Citrus Sinensis ID: 023495

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MIPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGNPLVSPPMDVVEQGLSAVKGYLSEKMNNDHKSPKKKSWVGKLVKYGTFNGALRNHRSEERERFIMSDFRAIDGLASPRHIGMFSPRRLFSPRSYFTK
cccccHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHccccccEEEccccccccccHHHHHcccccEEcccccccccccHHHHccccccEEcccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHHcHHHHHHHHHHHccccccccHHHHHHccccEEEccccccccccHHHHHHHcccccccccccccccccccccccccccccccccc
cccHHHHHHHHHccEEEccccccccccccccccccccEEEccccccccccHHHHHHccccEEEccccccccccHHHHHHHHHHHHEcccccccccccHHHHccccccEEEccccccccccHHHHHHHcccEEEcccccccHHcccHHHHHHccccEEEccccccccccHHHHcHccccEEEccccccccccHHHHHccccEEEEccccccccccHHHHHHHcccEEEccccccccccccHHHHHHcHHHHHHcccccccccHHHccccccccccccHcccc
MIPESLTARLLNVVVLDVHsnqlkclpnsigclsklkVLDVSGNlleslpktIENCRSLEELNANFNKlrqlpdtigFELINLktlsincnkivilpqslthltSLRVLDARLNCLKSLPEDLENLINLEVLNISqnfqyletlpYSIGLLMSLVELDvsynkittlpdsIGCLRKLQKlslegnplvsppmdvVEQGLSAVKGYLSekmnndhkspkkkswVGKLVKYGTFngalrnhrseerERFIMSDFraidglasprhigmfsprrlfsprsyftk
MIPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGNPLVSPPMDVVEQGLSAVKGYLSekmnndhkspkkkswvgkLVKYGtfngalrnhrseereRFIMSDFRAIDGlasprhigmfsprrlfsprsyftk
MIPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDlenlinlevlniSQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGNPLVSPPMDVVEQGLSAVKGYLSEKMNNDHKSPKKKSWVGKLVKYGTFNGALRNHRSEERERFIMSDFRAIDGLASPRHIGMFSPRRLFSPRSYFTK
******TARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEG*************************************WVGKLVKYGTFNGALRN*******RFIMSDFRAIDGLASPRHIGM***************
MIPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGNPLVSPPMDVVEQGLSAVKGYLSEKMN***KSPKKKSWVGKLVKYGTFNGALRNHRSEERERFIMSDFRAIDGLASPRHIGMFSPRRLFSP*SYF**
MIPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGNPLVSPPMDVVEQGLSAVKGYLSEKM**********SWVGKLVKYGTFNGALRNHRSEERERFIMSDFRAIDGLASPRHIGMFSPRRLFSPRSYFTK
MIPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGNPLVSPPMDVVEQGLSAVKGYLSEKMNNDHKSPKKKSWVGKLVKYGTFNGALRNHRSEERERFIMSDFRAIDGLASPRHIGMFSPRRLFSPR*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGNPLVSPPMDVVEQGLSAVKGYLSEKMNNDHKSPKKKSWVGKLVKYGTFNGALRNHRSEERERFIMSDFRAIDGLASPRHIGMFSPRRLFSPRSYFTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query281 2.2.26 [Sep-21-2011]
O61967 699 Protein lap1 OS=Caenorhab yes no 0.637 0.256 0.401 2e-24
Q9V780 849 Protein lap1 OS=Drosophil yes no 0.629 0.208 0.394 4e-23
B0W6M9 628 Leucine-rich repeat prote N/A no 0.619 0.277 0.372 9e-23
Q5ZLN0 603 Leucine-rich repeat-conta no no 0.765 0.356 0.298 5e-22
A6QLV3 582 Leucine-rich repeat prote yes no 0.683 0.329 0.346 7e-22
Q5RAV5 582 Leucine-rich repeat prote no no 0.683 0.329 0.346 7e-22
Q9UQ13 582 Leucine-rich repeat prote yes no 0.683 0.329 0.346 7e-22
Q5F4C4 529 Leucine-rich repeat prote no no 0.683 0.362 0.346 9e-22
B5DX45 629 Leucine-rich repeat prote no no 0.665 0.297 0.366 1e-21
Q9BTT6 524 Leucine-rich repeat-conta no no 0.672 0.360 0.388 1e-21
>sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 110/182 (60%), Gaps = 3/182 (1%)

Query: 10  LLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKL 69
           L ++ +LDV  N+L  LP  IG L++L  L+++ N +  LP T++NC+ L  LN + N  
Sbjct: 58  LRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPF 117

Query: 70  RQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINL 129
            +LP+TI  E  ++  LS+N   + +LP ++  LT+LRVL+AR N L+++P  +  L  L
Sbjct: 118 TRLPETI-CECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKL 176

Query: 130 EVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGNPLVS 189
           E L++ QN   LE LP  IG L SL E  V  N +T+LPDSI   R L +L +  N ++ 
Sbjct: 177 EELDLGQN--ELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIR 234

Query: 190 PP 191
            P
Sbjct: 235 LP 236
Critical role in assembling adherens junctions; adapter protein involved in polarizing protein trafficking in epithelial cells. Necessary to maintain, not establish, the entire terminal web (organelle-depleted, intermediate filament-rich layer of cytoplasm that underlies the apical microvilli of polarized epithelial cells) or brush border assembly at the apical surface gut cells. Required for correct localization of ifb-2 intermediate filaments in the terminal web.
Caenorhabditis elegans (taxid: 6239)
>sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 Back     alignment and function description
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 Back     alignment and function description
>sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 Back     alignment and function description
>sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
359485043351 PREDICTED: leucine-rich repeat-containin 0.992 0.794 0.786 1e-126
147771824355 hypothetical protein VITISV_043793 [Viti 0.992 0.785 0.786 1e-126
297735442308 unnamed protein product [Vitis vinifera] 0.992 0.905 0.786 1e-126
255554408353 leucine-rich repeat-containing protein, 0.989 0.787 0.795 1e-126
283132365350 leucine rich repeat protein [Lotus japon 0.992 0.797 0.786 1e-124
356562028360 PREDICTED: leucine-rich repeat and calpo 0.992 0.775 0.756 1e-121
224090495336 predicted protein [Populus trichocarpa] 0.989 0.827 0.772 1e-120
357479483343 Leucine rich repeat protein [Medicago tr 0.985 0.807 0.754 1e-118
449457277379 PREDICTED: leucine-rich repeat-containin 1.0 0.741 0.737 1e-116
297836332377 leucine-rich repeat family protein [Arab 0.996 0.742 0.734 1e-114
>gi|359485043|ref|XP_002266645.2| PREDICTED: leucine-rich repeat-containing protein 40-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 221/281 (78%), Positives = 257/281 (91%), Gaps = 2/281 (0%)

Query: 2   IPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEE 61
           IPESLTARLLNVV+LDVHSNQLK LPNSIGCLSKLKVL++SGNL+++LPKTIENCRSLEE
Sbjct: 72  IPESLTARLLNVVILDVHSNQLKSLPNSIGCLSKLKVLNISGNLIQNLPKTIENCRSLEE 131

Query: 62  LNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPE 121
           LNANFN+L  LPDTIGFEL+N+K LS+N NK+++LP S +HLTSL+VLDARLNCL++LPE
Sbjct: 132 LNANFNQLTMLPDTIGFELLNIKKLSVNSNKLMLLPSSTSHLTSLQVLDARLNCLRALPE 191

Query: 122 DLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLS 181
           DLENLINL+VLN+SQNFQYLETLPYSIGLLMSLVELD SYN+ITTLPDS+GCL+KLQKL 
Sbjct: 192 DLENLINLQVLNVSQNFQYLETLPYSIGLLMSLVELDASYNRITTLPDSMGCLKKLQKLC 251

Query: 182 LEGNPLVSPPMDVVEQGLSAVKGYLSEKMNNDHK-SPKKKSWVGKLVKYGTFNGALRNHR 240
           +EGNPLVSPPM+VVEQG+ AVK YLSEKM   H+ SPKKKSW+GKLV+YGTFNG   N  
Sbjct: 252 VEGNPLVSPPMEVVEQGMQAVKEYLSEKMTAAHRCSPKKKSWIGKLVRYGTFNGT-NNAS 310

Query: 241 SEERERFIMSDFRAIDGLASPRHIGMFSPRRLFSPRSYFTK 281
            EERE F+ SD+R+I+GLA+PR +GMFSPRRLFSPR+YF+K
Sbjct: 311 REEREGFLRSDYRSIEGLATPRSVGMFSPRRLFSPRNYFSK 351

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147771824|emb|CAN71340.1| hypothetical protein VITISV_043793 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735442|emb|CBI17882.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255554408|ref|XP_002518243.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223542590|gb|EEF44129.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|283132365|dbj|BAI63588.1| leucine rich repeat protein [Lotus japonicus] Back     alignment and taxonomy information
>gi|356562028|ref|XP_003549277.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224090495|ref|XP_002309000.1| predicted protein [Populus trichocarpa] gi|222854976|gb|EEE92523.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357479483|ref|XP_003610027.1| Leucine rich repeat protein [Medicago truncatula] gi|355511082|gb|AES92224.1| Leucine rich repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449457277|ref|XP_004146375.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] gi|449530051|ref|XP_004172010.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297836332|ref|XP_002886048.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297331888|gb|EFH62307.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
TAIR|locus:2047595380 PIRL6 "AT2G19330" [Arabidopsis 0.996 0.736 0.696 7.9e-101
TAIR|locus:2120825383 PIRL8 "AT4G26050" [Arabidopsis 0.992 0.728 0.666 1e-93
TAIR|locus:2123899373 PIRL7 "plant intracellular ras 0.996 0.750 0.650 1.3e-91
TAIR|locus:2166429506 PIRL1 "plant intracellular ras 0.736 0.409 0.490 5.2e-42
TAIR|locus:2074728499 PIRL9 "plant intracellular ras 0.775 0.436 0.456 2.2e-41
TAIR|locus:2010326464 PIRL3 "AT1G12970" [Arabidopsis 0.736 0.446 0.427 1.3e-36
TAIR|locus:2088807471 PIRL2 "AT3G26500" [Arabidopsis 0.822 0.490 0.377 7.2e-36
TAIR|locus:2117617549 PIRL4 "plant intracellular ras 0.775 0.397 0.412 9.2e-35
TAIR|locus:2827587526 PIRL5 "AT2G17440" [Arabidopsis 0.793 0.423 0.393 1.3e-34
WB|WBGene00002632 699 let-413 [Caenorhabditis elegan 0.633 0.254 0.387 4.3e-24
TAIR|locus:2047595 PIRL6 "AT2G19330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1000 (357.1 bits), Expect = 7.9e-101, P = 7.9e-101
 Identities = 197/283 (69%), Positives = 233/283 (82%)

Query:     2 IPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEE 61
             IPESLTARLLN++ LDVHSNQ+K LPNSIGCLSKLK L+VSGN L S PK+I++CRSLEE
Sbjct:    98 IPESLTARLLNLIALDVHSNQIKALPNSIGCLSKLKTLNVSGNFLVSFPKSIQHCRSLEE 157

Query:    62 LNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPE 121
             LNANFNKL +LPD+IGFEL NL+ LSIN NK++ LP S+THLTSLRVLDARLNCL  LP+
Sbjct:   158 LNANFNKLIRLPDSIGFELTNLRKLSINSNKLISLPISITHLTSLRVLDARLNCLMILPD 217

Query:   122 DXXXXXXXXXXXXSQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLS 181
             D            SQNFQYL  LP SIGLLM+L+ELDVSYNKIT LP+SIGC+R+L+KLS
Sbjct:   218 DLENLINLEILNVSQNFQYLSALPSSIGLLMNLIELDVSYNKITVLPESIGCMRRLRKLS 277

Query:   182 LEGNPLVSPPMDVVEQGLSAVKGYLSEKMNNDH-KSP-KKKSW-VGKLVKYGTFNGALRN 238
             +EGNPLVSPP++V+EQ L  V+ YL++KMN    +SP KKKSW  GKLVKYGTFNG  R+
Sbjct:   278 VEGNPLVSPPIEVMEQNLQVVREYLTQKMNGGSPRSPSKKKSWGFGKLVKYGTFNGGSRS 337

Query:   239 HRSEERERFIMSDFRAIDGLASPRHIGMFSPRRLFSPRSYFTK 281
                EERE FIM ++R+ID LASPR+ GMFSPRRLFSPR+YF++
Sbjct:   338 WNREEREGFIMPEYRSIDSLASPRYSGMFSPRRLFSPRTYFSR 380
GO:0008150 "biological_process" evidence=ND
GO:0042023 "DNA endoreduplication" evidence=RCA
TAIR|locus:2120825 PIRL8 "AT4G26050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123899 PIRL7 "plant intracellular ras group-related LRR 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166429 PIRL1 "plant intracellular ras group-related LRR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074728 PIRL9 "plant intracellular ras group-related LRR 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010326 PIRL3 "AT1G12970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088807 PIRL2 "AT3G26500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827587 PIRL5 "AT2G17440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00002632 let-413 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00031308001
SubName- Full=Chromosome chr11 scaffold_56, whole genome shotgun sequence; (308 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00001342001
SubName- Full=Chromosome chr8 scaffold_115, whole genome shotgun sequence; (397 aa)
  •     0.488
GSVIVG00031796001
SubName- Full=Chromosome chr18 scaffold_59, whole genome shotgun sequence; (590 aa)
  •     0.475
GSVIVG00030267001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (446 aa)
  •     0.467

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-14
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-13
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-09
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-08
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 6e-08
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 73.1 bits (179), Expect = 1e-14
 Identities = 64/179 (35%), Positives = 97/179 (54%), Gaps = 4/179 (2%)

Query: 2   IPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEE 61
           IP  +     N+  LD+  N+++ LP+ +  L  LK LD+S N L  LPK + N  +L  
Sbjct: 131 IPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNN 190

Query: 62  LNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPE 121
           L+ + NK+  LP  I   L  L+ L ++ N I+ L  SL++L +L  L+   N L+ LPE
Sbjct: 191 LDLSGNKISDLPPEIE-LLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPE 249

Query: 122 DLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKL 180
            + NL NLE L++S N     +   S+G L +L ELD+S N ++     I  L  L +L
Sbjct: 250 SIGNLSNLETLDLSNNQI---SSISSLGSLTNLRELDLSGNSLSNALPLIALLLLLLEL 305

Length = 394
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 281
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
KOG0617264 consensus Ras suppressor protein (contains leucine 99.83
KOG0617264 consensus Ras suppressor protein (contains leucine 99.82
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.81
KOG4237498 consensus Extracellular matrix protein slit, conta 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
KOG4237498 consensus Extracellular matrix protein slit, conta 99.7
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.61
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.59
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.57
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.54
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.54
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.53
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.47
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.47
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.42
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.4
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.35
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.34
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.3
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.24
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.04
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.03
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.96
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.92
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
PLN03150623 hypothetical protein; Provisional 98.83
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.75
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.75
PLN03150623 hypothetical protein; Provisional 98.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.69
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.69
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.4
PRK15386 426 type III secretion protein GogB; Provisional 98.3
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.22
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.18
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.1
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.05
PRK15386 426 type III secretion protein GogB; Provisional 98.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.73
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.7
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.24
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.17
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.77
KOG4308478 consensus LRR-containing protein [Function unknown 96.74
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.35
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.22
KOG4341483 consensus F-box protein containing LRR [General fu 95.8
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.75
KOG4341483 consensus F-box protein containing LRR [General fu 95.57
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.43
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.31
KOG4308478 consensus LRR-containing protein [Function unknown 94.55
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.47
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.43
smart0037026 LRR Leucine-rich repeats, outliers. 94.43
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.33
smart0037026 LRR Leucine-rich repeats, outliers. 94.06
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.06
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.87
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.46
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.94
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 83.12
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 81.92
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.87  E-value=8.6e-22  Score=192.03  Aligned_cols=187  Identities=28%  Similarity=0.467  Sum_probs=99.5

Q ss_pred             ChhHHhccCCCcEEEccCCCCCc-cchhccCCCCCcEEEccCCCCC-CcchhhhcCccCceeeccCCcCc-ccChhHhhc
Q 023495            3 PESLTARLLNVVVLDVHSNQLKC-LPNSIGCLSKLKVLDVSGNLLE-SLPKTIENCRSLEELNANFNKLR-QLPDTIGFE   79 (281)
Q Consensus         3 p~~~~~~~~~L~~L~l~~~~l~~-l~~~~~~l~~L~~L~L~~n~l~-~l~~~~~~l~~L~~L~L~~n~l~-~~~~~~~~~   79 (281)
                      |..++.++.+|++|++++|+++. +|.  +.+++|++|++++|.+. .+|..+..+++|++|++++|.+. .+|..+. +
T Consensus       110 p~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~-~  186 (968)
T PLN00113        110 PDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLT-N  186 (968)
T ss_pred             ChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhh-h
Confidence            44443344444444444444431 121  23444455555555444 33555556666666666666554 3333333 5


Q ss_pred             CCCCcEEEccCCcCc-ccCccccCCCCCcEEEccCCcCC-CChhhhhCCCCCCeeecccccccccCCCccccCCCcccEE
Q 023495           80 LINLKTLSINCNKIV-ILPQSLTHLTSLRVLDARLNCLK-SLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVEL  157 (281)
Q Consensus        80 l~~L~~L~l~~~~l~-~l~~~~~~l~~L~~L~l~~n~l~-~l~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L  157 (281)
                      +++|++|++++|.+. .+|..+..+++|+.|++++|.+. .+|..++++++|++|++++| ...+.+|..+..+++|+.|
T Consensus       187 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n-~l~~~~p~~l~~l~~L~~L  265 (968)
T PLN00113        187 LTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYN-NLTGPIPSSLGNLKNLQYL  265 (968)
T ss_pred             CcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCc-eeccccChhHhCCCCCCEE
Confidence            666666666665554 44555556666666666666555 45555666666666666665 3444555555566666666


Q ss_pred             EcCCCCCC-CCChhhhcCCCCCEEEccCCCCCCCCHH
Q 023495          158 DVSYNKIT-TLPDSIGCLRKLQKLSLEGNPLVSPPMD  193 (281)
Q Consensus       158 ~l~~n~i~-~~~~~~~~l~~L~~L~L~~n~l~~~~~~  193 (281)
                      ++++|.+. .+|..+..+++|+.|++++|.+.+..+.
T Consensus       266 ~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~  302 (968)
T PLN00113        266 FLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPE  302 (968)
T ss_pred             ECcCCeeeccCchhHhhccCcCEEECcCCeeccCCCh
Confidence            66666554 4455555556666666666655544333

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-07
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 7e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-05
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 1e-04
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 1e-04
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 2e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 3e-04
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 3e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 3e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 3e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 4e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 4e-04
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 69/123 (56%), Gaps = 6/123 (4%)
Query: 2   IPESLTARLLNVVVLDVHSNQLKCLPNSI-GCLSKLKVLDVSGNLLESLPKTIEN-CRSL 59
           +P  + A+      LD+ +N LK LPN +   L+ L  L + GN L+SLP  + N   SL
Sbjct: 22  VPTGIPAQ---TTYLDLETNSLKSLPNGVFDELTSLTQLYLGGNKLQSLPNGVFNKLTSL 78
Query: 60  EELNANFNKLRQLPDTIGFELINLKTLSINCNKIVILPQSL-THLTSLRVLDARLNCLKS 118
             LN + N+L+ LP+ +  +L  LK L++N N++  LP  +   LT L+ L    N LKS
Sbjct: 79  TYLNLSTNQLQSLPNGVFDKLTQLKELALNTNQLQSLPDGVFDKLTQLKDLRLYQNQLKS 138
Query: 119 LPE 121
           +P+
Sbjct: 139 VPD 141
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-52
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-46
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-51
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-48
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-33
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-42
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-28
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-38
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-31
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-28
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-27
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-27
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-25
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-21
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  171 bits (436), Expect = 6e-52
 Identities = 54/201 (26%), Positives = 94/201 (46%), Gaps = 13/201 (6%)

Query: 2   IPESLTARLLNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEE 61
            P+    RL ++  + + +  L  LP+++   + L+ L ++ N L +LP +I +   L E
Sbjct: 96  FPDQA-FRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRE 154

Query: 62  LN-ANFNKLRQLPDTIG--------FELINLKTLSINCNKIVILPQSLTHLTSLRVLDAR 112
           L+     +L +LP+ +           L+NL++L +    I  LP S+ +L +L+ L  R
Sbjct: 155 LSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIR 214

Query: 113 LNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVS-YNKITTLPDSI 171
            + L +L   + +L  LE L++      L   P   G    L  L +   + + TLP  I
Sbjct: 215 NSPLSALGPAIHHLPKLEELDLR-GCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDI 273

Query: 172 GCLRKLQKLSLEGNP-LVSPP 191
             L +L+KL L G   L   P
Sbjct: 274 HRLTQLEKLDLRGCVNLSRLP 294
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.9
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.85
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.85
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.83
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.51
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.5
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.47
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.4
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.38
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.37
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.95
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.81
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.74
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.69
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.19
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.01
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.79
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.22
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 82.35
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.94  E-value=1.4e-26  Score=198.10  Aligned_cols=176  Identities=31%  Similarity=0.379  Sum_probs=95.8

Q ss_pred             CCCcEEEccCCCCCccchhccCCCCCcEEEccCCCCCCcchhhhcCccCceeeccCCcCcccChhHhhcCCCCcEEEccC
Q 023495           11 LNVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFELINLKTLSINC   90 (281)
Q Consensus        11 ~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~L~~n~l~~l~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~   90 (281)
                      .++++|++++|+++.+|..++++++|++|++++|.++.+|..+..+++|++|++++|.++.+|..+. .+++|++|++++
T Consensus        81 ~~l~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~-~l~~L~~L~L~~  159 (328)
T 4fcg_A           81 PGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIA-SLNRLRELSIRA  159 (328)
T ss_dssp             TTCCEEEEESSCCSSCCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCCCCCCCGGGG-GCTTCCEEEEEE
T ss_pred             cceeEEEccCCCchhcChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCccccCcHHHh-cCcCCCEEECCC
Confidence            4555555555555555555555555555555555555555555555555555555555555555443 555555555555


Q ss_pred             CcC-cccCcccc---------CCCCCcEEEccCCcCCCChhhhhCCCCCCeeecccccccccCCCccccCCCcccEEEcC
Q 023495           91 NKI-VILPQSLT---------HLTSLRVLDARLNCLKSLPEDLENLINLEVLNISQNFQYLETLPYSIGLLMSLVELDVS  160 (281)
Q Consensus        91 ~~l-~~l~~~~~---------~l~~L~~L~l~~n~l~~l~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~  160 (281)
                      |.. ..+|..+.         .+++|++|++++|.++.+|..++.+++|+.|++++|  .+..+|..+..+++|+.|+++
T Consensus       160 n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N--~l~~l~~~l~~l~~L~~L~Ls  237 (328)
T 4fcg_A          160 CPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNS--PLSALGPAIHHLPKLEELDLR  237 (328)
T ss_dssp             ETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESS--CCCCCCGGGGGCTTCCEEECT
T ss_pred             CCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCC--CCCcCchhhccCCCCCEEECc
Confidence            332 24444332         255555555555555555555555555555555555  333444455555555555555


Q ss_pred             CCCCC-CCChhhhcCCCCCEEEccCCCCCC
Q 023495          161 YNKIT-TLPDSIGCLRKLQKLSLEGNPLVS  189 (281)
Q Consensus       161 ~n~i~-~~~~~~~~l~~L~~L~L~~n~l~~  189 (281)
                      +|.+. .+|..+..+++|+.|++++|.+.+
T Consensus       238 ~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~  267 (328)
T 4fcg_A          238 GCTALRNYPPIFGGRAPLKRLILKDCSNLL  267 (328)
T ss_dssp             TCTTCCBCCCCTTCCCCCCEEECTTCTTCC
T ss_pred             CCcchhhhHHHhcCCCCCCEEECCCCCchh
Confidence            55444 445555555555555555554444
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 281
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 74.7 bits (182), Expect = 7e-16
 Identities = 37/174 (21%), Positives = 76/174 (43%), Gaps = 10/174 (5%)

Query: 12  NVVVLDVHSNQLKCLPNSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQ 71
           N+  L ++ NQLK +  ++  L+ L  LD++ N + +L   +     L EL    N++  
Sbjct: 220 NLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLA-PLSGLTKLTELKLGANQISN 277

Query: 72  LPDTIGFELINLKTLSINCNKIVILPQSLTHLTSLRVLDARLNCLKSLPEDLENLINLEV 131
           +    G   +    L+ N  + +    +L +LT    L    N +  +   + +L  L+ 
Sbjct: 278 ISPLAGLTALTNLELNENQLEDISPISNLKNLT---YLTLYFNNISDISP-VSSLTKLQR 333

Query: 132 LNISQNFQYLETLPYSIGLLMSLVELDVSYNKITTLPDSIGCLRKLQKLSLEGN 185
           L  + N   +  +  S+  L ++  L   +N+I+ L   +  L ++ +L L   
Sbjct: 334 LFFANN--KVSDVS-SLANLTNINWLSAGHNQISDLT-PLANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.83
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.34
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.05
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.47
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.45
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.15
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.12
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.88
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=2.2e-23  Score=171.15  Aligned_cols=182  Identities=26%  Similarity=0.297  Sum_probs=145.3

Q ss_pred             CChhHHhccCCCcEEEccCCCCCccc-hhccCCCCCcEEEccCCCCCCcchhhhcCccCceeeccCCcCcccChhHhhcC
Q 023495            2 IPESLTARLLNVVVLDVHSNQLKCLP-NSIGCLSKLKVLDVSGNLLESLPKTIENCRSLEELNANFNKLRQLPDTIGFEL   80 (281)
Q Consensus         2 ip~~~~~~~~~L~~L~l~~~~l~~l~-~~~~~l~~L~~L~L~~n~l~~l~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l   80 (281)
                      ||+++.   +++++|+|++|+|+.++ ..|.++++|++|++++|.++.++. +..+++|++|++++|.++..+..+. .+
T Consensus        25 iP~~lp---~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~-~~~l~~L~~L~Ls~N~l~~~~~~~~-~l   99 (266)
T d1p9ag_          25 LPPDLP---KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQV-DGTLPVLGTLDLSHNQLQSLPLLGQ-TL   99 (266)
T ss_dssp             CCSCCC---TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEEC-CSCCTTCCEEECCSSCCSSCCCCTT-TC
T ss_pred             eCcCcC---cCCCEEECcCCcCCCcCHHHhhcccccccccccccccccccc-ccccccccccccccccccccccccc-cc
Confidence            566542   46888999999888885 468888889999999988887753 4678889999999988887776554 78


Q ss_pred             CCCcEEEccCCcCcccC-ccccCCCCCcEEEccCCcCCCChhh-hhCCCCCCeeecccccccccCCCccccCCCcccEEE
Q 023495           81 INLKTLSINCNKIVILP-QSLTHLTSLRVLDARLNCLKSLPED-LENLINLEVLNISQNFQYLETLPYSIGLLMSLVELD  158 (281)
Q Consensus        81 ~~L~~L~l~~~~l~~l~-~~~~~l~~L~~L~l~~n~l~~l~~~-~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~  158 (281)
                      ++|+.|+++++.+..++ ..+..+.+++.|++++|.++.++.. +..+++++.+++++| ......+..+..+++|++|+
T Consensus       100 ~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N-~l~~~~~~~~~~l~~L~~L~  178 (266)
T d1p9ag_         100 PALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANN-NLTELPAGLLNGLENLDTLL  178 (266)
T ss_dssp             TTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTS-CCSCCCTTTTTTCTTCCEEE
T ss_pred             cccccccccccccceeeccccccccccccccccccccceeccccccccccchhcccccc-cccccCccccccccccceee
Confidence            88999999888887654 3467788889999999888877654 677888999999988 44444455678888999999


Q ss_pred             cCCCCCCCCChhhhcCCCCCEEEccCCCCCC
Q 023495          159 VSYNKITTLPDSIGCLRKLQKLSLEGNPLVS  189 (281)
Q Consensus       159 l~~n~i~~~~~~~~~l~~L~~L~L~~n~l~~  189 (281)
                      |++|+++.+|+.+..+++|+.|+|++|++..
T Consensus       179 Ls~N~L~~lp~~~~~~~~L~~L~L~~Np~~C  209 (266)
T d1p9ag_         179 LQENSLYTIPKGFFGSHLLPFAFLHGNPWLC  209 (266)
T ss_dssp             CCSSCCCCCCTTTTTTCCCSEEECCSCCBCC
T ss_pred             cccCCCcccChhHCCCCCCCEEEecCCCCCC
Confidence            9999999888888888899999999998754
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure