protoporphyrinogen oxidase; Provisional 95.7
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 95.66
PLN02487 569 zeta-carotene desaturase 95.65
PLN02464 627 glycerol-3-phosphate dehydrogenase 95.61
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 95.5
PLN02576 496 protoporphyrinogen oxidase 95.5
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 95.49
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 95.38
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 95.22
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.22
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 95.21
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 95.2
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 95.18
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 95.18
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 95.17
KOG1276 491 consensus Protoporphyrinogen oxidase [Coenzyme tra 95.16
PRK05708305 2-dehydropantoate 2-reductase; Provisional 95.11
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.06
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 95.05
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 95.03
PLN02529 738 lysine-specific histone demethylase 1 95.0
PRK07121 492 hypothetical protein; Validated 95.0
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.99
COG2907 447 Predicted NAD/FAD-binding protein [General functio 94.91
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.75
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 94.75
PRK06719157 precorrin-2 dehydrogenase; Validated 94.74
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.64
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 94.62
PRK12842 574 putative succinate dehydrogenase; Reviewed 94.59
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 94.58
PRK05257 494 malate:quinone oxidoreductase; Validated 94.58
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 94.53
PRK08274 466 tricarballylate dehydrogenase; Validated 94.46
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 94.46
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.35
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 94.33
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.32
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.31
PLN02328 808 lysine-specific histone demethylase 1 homolog 94.25
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.24
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 94.04
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 93.96
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 93.94
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 93.93
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.88
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.82
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.76
PLN02676 487 polyamine oxidase 93.7
PLN02612 567 phytoene desaturase 93.68
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 93.67
PRK13339 497 malate:quinone oxidoreductase; Reviewed 93.64
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 93.62
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.56
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 93.55
PRK13977 576 myosin-cross-reactive antigen; Provisional 93.49
PRK02106 560 choline dehydrogenase; Validated 93.48
PRK12921305 2-dehydropantoate 2-reductase; Provisional 93.44
PLN03000 881 amine oxidase 93.38
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 93.33
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 93.27
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.27
PTZ00188506 adrenodoxin reductase; Provisional 93.26
PLN02568 539 polyamine oxidase 93.23
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 93.23
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 93.21
KOG2404 477 consensus Fumarate reductase, flavoprotein subunit 93.12
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 93.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 92.98
PRK12842 574 putative succinate dehydrogenase; Reviewed 92.95
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 92.89
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 92.83
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 92.75
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 92.68
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 92.52
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 92.43
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 92.37
PRK08229341 2-dehydropantoate 2-reductase; Provisional 92.28
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 92.22
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 92.18
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 92.14
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.12
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 92.07
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.07
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 92.06
PRK08328231 hypothetical protein; Provisional 92.01
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.98
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 91.94
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 91.85
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 91.83
PRK05562223 precorrin-2 dehydrogenase; Provisional 91.76
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 91.73
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 91.68
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 91.68
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 91.67
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 91.64
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 91.62
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.62
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.54
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 91.37
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 91.28
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.25
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.25
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 91.19
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 91.16
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 91.15
TIGR02730493 carot_isom carotene isomerase. Members of this fam 91.12
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 91.08
PRK08223287 hypothetical protein; Validated 91.02
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 90.97
PLN02602350 lactate dehydrogenase 90.91
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 90.88
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 90.87
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 90.81
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 90.78
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 90.72
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 90.7
cd01483143 E1_enzyme_family Superfamily of activating enzymes 90.7
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 90.68
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 90.58
PRK04148134 hypothetical protein; Provisional 90.52
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.51
PLN02612567 phytoene desaturase 90.42
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 90.18
PLN02976 1713 amine oxidase 90.16
PRK08275554 putative oxidoreductase; Provisional 90.1
PLN02785 587 Protein HOTHEAD 89.97
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 89.93
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 89.7
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.6
KOG3855 481 consensus Monooxygenase involved in coenzyme Q (ub 89.56
PRK07411390 hypothetical protein; Validated 89.54
PRK05600370 thiamine biosynthesis protein ThiF; Validated 89.43
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 89.31
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 89.3
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 89.27
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 89.25
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 89.19
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 89.09
PLN02735 1102 carbamoyl-phosphate synthase 89.03
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 88.99
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 88.95
PRK09231582 fumarate reductase flavoprotein subunit; Validated 88.78
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 88.75
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 88.73
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.69
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 88.68
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 88.66
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 88.62
PRK12839 572 hypothetical protein; Provisional 88.61
COG0421282 SpeE Spermidine synthase [Amino acid transport and 88.59
COG3573 552 Predicted oxidoreductase [General function predict 88.58
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 88.57
TIGR03378 419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 88.57
PRK07395 553 L-aspartate oxidase; Provisional 88.57
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 88.52
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 88.5
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 88.49
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 88.47
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 88.45
PRK08071 510 L-aspartate oxidase; Provisional 88.4
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 88.38
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 88.29
PRK06153393 hypothetical protein; Provisional 88.28
PRK11730 715 fadB multifunctional fatty acid oxidation complex 88.26
PRK13339497 malate:quinone oxidoreductase; Reviewed 88.2
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 88.14
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 88.09
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 87.93
PRK05442326 malate dehydrogenase; Provisional 87.88
KOG1495332 consensus Lactate dehydrogenase [Energy production 87.61
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 87.57
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 87.53
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 87.46
PLN00112444 malate dehydrogenase (NADP); Provisional 87.37
PRK00536262 speE spermidine synthase; Provisional 87.33
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 87.33
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 87.32
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 87.17
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 87.14
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 87.03
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 87.02
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.0
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 86.99
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 86.86
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 86.74
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 86.62
PRK09077 536 L-aspartate oxidase; Provisional 86.55
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 86.49
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 86.37
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 86.27
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 85.98
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.98
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=1.7e-54  Score=379.11  Aligned_cols=272  Identities=50%  Similarity=0.849  Sum_probs=242.8

Q ss_pred             CCCCCHHHHcccCeEEEEccCcHHHHHHHHHHHhhhhHHHhhcCCCCCccEEEEEeCC-CCCCCCCHHHHHHHHHHHHhC
Q 023375            3 LAGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEAN-EILSSFDDRLRHYATTQLSKS   81 (283)
Q Consensus         3 ~~~~~~~~~~~~~~vvVvGgG~~Gve~A~~L~~~~~~~~~~~~~~~~~~~~V~li~~~-~~l~~~~~~~~~~~~~~l~~~   81 (283)
                      .|+..+|||++.+++|||||||+|+|+|+||+++...++.+-||+++++.+|||+|+. .+|+.|+..+.+++++.+.+.
T Consensus       207 ~~~l~~eerkRlLh~VVVGGGPTGVEFAaEL~Dfi~~Dl~k~yp~l~~~i~vtLiEA~d~iL~mFdkrl~~yae~~f~~~  286 (491)
T KOG2495|consen  207 LPGLSDEERKRLLHFVVVGGGPTGVEFAAELADFIPEDLRKIYPELKKDIKVTLIEAADHILNMFDKRLVEYAENQFVRD  286 (491)
T ss_pred             cCCCChHHhhheEEEEEECCCCcceeehHHHHHHHHHHHHHhhhcchhheEEEeeccchhHHHHHHHHHHHHHHHHhhhc
Confidence            4788999999999999999999999999999999999999999999999999999998 799999999999999999999


Q ss_pred             CCEEEeC-ceEEEeCCeEEEcCC----cEEEeeEEEEcCCCCCchhhhccCCCCCCCC--ccccCCCcccCCCCCEEEec
Q 023375           82 GVRLVRG-IVKDVDSQKLILNDG----TEVPYGLLVWSTGVGPSTLVKSLDLPKSPGG--RIGIDEWLRVPSVQDVFAVG  154 (283)
Q Consensus        82 gV~v~~~-~V~~v~~~~v~~~~g----~~i~~d~vi~a~G~~~~~~~~~~~l~~~~~g--~i~Vd~~l~~~~~~~VfaiG  154 (283)
                      ||++.++ .|..|+++.+..+.+    ++|||.+++|+||..|.++...+....++.|  ++.||++||+++.+||||+|
T Consensus       287 ~I~~~~~t~Vk~V~~~~I~~~~~~g~~~~iPYG~lVWatG~~~rp~~k~lm~~i~e~~rr~L~vDE~LrV~G~~nvfAiG  366 (491)
T KOG2495|consen  287 GIDLDTGTMVKKVTEKTIHAKTKDGEIEEIPYGLLVWATGNGPRPVIKDLMKQIDEQGRRGLAVDEWLRVKGVKNVFAIG  366 (491)
T ss_pred             cceeecccEEEeecCcEEEEEcCCCceeeecceEEEecCCCCCchhhhhHhhcCCccCceeeeeeceeeccCcCceEEec
Confidence            9999999 799999998887654    6899999999999999999998877777777  79999999999999999999


Q ss_pred             cccccCcCCCCcCCCcchHHHHHHHHHHHHHHHHHhhhCCCCCCCc-----CCCCCCCCceeeecccEEEecCcceeEec
Q 023375          155 DCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSA-----KDMELGDPFVYRHLGSMATIGRYKALVDL  229 (283)
Q Consensus       155 D~a~~~~~~~~~~~p~~~~~A~~qg~~~a~~i~~~~~~~~g~~~~~-----~~~~~~~~~~~~~~g~~~slG~~~av~~~  229 (283)
                      ||+..      ...+++||+|.|||.++|++++...+..+......     ......+||+|+++|++++||+++|++++
T Consensus       367 Dca~~------~~~~~tAQVA~QqG~yLAk~fn~m~k~~~~~e~~~~r~~~~~~~~f~PF~Y~H~GalA~lG~ekaiAdl  440 (491)
T KOG2495|consen  367 DCADQ------RGLKPTAQVAEQQGAYLAKNFNKMGKGGNLPEGPSARLRGEGRHQFKPFKYKHLGALAYLGREKAIADL  440 (491)
T ss_pred             ccccc------ccCccHHHHHHHHHHHHHHHHHHHhcccCCCccchhhhhhhhhhccCCcccccccceeeccccchhhcC
Confidence            99954      34578999999999999999998876543311000     01111389999999999999999999998


Q ss_pred             cccccCCCeeeecHHHHHHHHHHHHHhcCCchhHHHHHHHHHHHhccCCCCCCC
Q 023375          230 RQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI  283 (283)
Q Consensus       230 ~~~~~~~~~~~~G~~a~~~~~~~~~~~~~~~~~r~~~~~~w~~~~~~~~~~~~~  283 (283)
                      +.   ...+...|..+|++|+++|+.++.|||+|+.|++||++.+|||||++++
T Consensus       441 ~~---g~~~~~~G~~s~~lWrS~Yls~~~S~R~R~lV~~dW~~~~~fGRd~s~i  491 (491)
T KOG2495|consen  441 PV---GKMWVSAGGSSFWLWRSAYLSKLVSWRNRFLVAIDWEKTFFFGRDSSSI  491 (491)
T ss_pred             cc---CCeeeeccchhhHHHHHHHHHHhhhhhhheeeeeheeeeEEeccccccC
Confidence            63   1238999999999999999999999999999999999999999999875



>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
4g9k_A471 Structure Of The Ndi1 Protein From Saccharomyces Ce 6e-25
4g6g_A502 Crystal Structure Of Ndh With Trt Length = 502 6e-25
2jk6_A511 Structure Of Trypanothione Reductase From Leishmani 1e-05
2x50_A510 Crystal Structure Of Trypanothione Reductase From L 1e-05
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 6e-05
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 1e-04
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 1e-04
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 1e-04
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 1e-04
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 2e-04
1lvl_A458 The Refined Structure Of Pseudomonas Putida Lipoami 4e-04
1xhc_A367 Nadh Oxidase /nitrite Reductase From Pyrococcus Fur 7e-04
>pdb|4G9K|A Chain A, Structure Of The Ndi1 Protein From Saccharomyces Cerevisiae Length = 471 Back     alignment and structure

Iteration: 1

Score = 110 bits (276), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 87/296 (29%), Positives = 157/296 (53%), Gaps = 31/296 (10%) Query: 8 EEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEI-LSSF 66 + E+ RLL VVVGGGPTGVE +GEL D++ +D+R+ + + + + L+EA I L+ F Sbjct: 180 DPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMF 239 Query: 67 DDRLRHYATTQLSKSGVRL-VRGIVKDVDSQKLILNDGTE--------VPYGLLVWSTGV 117 + +L YA + L + +++ +R V V+ ++L+ E +PYG L+W+TG Sbjct: 240 EKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGN 299 Query: 118 GPSTLVKSL--DLPKSPGGR--IGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQ 173 ++ L +P+ + + ++++L+V ++FA+GD + LP AQ Sbjct: 300 KARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAF-------AGLPPTAQ 352 Query: 174 VAERQGKYLFSLLNRIGKAGGGRAN--SAKD-----MELGD--PFVYRHLGSMATIGRYK 224 VA ++ +YL +++ + + N S KD E + PF Y LG++A +G + Sbjct: 353 VAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKYNDLGALAYLGSER 412 Query: 225 ALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDI 280 A+ +R K + + G +++ +WR YL+ ++S R+R V +W F RD Sbjct: 413 AIATIRSGKRT-FYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDF 467
>pdb|4G6G|A Chain A, Crystal Structure Of Ndh With Trt Length = 502 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|1LVL|A Chain A, The Refined Structure Of Pseudomonas Putida Lipoamide Dehydrogenase Complexed With Nad+ At 2.45 Angstroms Resolution Length = 458 Back     alignment and structure
>pdb|1XHC|A Chain A, Nadh Oxidase /nitrite Reductase From Pyrococcus Furiosus Pfu-1140779- 001 Length = 367 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 1e-21
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 6e-04
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 6e-21
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 6e-21
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-19
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 1e-19
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 3e-19
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 6e-19
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 5e-17
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 6e-17
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 8e-17
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 3e-16
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 3e-16
1fec_A490 Trypanothione reductase; redox-active center, oxid 3e-16
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 4e-16
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 5e-16
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 2e-15
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 9e-15
4dna_A463 Probable glutathione reductase; structural genomic 3e-14
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 2e-13
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 4e-13
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 5e-12
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 1e-11
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 1e-11
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 2e-11
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 3e-11
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 4e-11
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 8e-11
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 1e-10
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 1e-10
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 3e-09
4fk1_A304 Putative thioredoxin reductase; structural genomic 6e-09
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 7e-08
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 1e-07
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 1e-07
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 5e-07
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 7e-07
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 1e-06
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 3e-06
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 5e-06
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 1e-05
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 1e-05
1fcd_A 401 Flavocytochrome C sulfide dehydrogenase (flavin- b 1e-05
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 2e-05
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 3e-05
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 1e-04
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 2e-04
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 3e-04
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
 Score = 92.5 bits (230), Expect = 1e-21
 Identities = 40/280 (14%), Positives = 80/280 (28%), Gaps = 41/280 (14%)

Query: 19  VVGGGPTGVEFSG---ELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDR----LR 71
           +V G   G    G   E +  I+    ++          T I +   +     +     +
Sbjct: 153 IVIGAMAGASCFGPAYEYA-MIVASDLKKRGMRDKIPSFTFITSEPYIGHLGIQGVGDSK 211

Query: 72  HYATTQLSKSGVRLVRG-IVKDVDSQKLILNDGT---------EVPYGLLVWSTGVGPST 121
              T  L + G+       V  V+  K+ +              +P    +         
Sbjct: 212 GILTKGLKEEGIEAYTNCKVTKVEDNKMYVTQVDEKGETIKEMVLPVKFGMMIPAFKGVP 271

Query: 122 LVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGK---TVLPALAQVAERQ 178
            V  ++   +PGG + +DE  R     ++FA G              T  P    + E  
Sbjct: 272 AVAGVEGLCNPGGFVLVDEHQRSKKYANIFAAGIAIAIPPVETTPVPTGAPKTGYMIESM 331

Query: 179 GKYL-FSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKA-LVDLRQNKESK 236
                 ++   +           +  +        +  + A +G   A  + L Q K  K
Sbjct: 332 VSAAVHNIKADL-----------EGRKGEQTMGTWNAVAFADMGDRGAAFIALPQLKPRK 380

Query: 237 GLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVF 276
                   ++  W   +L +V  +   F   +    +  F
Sbjct: 381 ----VDVFAYGRW--VHLAKVA-FEKYFIRKMKMGVSEPF 413


>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query283
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.97
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.96
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.95
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.95
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.93
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.93
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.93
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.93
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.93
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.93
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.92
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.92
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.92
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.92
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.92
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.92
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.92
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.92
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.92
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.92
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.92
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.92
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.92
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.92
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.92
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.92
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.92
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.91
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.91
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.91
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.91
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.91
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.91
4dna_A463 Probable glutathione reductase; structural genomic 99.91
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.91
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.91
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.91
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.91
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.91
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.91
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.91
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.91
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.9
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.9
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.9
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.9
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.9
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.9
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.9
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.9
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.9
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.9
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.9
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.9
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.89
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.89
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.89
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.89
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.89
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.89
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.89
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.88
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.88
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.88
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.88
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.88
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.87
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.87
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.86
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.86
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.85
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.85
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.85
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.84
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.83
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.83
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.83
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.78
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.76
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.76
2cul_A232 Glucose-inhibited division protein A-related PROT 99.76
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.76
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.74
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.73
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.72
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.67
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.66
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.65
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.59
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.58
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.48
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.48
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.44
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.36
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.06
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 99.03
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.01
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 99.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.0
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.99
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.99
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.96
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.93
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.92
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.92
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.91
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.9
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.9
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.88
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.87
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.87
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.85
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.84
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.84
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.84
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.81
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.81
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 98.81
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.8
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 98.8
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.8
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.8
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.79
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.78
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.78
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.77
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.75
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.75
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.73
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.72
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.71
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.7
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.69
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.69
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 98.68
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.68
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.67
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.67
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.67
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.66
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.64
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 98.64
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 98.63
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.62
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.62
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.62
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.61
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 98.61
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.61
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.6
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.59
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.59
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 98.59
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.59
4dna_A 463 Probable glutathione reductase; structural genomic 98.58
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.58
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.57
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.57
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 98.56
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 98.56
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.56
1fec_A 490 Trypanothione reductase; redox-active center, oxid 98.56
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.54
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.54
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.52
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.51
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.51
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 98.51
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.51
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 98.5
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.5
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.5
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.49
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.47
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 98.47
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.47
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.45
3dme_A369 Conserved exported protein; structural genomics, P 98.45
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.45
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.44
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.43
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.42
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.42
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.42
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.4
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.4
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.4
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.4
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.39
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 98.39
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.38
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.38
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.36
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.36
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.36
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.35
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 98.35
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.34
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.33
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.33
1ojt_A 482 Surface protein; redox-active center, glycolysis, 98.33
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.32
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.31
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.31
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.28
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.28
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 98.27
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.27
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.27
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.27
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.27
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.26
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.24
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.22
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.22
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.21
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.21
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.21
3atr_A 453 Conserved archaeal protein; saturating double bond 98.19
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.19
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.18
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.18
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.18
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.17
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.16
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.16
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.15
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.15
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.14
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.11
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.06
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.06
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.06
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.05
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.98
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.98
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 97.93
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.92
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.89
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.88
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.87
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.86
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.84
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.84
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.84
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.81
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.76
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.71
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.62
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 97.61
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.6
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.43
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.32
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.28
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.26
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.24
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.23
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.1
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.99
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 96.93
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.53
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 96.48
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 96.39
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.36
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.34
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 96.29
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 96.28
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 96.21
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.15
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.1
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 96.03
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.0
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 95.96
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 95.94
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 95.7
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 95.65
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 95.64
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 95.61
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 95.61
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 95.59
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 95.58
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 95.43
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 95.41
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 95.37
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 95.35
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.31
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 95.13
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 95.12
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 95.12
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 94.88
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 94.82
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.75
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 94.71
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.53
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.52
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.51
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.43
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 94.16
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 94.09
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.01
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 93.98
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 93.82
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 93.7
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.67
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 93.52
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 93.5
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 93.49
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 93.44
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 93.32
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.26
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 93.25
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 93.21
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.18
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.16
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.13
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 93.02
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 92.93
3c85_A183 Putative glutathione-regulated potassium-efflux S 92.81
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.73
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 92.67
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 92.44
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 92.41
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.15
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 92.05
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 92.04
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 92.01
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 91.84
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 91.6
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 91.51
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 91.25
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 91.21
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 91.21
4g65_A 461 TRK system potassium uptake protein TRKA; structur 91.11
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 91.04
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 91.03
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 90.97
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 90.89
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 90.88
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 90.73
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 90.72
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 90.62
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 90.36
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 90.3
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 90.28
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.26
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 90.24
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 90.2
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 90.14
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 89.83
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 89.65
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 89.57
2gqf_A401 Hypothetical protein HI0933; structural genomics, 89.44
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.42
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 88.99
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 88.99
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 88.91
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 88.73
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 88.51
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 88.46
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 88.03
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 87.56
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 87.54
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 87.41
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 87.37
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 87.36
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 87.13
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 87.11
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 87.08
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 86.96
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 86.96
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 86.86
3ius_A286 Uncharacterized conserved protein; APC63810, silic 86.72
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 86.53
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 86.48
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 86.46
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 86.41
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 86.24
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 86.18
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 86.12
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 86.11
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 86.08
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 85.98
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 85.92
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 85.87
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 85.7
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 85.68
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 85.58
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 85.52
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 85.47
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 85.31
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 85.25
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 85.17
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 85.13
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 85.11
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 85.1
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 85.09
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 85.05
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 85.05
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 85.01
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 84.97
2rir_A300 Dipicolinate synthase, A chain; structural genomic 84.96
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 84.8
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 84.77
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 84.66
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 84.59
4g65_A461 TRK system potassium uptake protein TRKA; structur 84.56
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 84.51
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 84.49
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 84.45
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 84.45
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 84.31
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 84.28
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 84.13
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 84.07
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 84.06
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 84.01
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 83.93
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 83.77
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 83.65
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 83.5
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 83.46
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 83.33
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 83.11
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 83.08
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 83.02
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 82.82
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 82.75
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 82.75
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 82.72
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 82.67
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 82.59
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 82.57
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 82.56
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 82.5
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 82.32
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 82.27
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 82.17
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 82.16
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 82.08
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 82.02
3tl2_A315 Malate dehydrogenase; center for structural genomi 81.85
4f6c_A 427 AUSA reductase domain protein; thioester reductase 81.84
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 81.8
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 81.64
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 81.57
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 81.54
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 81.54
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 81.5
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 81.49
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 81.49
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 81.36
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 81.2
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 81.13
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 80.8
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 80.76
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 80.63
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 80.51
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 80.46
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 80.42
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 80.42
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 80.39
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 80.37
1vpd_A299 Tartronate semialdehyde reductase; structural geno 80.3
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 80.18
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 80.14
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 80.11
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 80.09
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 80.06
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 80.01
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
Probab=100.00  E-value=2.6e-52  Score=391.14  Aligned_cols=267  Identities=30%  Similarity=0.616  Sum_probs=225.9

Q ss_pred             CHHHHcccCeEEEEccCcHHHHHHHHHHHhhhhHHHhhcCCCCCccEEEEEeCC-CCCCCCCHHHHHHHHHHHHhCCCEE
Q 023375            7 SEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEAN-EILSSFDDRLRHYATTQLSKSGVRL   85 (283)
Q Consensus         7 ~~~~~~~~~~vvVvGgG~~Gve~A~~L~~~~~~~~~~~~~~~~~~~~V~li~~~-~~l~~~~~~~~~~~~~~l~~~gV~v   85 (283)
                      +++++++.++++|||||++|+|+|.+|+++....+.+.||.+..+.+|+|+++. +++|.+++++++++.+.|+++||++
T Consensus       210 ~~~~~~~~~~vvVvGgG~tGvE~A~~l~~~~~~~l~~~~~~~~~~~~V~lve~~~~il~~~~~~~~~~~~~~L~~~GV~v  289 (502)
T 4g6h_A          210 GDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKV  289 (502)
T ss_dssp             TCHHHHHHTEEEEECCSHHHHHHHHHHHHHHHHTHHHHCHHHHHHCEEEEECSSSSSSTTSCHHHHHHHHHHHHHTTCEE
T ss_pred             cchhhccccceEEECCCcchhhhHHHHHHHHHHHHHhhcccccccceeEEeccccccccCCCHHHHHHHHHHHHhcceee
Confidence            344567788999999999999999999999887777777776667999999998 8999999999999999999999999


Q ss_pred             EeC-ceEEEeCCeEEE----cCC----cEEEeeEEEEcCCCCCchhhhc----cCCCCCCCCccccCCCcccCCCCCEEE
Q 023375           86 VRG-IVKDVDSQKLIL----NDG----TEVPYGLLVWSTGVGPSTLVKS----LDLPKSPGGRIGIDEWLRVPSVQDVFA  152 (283)
Q Consensus        86 ~~~-~V~~v~~~~v~~----~~g----~~i~~d~vi~a~G~~~~~~~~~----~~l~~~~~g~i~Vd~~l~~~~~~~Vfa  152 (283)
                      +++ +|++++++.+.+    .||    +++++|+||||+|.+|+++..+    ++...+.+|+|.||++||++++|||||
T Consensus       290 ~~~~~v~~v~~~~~~~~~~~~dg~~~~~~i~ad~viwa~Gv~~~~~~~~l~~~~~~~~~~~g~I~Vd~~lq~~~~~~IfA  369 (502)
T 4g6h_A          290 HLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFA  369 (502)
T ss_dssp             ETTEEEEEECSSEEEEEEECTTSCEEEEEEECSEEEECCCEECCHHHHHHHHHSGGGTTCCSSEEBCTTSBBTTCSSEEE
T ss_pred             ecCceEEEEeCCceEEEEEecCcccceeeeccCEEEEccCCcCCHHHHhHHHhccccccCCCceeECCccccCCCCCEEE
Confidence            999 899999997655    354    3699999999999999965443    456667789999999999999999999


Q ss_pred             eccccccCcCCCCcCCCcchHHHHHHHHHHHHHHHHHhhhCC------CCCC----CcCCCCCCCCceeeecccEEEecC
Q 023375          153 VGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGG------GRAN----SAKDMELGDPFVYRHLGSMATIGR  222 (283)
Q Consensus       153 iGD~a~~~~~~~~~~~p~~~~~A~~qg~~~a~~i~~~~~~~~------g~~~----~~~~~~~~~~~~~~~~g~~~slG~  222 (283)
                      +|||+..       +.|++++.|.+||+++|+||.+..+...      ....    ..+..++ +||.|+++|+|+|||+
T Consensus       370 iGD~a~~-------~~p~~a~~A~qqg~~~A~ni~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~pF~y~~~G~~a~lG~  441 (502)
T 4g6h_A          370 IGDNAFA-------GLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNF-KPFKYNDLGALAYLGS  441 (502)
T ss_dssp             CGGGEES-------SSCCCHHHHHHHHHHHHHHHHHHTTCHHHHHHTTSSSCCHHHHHHHTTC-CCCCCCCCEEEEECST
T ss_pred             EEcccCC-------CCCCchHHHHHHHHHHHHHHHHHhccchhhhhhhhccchhhhhhcCCCC-CCCEecCcceEEEEeC
Confidence            9999974       5699999999999999999987542100      0000    0011233 8999999999999999


Q ss_pred             cceeEeccccccCCCeeeecHHHHHHHHHHHHHhcCCchhHHHHHHHHHHHhccCCCCCC
Q 023375          223 YKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISR  282 (283)
Q Consensus       223 ~~av~~~~~~~~~~~~~~~G~~a~~~~~~~~~~~~~~~~~r~~~~~~w~~~~~~~~~~~~  282 (283)
                      ++||+++.+... .++.+.|++||++|+++|+++++++|+|+.|++||++.+||+||++|
T Consensus       442 ~~av~~~~~~~~-~~~~~~G~~a~~~w~~~yl~~l~~~r~r~~v~~~W~~~~~fgRdisr  500 (502)
T 4g6h_A          442 ERAIATIRSGKR-TFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFK  500 (502)
T ss_dssp             TCEEEEEEETTE-EEEEEEEHHHHHHHHHHHHHHCSCHHHHHHHHHHHHHHHHSCCCCCT
T ss_pred             CceEEEccCCCc-cceecccHHHHHHHHHHHHHHccchhhhHHHHHHHHHHHhCCCCCcC
Confidence            999999854211 24677899999999999999999999999999999999999999987



>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 283
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 9e-11
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 7e-10
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 8e-09
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 3e-08
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 6e-08
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 2e-07
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 7e-06
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 7e-06
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 1e-05
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-05
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 2e-04
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 4e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 4e-04
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 4e-04
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 8e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 0.002
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 0.004
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: NADH-dependent ferredoxin reductase, BphA4
species: Pseudomonas sp., KKS102 [TaxId: 306]
 Score = 57.4 bits (137), Expect = 9e-11
 Identities = 36/171 (21%), Positives = 66/171 (38%), Gaps = 7/171 (4%)

Query: 18  VVVGGGPTGVEFSGELSDFIMR-DVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATT 76
           VV+G G   V F  EL     +  +       +       +  + +     +++R     
Sbjct: 7   VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLDCKR 66

Query: 77  QLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPG--- 133
                 +  V     D  +  + L+DG  +PYG LV +TG  P  ++ +  L ++ G   
Sbjct: 67  APEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAVLANDALARAAGLAC 126

Query: 134 -GRIGIDEWLRVPSVQDVFAVGDC-SGYLESTGKTVLPALAQVAERQGKYL 182
              I +D + R  +  DV+A+GD        +G+         A+ QG  +
Sbjct: 127 DDGIFVDAYGR-TTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAV 176


>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query283
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.92
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.92
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.92
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.91
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.87
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.87
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.8
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.8
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.8
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.8
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.79
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.77
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.77
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.76
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.76
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.76
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.74
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.73
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.73
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.73
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.72
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.72
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.72
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.72
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.71
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.71
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.7
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.68
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.66
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.65
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.65
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.64
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.63
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.63
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.63
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.62
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.62
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.58
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.57
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.48
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.41
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.34
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.29
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.22
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.18
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.17
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.09
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.07
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.04
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.04
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.03
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.93
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.89
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.84
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.83
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.83
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.79
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.7
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.68
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.6
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.59
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.56
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.56
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.55
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.52
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.52
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.5
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.43
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.4
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.36
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.34
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.3
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.28
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.24
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 98.19
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.12
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.94
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.88
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.86
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.74
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 97.59
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.54
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.49
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.47
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.46
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.44
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.16
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.02
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 96.99
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 96.76
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.63
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 96.35
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.24
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.23
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 96.19
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.15
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 96.09
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.96
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.86
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.8
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.62
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.47
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 95.43
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.42
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.39
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 95.22
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.22
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 94.91
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 94.56
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 94.28
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.13
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 93.97
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.94
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.76
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 93.61
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 93.25
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 93.07
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 92.64
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 92.41
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.04
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.0
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 91.95
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 91.88
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 91.8
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 91.68
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 91.39
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 91.38
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.89
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 90.69
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.64
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.62
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.07
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.9
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 89.79
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 89.7
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 89.25
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 88.98
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 88.19
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 88.1
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 88.09
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 87.9
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 87.83
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 87.73
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 87.71
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.68
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 87.38
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 87.36
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 87.3
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 87.09
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.93
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 86.91
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 86.85
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 86.61
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 86.59
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 86.45
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 86.24
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 86.19
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 86.01
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 85.54
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 85.52
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 84.8
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.02
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 83.58
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 83.56
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 83.48
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 82.96
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 82.67
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 82.63
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.39
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 82.12
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 82.08
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 81.93
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 81.7
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 81.62
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 81.34
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 80.91
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 80.47
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: NADH oxidase /nitrite reductase
species: Pyrococcus furiosus [TaxId: 2261]
Probab=99.92  E-value=1e-24  Score=172.93  Aligned_cols=149  Identities=30%  Similarity=0.488  Sum_probs=121.1

Q ss_pred             eEEEEccCcHHHHHHHHHHHhhhhHHHhhcCCCCCccEEEEEeCCCCCCCCCHHH-------------HHHHHHHHHhCC
Q 023375           16 HCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRL-------------RHYATTQLSKSG   82 (283)
Q Consensus        16 ~vvVvGgG~~Gve~A~~L~~~~~~~~~~~~~~~~~~~~V~li~~~~~l~~~~~~~-------------~~~~~~~l~~~g   82 (283)
                      ||+|||||++|+|+|.+|++ +              .+|+++++.......++.+             .....+.+++.+
T Consensus         2 rVvIIGgG~~G~e~A~~l~~-~--------------~~Vtvv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   66 (167)
T d1xhca1           2 KVVIVGNGPGGFELAKQLSQ-T--------------YEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRG   66 (167)
T ss_dssp             EEEEECCSHHHHHHHHHHTT-T--------------SEEEEECSSSSCCCCSTTHHHHHTTSSCGGGGCSSCHHHHHHHT
T ss_pred             eEEEECCcHHHHHHHHHHHc-C--------------CCEEEEeccccccccccchhhhhhhhhhhhhhhHHHHHHHHhcc
Confidence            79999999999999999965 3              7999999863322222222             222345677889


Q ss_pred             CEEEeC-ceEEEeCC-eEEEcCCcEEEeeEEEEcCCCCCchhhhccCCCCCCCCccccCCCcccCCCCCEEEeccccccC
Q 023375           83 VRLVRG-IVKDVDSQ-KLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYL  160 (283)
Q Consensus        83 V~v~~~-~V~~v~~~-~v~~~~g~~i~~d~vi~a~G~~~~~~~~~~~l~~~~~g~i~Vd~~l~~~~~~~VfaiGD~a~~~  160 (283)
                      ++++++ .+++++.+ .+.+.+++++++|.++||+|..|+++....+++.+.  .+.||+++|+ +.|+|||+|||+..+
T Consensus        67 v~~~~~~~v~~i~~~~~~~~~~~~~i~~D~li~a~G~~~~~~~~~~gl~~~~--~i~v~~~~~t-~~~~i~aiGD~~~~~  143 (167)
T d1xhca1          67 IEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGAPNVDLARRSGIHTGR--GILIDDNFRT-SAKDVYAIGDCAEYS  143 (167)
T ss_dssp             EEEECSCCEEEEETTTTEEEESSCEEECSEEEECCCEECCHHHHHTTCCBSS--SEECCTTSBC-SSTTEEECGGGEEBT
T ss_pred             ceeeeeccccccccccccccccccccccceeEEEEEecCCchhhhcCceeCC--ceeeccccEe-cCCCeEEeeecccCC
Confidence            999999 89999765 577788889999999999999988888888887653  5999999999 899999999999753


Q ss_pred             cCCCCcCCCcchHHHHHHHHHHHHHHH
Q 023375          161 ESTGKTVLPALAQVAERQGKYLFSLLN  187 (283)
Q Consensus       161 ~~~~~~~~p~~~~~A~~qg~~~a~~i~  187 (283)
                           .+.+..++.|++||+++|+||.
T Consensus       144 -----~~~~~~~~~a~~~a~~~a~~i~  165 (167)
T d1xhca1         144 -----GIIAGTAKAAMEQARVLADILK  165 (167)
T ss_dssp             -----TBCCCSHHHHHHHHHHHHHHHT
T ss_pred             -----CeEEChHHHHHHHHHHHHHHcC
Confidence                 3567889999999999999984



>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure