Citrus Sinensis ID: 023527

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MNLFLVQHGLKVIRLAKLITEWKNSYNLNKWANLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDSLTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLRLTFILSNKHKDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLNNHLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNIDN
cEEEEEHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccEEccccccccEEcccccccccccccccEEEEEHHHHHcccccccccHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccEEEEccccccEEEEEEccEEEEEEEcccEEEccccccEEEEcccccccHHHHHHHHHcccccccccccccEEEEccEEEEEccccccHHHHHHHccc
cEEEEEEHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccEEcccccccccccccccccEEHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHEcccccEEEEEcccHcEEEEEEEccEEEEEEccccccccccccEEcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHccc
MNLFLVQHGLKVIRLAKLITEWKNSynlnkwanLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKActdftrcdflplhcddsltnytffsdfcstktqnatiydfgIFRDaiqsgvldqnyffrrylpCFQWSLQALRLRLTFILsnkhkdpillveefgnldgssleklcdvvkpavftersyiiqeenpiDQMLFVLQGKLWTYTSRRVtelssnsgnlnnhleggdfsgEELIAWAKaghnssnlpistKTIQALTKVEAFVLMAYDLKQVLLNIDN
MNLFLVQHGLKVIRLAKLITEWKNSYNLNKWANLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDSLTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLRLTFILSNKHKDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSyiiqeenpidqMLFVLQGKLWTYTSRRVTelssnsgnlnnHLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNIDN
MNLFLVQHGLKVIRLAKLITEWKNSYNLNKWANLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDSLTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLRLTFILSNKHKDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTelssnsgnlnnhleggDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNIDN
**LFLVQHGLKVIRLAKLITEWKNSYNLNKWANLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDSLTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLRLTFILSNKHKDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTE***************DFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNI**
MNLFLVQHGLKVIRLAKLITEWKNSYNLNKWANLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDSLTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLRLTFILSNKHKDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLNNHLEGGDFSGEELIAWAKAGHN****PISTKTIQALTKVEAFVLMAYDLKQVLLNID*
MNLFLVQHGLKVIRLAKLITEWKNSYNLNKWANLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDSLTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLRLTFILSNKHKDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLNNHLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNIDN
MNLFLVQHGLKVIRLAKLITEWKNSYNLNKWANLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDSLTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLRLTFILSNKHKDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLNNHLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNIDN
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLFLVQHGLKVIRLAKLITEWKNSYNLNKWANLTFNFGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDSLTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLRLTFILSNKHKDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLNNHLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNIDN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query281 2.2.26 [Sep-21-2011]
O65717 716 Cyclic nucleotide-gated i yes no 0.416 0.163 0.479 1e-25
Q9LNJ0 711 Probable cyclic nucleotid no no 0.405 0.160 0.441 2e-21
O82226 747 Probable cyclic nucleotid no no 0.405 0.152 0.441 2e-21
Q9S9N5 738 Putative cyclic nucleotid no no 0.405 0.154 0.441 2e-21
Q9FXH6 753 Putative cyclic nucleotid no no 0.405 0.151 0.441 3e-21
Q9LD40 696 Putative cyclic nucleotid no no 0.405 0.163 0.45 3e-21
Q9M0A4 733 Putative cyclic nucleotid no no 0.405 0.155 0.441 1e-20
Q8RWS9 717 Probable cyclic nucleotid no no 0.405 0.158 0.416 2e-19
Q9SU64 705 Probable cyclic nucleotid no no 0.405 0.161 0.383 9e-18
Q9SJA4 726 Probable cyclic nucleotid no no 0.423 0.163 0.392 1e-17
>sp|O65717|CNGC1_ARATH Cyclic nucleotide-gated ion channel 1 OS=Arabidopsis thaliana GN=CNGC1 PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 85/123 (69%), Gaps = 6/123 (4%)

Query: 154 ILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVT 213
           ++ V  F  +D   L+ LCD ++P ++TE SYI++E +P+D+MLF+++GKL T T+    
Sbjct: 481 LMRVPMFEKMDEQLLDALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTITTN--- 537

Query: 214 ELSSNSGNLNN-HLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDL 272
                +G LN+ +L  GDF GEEL+ WA   H+SSNLPIST+T++AL +VEAF L A DL
Sbjct: 538 --GGRTGFLNSEYLGAGDFCGEELLTWALDPHSSSNLPISTRTVRALMEVEAFALKADDL 595

Query: 273 KQV 275
           K V
Sbjct: 596 KFV 598
Acts as cyclic nucleotide-gated ion channel. Can be activated by cyclic AMP which leads to an opening of the cation channel. May be responsible for cAMP-induced calcium entry in cells and thus should be involved in the calcium signal transduction. Could transport K(+), Na(+) and Pb(2+).
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LNJ0|CNG10_ARATH Probable cyclic nucleotide-gated ion channel 10 OS=Arabidopsis thaliana GN=CNGC10 PE=2 SV=2 Back     alignment and function description
>sp|O82226|CNGC6_ARATH Probable cyclic nucleotide-gated ion channel 6 OS=Arabidopsis thaliana GN=CNGC6 PE=1 SV=2 Back     alignment and function description
>sp|Q9S9N5|CNGC7_ARATH Putative cyclic nucleotide-gated ion channel 7 OS=Arabidopsis thaliana GN=CNGC7 PE=2 SV=1 Back     alignment and function description
>sp|Q9FXH6|CNGC8_ARATH Putative cyclic nucleotide-gated ion channel 8 OS=Arabidopsis thaliana GN=CNGC8 PE=3 SV=2 Back     alignment and function description
>sp|Q9LD40|CNG13_ARATH Putative cyclic nucleotide-gated ion channel 13 OS=Arabidopsis thaliana GN=CNGC13 PE=3 SV=2 Back     alignment and function description
>sp|Q9M0A4|CNGC9_ARATH Putative cyclic nucleotide-gated ion channel 9 OS=Arabidopsis thaliana GN=CNGC9 PE=1 SV=1 Back     alignment and function description
>sp|Q8RWS9|CNGC5_ARATH Probable cyclic nucleotide-gated ion channel 5 OS=Arabidopsis thaliana GN=CNGC5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SU64|CNG16_ARATH Probable cyclic nucleotide-gated ion channel 16 OS=Arabidopsis thaliana GN=CNGC16 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJA4|CNG14_ARATH Probable cyclic nucleotide-gated ion channel 14 OS=Arabidopsis thaliana GN=CNGC14 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
255578125 518 Cyclic nucleotide-gated ion channel, put 0.896 0.486 0.278 3e-26
224135235 708 predicted protein [Populus trichocarpa] 0.416 0.165 0.487 3e-25
255545024 838 Cyclic nucleotide-gated ion channel, put 0.416 0.139 0.487 7e-25
225462733 709 PREDICTED: cyclic nucleotide-gated ion c 0.405 0.160 0.5 1e-24
449465194 664 PREDICTED: cyclic nucleotide-gated ion c 0.434 0.183 0.491 3e-24
321160850288 cyclic nucleotide gated channel 1 [Hirsc 0.409 0.399 0.479 3e-24
224118210 709 predicted protein [Populus trichocarpa] 0.416 0.165 0.479 5e-24
15238657 716 cyclic nucleotide-gated ion channel 1 [A 0.416 0.163 0.479 8e-24
24943196 566 cyclic nucleotide-gated channel C [Phase 0.416 0.206 0.471 9e-24
449456377 713 PREDICTED: cyclic nucleotide-gated ion c 0.416 0.164 0.463 1e-23
>gi|255578125|ref|XP_002529932.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223530562|gb|EEF32440.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  124 bits (312), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 91/327 (27%), Positives = 151/327 (46%), Gaps = 75/327 (22%)

Query: 11  KVIRLAKLITEWKNSYNLNKWANLTFNFG-YLQAANVFGSLWYFFAVQRKAECWKKAC-- 67
           ++I+   ++TE         WA   +N   Y+ A++V G+ WY  +++R+  CW+ AC  
Sbjct: 96  RIIKANGVVTE-------TAWAGAAYNLMLYMLASHVLGACWYLLSIERQEACWRSACHL 148

Query: 68  -TDFTRCDFLPLHCDDSLTNYTFF--SDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFF 124
                R ++   H   +    ++F  S+       N + Y FGIF DA+  GV     FF
Sbjct: 149 EKPSCRYNYFDCHQMHNPLRVSWFKSSNVTHLCQPNISFYQFGIFGDALTFGVTTST-FF 207

Query: 125 RRYLPCFQWSLQALR-------------------------LRLTFILSNKHK-------- 151
           R+Y  C  W L+ LR                         LRL+    +++K        
Sbjct: 208 RKYFYCLWWGLKNLRLTLFYFHSGSSLGQNLSTSTYLPTELRLSVRKYDQYKWVATRGVD 267

Query: 152 ----------------------DPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQE 189
                                 D +  V  F  +D   L+ +C+ +KPA+ TE +++++E
Sbjct: 268 EEALLKGLPLDLRRDIKRHLCLDLVRRVPLFDQMDERMLDAICERLKPALSTEGTFLVRE 327

Query: 190 ENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLNN-HLEGGDFSGEELIAWAKAGHNSSN 248
            + +++MLF+++G L +YT+         +G  N+  +  GDF GEEL+ WA     S  
Sbjct: 328 GDLVNEMLFIIRGNLDSYTTN-----GGRTGFFNSCRIGPGDFCGEELLTWALDPRPSVI 382

Query: 249 LPISTKTIQALTKVEAFVLMAYDLKQV 275
           LP ST+T++A+++VEAF L A DLK V
Sbjct: 383 LPSSTRTVKAISEVEAFALEAEDLKFV 409

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224135235|ref|XP_002322017.1| predicted protein [Populus trichocarpa] gi|222869013|gb|EEF06144.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545024|ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223547481|gb|EEF48976.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225462733|ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera] gi|302143681|emb|CBI22542.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449465194|ref|XP_004150313.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|321160850|gb|ADW66596.1| cyclic nucleotide gated channel 1 [Hirschfeldia incana] Back     alignment and taxonomy information
>gi|224118210|ref|XP_002317760.1| predicted protein [Populus trichocarpa] gi|222858433|gb|EEE95980.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15238657|ref|NP_200125.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana] gi|38502855|sp|O65717.1|CNGC1_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 1; Short=AtCNGC1; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 1 gi|13877753|gb|AAK43954.1|AF370139_1 putative cyclic nucleotide-regulated ion channel protein [Arabidopsis thaliana] gi|3096947|emb|CAA76178.1| putative cyclic nucleotide-regulated ion channel [Arabidopsis thaliana] gi|9757994|dbj|BAB08416.1| cyclic nucleotide-regulated ion channel [Arabidopsis thaliana] gi|24030485|gb|AAN41391.1| putative cyclic nucleotide-regulated ion channel protein [Arabidopsis thaliana] gi|332008928|gb|AED96311.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|24943196|gb|AAN65366.1| cyclic nucleotide-gated channel C [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|449456377|ref|XP_004145926.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
TAIR|locus:2163776 716 CNGC1 "cyclic nucleotide gated 0.419 0.164 0.450 6.7e-46
TAIR|locus:2125206 696 CNGC13 "cyclic nucleotide-gate 0.427 0.172 0.427 6.2e-41
TAIR|locus:2039084 706 CNGC3 "cyclic nucleotide gated 0.455 0.181 0.335 5.3e-35
TAIR|locus:2061401 747 CNGC6 "cyclic nucleotide-gated 0.398 0.149 0.405 3.8e-33
TAIR|locus:2118836 733 CNGC9 "cyclic nucleotide gated 0.398 0.152 0.405 7.7e-33
TAIR|locus:2174448 717 CNGC5 "cyclic nucleotide gated 0.398 0.156 0.379 8.6e-32
TAIR|locus:2200502 738 CNGC7 "cyclic nucleotide gated 0.398 0.151 0.405 1.4e-31
TAIR|locus:2013139 753 CNGC8 "cyclic nucleotide gated 0.398 0.148 0.405 1e-30
TAIR|locus:2046703 726 CNGC14 "cyclic nucleotide-gate 0.427 0.165 0.370 5e-29
TAIR|locus:2062814678 CNGC15 "cyclic nucleotide-gate 0.427 0.176 0.354 2.7e-28
TAIR|locus:2163776 CNGC1 "cyclic nucleotide gated channel 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 6.7e-46, Sum P(2) = 6.7e-46
 Identities = 55/122 (45%), Positives = 77/122 (63%)

Query:   154 ILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVT 213
             ++ V  F  +D   L+ LCD ++P ++TE SYI++E +P+D+MLF+++GKL T T    T
Sbjct:   481 LMRVPMFEKMDEQLLDALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTIT----T 536

Query:   214 XXXXXXXXXXXXXXXXDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLK 273
                             DF GEEL+ WA   H+SSNLPIST+T++AL +VEAF L A DLK
Sbjct:   537 NGGRTGFLNSEYLGAGDFCGEELLTWALDPHSSSNLPISTRTVRALMEVEAFALKADDLK 596

Query:   274 QV 275
              V
Sbjct:   597 FV 598
GO:0005216 "ion channel activity" evidence=IEA
GO:0005261 "cation channel activity" evidence=ISS
GO:0005516 "calmodulin binding" evidence=ISS;TAS;IPI
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006811 "ion transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0030551 "cyclic nucleotide binding" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005242 "inward rectifier potassium channel activity" evidence=IGI
GO:0005221 "intracellular cyclic nucleotide activated cation channel activity" evidence=IGI
GO:0006813 "potassium ion transport" evidence=IGI
GO:0006816 "calcium ion transport" evidence=IGI
TAIR|locus:2125206 CNGC13 "cyclic nucleotide-gated channel 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039084 CNGC3 "cyclic nucleotide gated channel 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061401 CNGC6 "cyclic nucleotide-gated channel 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118836 CNGC9 "cyclic nucleotide gated channel 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174448 CNGC5 "cyclic nucleotide gated channel 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200502 CNGC7 "cyclic nucleotide gated channel 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013139 CNGC8 "cyclic nucleotide gated channel 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046703 CNGC14 "cyclic nucleotide-gated channel 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062814 CNGC15 "cyclic nucleotide-gated channel 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_XV000064
hypothetical protein (708 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 8e-09
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 3e-04
PLN02868 413 PLN02868, PLN02868, acyl-CoA thioesterase family p 0.001
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 52.3 bits (126), Expect = 8e-09
 Identities = 27/108 (25%), Positives = 40/108 (37%), Gaps = 14/108 (12%)

Query: 160 FGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNS 219
           F  LD   LE+L D ++   F     II++ +P D +  VL G +               
Sbjct: 2   FSGLDDEELEELADALEERRFPAGEVIIRQGDPADSLYIVLSGSV-----EVYKLDEDGR 56

Query: 220 GNLNNHLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVL 267
             +   L  GD  GE  +               + T++ALT  E  VL
Sbjct: 57  EQIVGFLGPGDLFGELALL---------GNGPRSATVRALTDSELLVL 95

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|178459 PLN02868, PLN02868, acyl-CoA thioesterase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 281
KOG0498 727 consensus K+-channel ERG and related proteins, con 100.0
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.83
KOG0500 536 consensus Cyclic nucleotide-gated cation channel C 99.8
PRK09392 236 ftrB transcriptional activator FtrB; Provisional 99.68
KOG0499 815 consensus Cyclic nucleotide-gated cation channel C 99.63
cd00038115 CAP_ED effector domain of the CAP family of transc 99.61
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.61
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.59
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.56
PLN02868 413 acyl-CoA thioesterase family protein 99.56
PRK11161 235 fumarate/nitrate reduction transcriptional regulat 99.55
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.53
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.48
PRK10402 226 DNA-binding transcriptional activator YeiL; Provis 99.43
PRK09391 230 fixK transcriptional regulator FixK; Provisional 99.34
PRK13918 202 CRP/FNR family transcriptional regulator; Provisio 99.34
KOG1113368 consensus cAMP-dependent protein kinase types I an 99.28
TIGR03697 193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.27
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.22
COG2905 610 Predicted signal-transduction protein containing c 99.17
KOG1113 368 consensus cAMP-dependent protein kinase types I an 99.13
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 98.96
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 97.88
PF04831153 Popeye: Popeye protein conserved region; InterPro: 97.12
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 97.1
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 96.97
PRK11832207 putative DNA-binding transcriptional regulator; Pr 95.85
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 92.37
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 91.24
PRK13290125 ectC L-ectoine synthase; Reviewed 85.63
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 84.14
COG1917131 Uncharacterized conserved protein, contains double 82.52
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-55  Score=446.45  Aligned_cols=229  Identities=33%  Similarity=0.545  Sum_probs=204.2

Q ss_pred             eeehhhhheeeccceeeceeeeeehhhHhHHHH-HHHHhhhcccceeeeeechhhHHHHHHHHcCCCCCCcccceecCCC
Q 023527            5 LVQHGLKVIRLAKLITEWKNSYNLNKWANLTFN-FGYLQAANVFGSLWYFFAVQRKAECWKKACTDFTRCDFLPLHCDDS   83 (281)
Q Consensus         5 l~~~~~~~~~l~~~~~~~~g~~~~taw~g~~~n-~~y~lashv~g~~wyl~~~~r~~~c~~~~c~~~~~c~~~~~~c~~~   83 (281)
                      .+|||+|++|++.|++|.+|+++||||||+|+| ++||||+|++|+|||++|+||++.||+++|-....|.  +++|.+ 
T Consensus       205 rL~Rl~Rv~~l~~r~~k~~~~v~~~awa~~a~ll~~~~l~sH~~gc~wYlia~~~~~~~~~~~tw~~~l~~--~~~~~~-  281 (727)
T KOG0498|consen  205 RLPRLRRVIPLFARLEKDTGFVYETAWAGAALLLSVYLLASHWAGCIWYLIAIERPASCPRKATWLGSLGR--LLSCYN-  281 (727)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCcccccccccccc--ccccCc-
Confidence            356788889999999999999999999999999 9999999999999999999999999999843222222  455533 


Q ss_pred             CCcccccccccccccCCCCCCCcchhhhhhhcCccccccchhhhhheehhhhhhhhHH----------------------
Q 023527           84 LTNYTFFSDFCSTKTQNATIYDFGIFRDAIQSGVLDQNYFFRRYLPCFQWSLQALRLR----------------------  141 (281)
Q Consensus        84 ~~~~~~~~~~c~~~~~~~~~f~~gi~~~a~~~~v~~~~~~~~~~~~~~~Wg~~~~st~----------------------  141 (281)
                                        ..|+||||.+|+            ||+||+|||++++||+                      
T Consensus       282 ------------------~~~~fg~~s~~~------------kY~~aLyw~l~tLstvG~g~~~s~~~~E~iFsi~~mi~  331 (727)
T KOG0498|consen  282 ------------------LSFTFGIYSLAL------------KYVYALYWGLSTLSTVGYGLVHANNMGEKIFSIFIMLF  331 (727)
T ss_pred             ------------------ccccccchhHHH------------HHHHHHHHHhhHhhhccCCccCCCCcHHHHHHHHHHHH
Confidence                              339999999998            9999999999999999                      


Q ss_pred             ----HHHH-------------------------------------------------------------Hhhcchhh---
Q 023527          142 ----LTFI-------------------------------------------------------------LSNKHKDP---  153 (281)
Q Consensus       142 ----f~~l-------------------------------------------------------------l~~lp~dl---  153 (281)
                          ||+|                                                             +++||++|   
T Consensus       332 GllL~A~lIGNmt~~iqs~tsR~~~~r~k~rd~e~~m~~~~LP~~LRqRi~~y~q~kw~~t~Gvdee~lL~~LP~~LR~d  411 (727)
T KOG0498|consen  332 GLLLFAYLIGNMTALLQSLTSRTEEMRDKMRDAEQWMSRRQLPPDLRQRIRRYEQYKWLATRGVDEEELLQSLPKDLRRD  411 (727)
T ss_pred             hHHHHHHHHhhHHHhHHHHhHHHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHhhccCcCHHHHHHhCCHHHHHH
Confidence                3333                                                             78899887   


Q ss_pred             ---------hhcCCCCCCCCHHHHHHHhhcceeEEecCCCeEEccCCCcCeEEEEEEcEEEEEEeccccccCCCcceee-
Q 023527          154 ---------ILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLN-  223 (281)
Q Consensus       154 ---------Lr~vplF~~L~e~~L~~I~~~l~~~~y~kGe~I~rEGDp~~~myfIl~G~V~v~~~~~~~~~gGr~~~~~-  223 (281)
                               |++||+|++||++.|++||+++|+..|+|||+|++|||++++||||++|.+++.+.+     ||  ++.+ 
T Consensus       412 I~~hL~~~lv~~vpLF~~md~~~L~al~~rlk~~~f~pge~iireGd~v~~myFI~rG~le~~~~~-----~g--~~~~~  484 (727)
T KOG0498|consen  412 IKRHLCLDLVRKVPLFAGMDDGLLDALCSRLKPEYFTPGEYIIREGDPVTDMYFIVRGSLESITTD-----GG--GFFVV  484 (727)
T ss_pred             HHHHHhHHHHhhCchhhcCCHHHHHHHHHHhhhhccCCCCeEEecCCccceeEEEEeeeEEEEEcc-----CC--ceEEE
Confidence                     999999999999999999999999999999999999999999999999999999988     76  4556 


Q ss_pred             eeecCCceechhhHHHhhcCCCCCCCCCcceEEEEcccEEEEEEcHHHHHHHHhhhc
Q 023527          224 NHLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNID  280 (281)
Q Consensus       224 ~~L~~GDffGE~lL~w~l~~~s~~~~p~s~~TV~Altdvell~L~~edL~~l~~~f~  280 (281)
                      ..|+|||+|||++++|+++      .| +++||+|+|.||++.|+++||++|+++|+
T Consensus       485 ~~L~~Gd~~GeEl~~~~~~------~p-~t~TVralt~~el~~L~~~dL~~V~~~f~  534 (727)
T KOG0498|consen  485 AILGPGDFFGEELLTWCLD------LP-QTRTVRALTYCELFRLSADDLKEVLQQFR  534 (727)
T ss_pred             EEecCCCccchHHHHHHhc------CC-CCceeehhhhhhHHhccHHHHHHHHHHhH
Confidence            9999999999999999984      24 48999999999999999999999999996

>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
1wgp_A137 Solution Structure Of The Cnmp-Binding Domain From 4e-20
>pdb|1WGP|A Chain A, Solution Structure Of The Cnmp-Binding Domain From Arabidopsis Thaliana Cyclic Nucleotide-Regulated Ion Channel Length = 137 Back     alignment and structure 
Iteration: 1

 Score = 95.1 bits (235), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 74/114 (64%), Gaps = 4/114 (3%)
Query: 160 FGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTXXXXXX 219
           F N+D   L+ +C+ +KP +FTE+SY+++E +P+++MLF+++G+L + T    T      
Sbjct: 14  FENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVT----TDGGRSG 69
Query: 220 XXXXXXXXXXDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLK 273
                     DF G+EL+ WA    + SNLP ST+T++ALT+VEAF L+A +LK
Sbjct: 70  FYNRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELK 123

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 2e-25
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 1e-17
3ukn_A212 Novel protein similar to vertebrate potassium VOL 5e-17
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 4e-16
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 7e-16
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 3e-08
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 4e-04
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 5e-07
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 3e-04
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 6e-07
4din_B381 CAMP-dependent protein kinase type I-beta regulat 9e-07
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 8e-04
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 9e-05
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 2e-04
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 2e-04
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 3e-04
1ft9_A222 Carbon monoxide oxidation system transcription reg 4e-04
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
 Score = 97.2 bits (242), Expect = 2e-25
 Identities = 53/121 (43%), Positives = 81/121 (66%), Gaps = 6/121 (4%)

Query: 157 VEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELS 216
           V  F N+D   L+ +C+ +KP +FTE+SY+++E +P+++MLF+++G+L       VT   
Sbjct: 11  VPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRL-----ESVTTDG 65

Query: 217 SNSGNLNN-HLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQV 275
             SG  N   L+ GDF G+EL+ WA    + SNLP ST+T++ALT+VEAF L+A +LK V
Sbjct: 66  GRSGFYNRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFV 125

Query: 276 L 276
            
Sbjct: 126 A 126
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.84
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.82
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.81
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.81
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.81
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.8
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.8
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.8
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.79
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.79
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.79
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 99.78
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 99.77
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.77
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.77
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 99.76
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 99.76
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.76
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.76
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.75
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.75
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.75
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.75
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.73
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 99.72
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.72
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 99.71
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.7
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.69
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 99.69
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.69
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.69
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.69
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.68
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.66
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.66
1ft9_A 222 Carbon monoxide oxidation system transcription reg 99.65
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.65
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.65
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.65
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.65
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.64
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.63
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.6
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.59
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.59
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 99.55
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 99.53
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.49
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.47
3b02_A 195 Transcriptional regulator, CRP family; structural 99.38
2zcw_A 202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.31
3rns_A 227 Cupin 2 conserved barrel domain protein; structura 91.32
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 90.8
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 87.59
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 86.75
3lwc_A119 Uncharacterized protein; structural genomics, unkn 84.21
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 84.18
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 81.64
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 81.45
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 80.97
1v70_A105 Probable antibiotics synthesis protein; structural 80.16
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
Probab=99.84  E-value=4.6e-21  Score=153.32  Aligned_cols=125  Identities=42%  Similarity=0.736  Sum_probs=103.7

Q ss_pred             hhhhhcCCCCCCCCHHHHHHHhhcceeEEecCCCeEEccCCCcCeEEEEEEcEEEEEEeccccccCCCcceee-eeecCC
Q 023527          151 KDPILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLN-NHLEGG  229 (281)
Q Consensus       151 ~dlLr~vplF~~L~e~~L~~I~~~l~~~~y~kGe~I~rEGDp~~~myfIl~G~V~v~~~~~~~~~gGr~~~~~-~~L~~G  229 (281)
                      .++|+++|+|+.|++++++.|+..++.+.|++|++|+++||+.+++|||++|.|++....     +|++..+. ..++||
T Consensus         5 ~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~~~g~~i~~~G~~~~~~y~i~~G~v~~~~~~-----~g~~~~~~~~~l~~G   79 (137)
T 1wgp_A            5 SSGVRRVPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTD-----GGRSGFYNRSLLKEG   79 (137)
T ss_dssp             SCSCSSCSGGGSCCHHHHHHHHHHCBCCCBCTTEEEECTTSBCSEEEEEEECCCEEECCS-----SCSSSSSCEEECCTT
T ss_pred             HHHHHcCcchhhCCHHHHHHHHHHheEEEeCCCCEEEeCCCCCCeEEEEEeeEEEEEEcC-----CCcceeeeeeeecCC
Confidence            467899999999999999999999999999999999999999999999999999965334     67765551 289999


Q ss_pred             ceechhhHHHhhcCCCCCCCCCcceEEEEcccEEEEEEcHHHHHHHHhhhc
Q 023527          230 DFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNID  280 (281)
Q Consensus       230 DffGE~lL~w~l~~~s~~~~p~s~~TV~Altdvell~L~~edL~~l~~~f~  280 (281)
                      |+|||..+.+++...+....|++++|++|+++|+++.|++++|+++++++.
T Consensus        80 ~~fGe~~l~~~~~~~~~~~~~~~~~~~~A~~~~~~~~i~~~~~~~l~~~~p  130 (137)
T 1wgp_A           80 DFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFR  130 (137)
T ss_dssp             CBSSTHHHHHHHCSSCCSSSCBCSSEEEESSCBEEEEEEHHHHHHHHHHHC
T ss_pred             CEecHHHHHHHhccccccccccceeEEEEeEEEEEEEECHHHHHHHHHHCH
Confidence            999998643344432111122467899999999999999999999998873
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 281
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 1e-11
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 0.002
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable cyclic nucleotide-gated ion channel 6
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 59.2 bits (142), Expect = 1e-11
 Identities = 49/117 (41%), Positives = 81/117 (69%), Gaps = 4/117 (3%)

Query: 160 FGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNS 219
           F N+D   L+ +C+ +KP +FTE+SY+++E +P+++MLF+++G+L + T    T+   + 
Sbjct: 14  FENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVT----TDGGRSG 69

Query: 220 GNLNNHLEGGDFSGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVL 276
               + L+ GDF G+EL+ WA    + SNLP ST+T++ALT+VEAF L+A +LK V 
Sbjct: 70  FYNRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVA 126
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.93
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.86
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.83
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.83
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.82
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.82
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.8
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.8
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.8
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.79
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.74
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.74
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.73
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.71
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.7
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.67
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.62
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 93.27
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 92.17
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 89.34
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 87.01
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 84.38
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 82.67
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 82.24
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable cyclic nucleotide-gated ion channel 6
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.93  E-value=4.6e-26  Score=185.44  Aligned_cols=123  Identities=42%  Similarity=0.746  Sum_probs=110.1

Q ss_pred             hhhcCCCCCCCCHHHHHHHhhcceeEEecCCCeEEccCCCcCeEEEEEEcEEEEEEeccccccCCCcceee-eeecCCce
Q 023527          153 PILLVEEFGNLDGSSLEKLCDVVKPAVFTERSYIIQEENPIDQMLFVLQGKLWTYTSRRVTELSSNSGNLN-NHLEGGDF  231 (281)
Q Consensus       153 lLr~vplF~~L~e~~L~~I~~~l~~~~y~kGe~I~rEGDp~~~myfIl~G~V~v~~~~~~~~~gGr~~~~~-~~L~~GDf  231 (281)
                      .|+++|+|++|+++++++|+.+++++.|+||++|+++||+.++||||++|.|+++..+     +++..... ..++|||+
T Consensus         7 ~l~~vp~F~~l~~~~l~~l~~~~~~~~~~~ge~I~~~Gd~~~~ly~i~~G~v~~~~~~-----~~~~~~~~~~~l~~G~~   81 (137)
T d1wgpa_           7 GVRRVPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTD-----GGRSGFYNRSLLKEGDF   81 (137)
T ss_dssp             SCSSCSGGGSCCHHHHHHHHHHCBCCCBCTTEEEECTTSBCSEEEEEEECCCEEECCS-----SCSSSSSCEEECCTTCB
T ss_pred             HHHCCHhHhCCCHHHHHHHHHhcEEEEECCCCEEEecccccceeehhccCceEEEEec-----CCCceeeeeeeccCCcE
Confidence            4899999999999999999999999999999999999999999999999999988766     33333333 78999999


Q ss_pred             echhhHHHhhcCCCCCCCCCcceEEEEcccEEEEEEcHHHHHHHHhhhc
Q 023527          232 SGEELIAWAKAGHNSSNLPISTKTIQALTKVEAFVLMAYDLKQVLLNID  280 (281)
Q Consensus       232 fGE~lL~w~l~~~s~~~~p~s~~TV~Altdvell~L~~edL~~l~~~f~  280 (281)
                      |||..|.+.+++.+..+.+++++||+|+++|+++.|+++||+++++|||
T Consensus        82 fGE~~ll~~~~~~~~~~~~~r~~tv~a~t~~~l~~L~~~dl~~il~~~~  130 (137)
T d1wgpa_          82 CGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFR  130 (137)
T ss_dssp             SSTHHHHHHHCSSCCSSSCBCSSEEEESSCBEEEEEEHHHHHHHHHHHC
T ss_pred             EcchhHhccCCCcccccccccCcEEEEeeeEEEEEEEHHHHHHHHHHhc
Confidence            9999887777776666778899999999999999999999999999996
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure