Citrus Sinensis ID: 023700
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 278 | ||||||
| 3367594 | 303 | putative protein [Arabidopsis thaliana] | 0.920 | 0.844 | 0.567 | 6e-80 | |
| 224133580 | 329 | predicted protein [Populus trichocarpa] | 0.647 | 0.547 | 0.654 | 4e-62 | |
| 255579785 | 322 | conserved hypothetical protein [Ricinus | 0.586 | 0.506 | 0.689 | 1e-60 | |
| 449434454 | 405 | PREDICTED: uncharacterized protein LOC10 | 0.751 | 0.516 | 0.468 | 5e-59 | |
| 449491279 | 380 | PREDICTED: uncharacterized LOC101218748 | 0.751 | 0.55 | 0.468 | 2e-58 | |
| 297798346 | 375 | hypothetical protein ARALYDRAFT_491070 [ | 0.384 | 0.285 | 0.680 | 3e-57 | |
| 147782976 | 418 | hypothetical protein VITISV_010788 [Viti | 0.618 | 0.411 | 0.647 | 1e-56 | |
| 21593770 | 375 | unknown [Arabidopsis thaliana] | 0.352 | 0.261 | 0.666 | 2e-56 | |
| 18419647 | 376 | NAD(P)H dehydrogenase (quinone)s [Arabid | 0.352 | 0.260 | 0.666 | 2e-56 | |
| 357483971 | 352 | hypothetical protein MTR_5g023180 [Medic | 0.546 | 0.431 | 0.722 | 3e-56 |
| >gi|3367594|emb|CAA20046.1| putative protein [Arabidopsis thaliana] gi|7270528|emb|CAB81485.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 303 bits (776), Expect = 6e-80, Method: Compositional matrix adjust.
Identities = 152/268 (56%), Positives = 199/268 (74%), Gaps = 12/268 (4%)
Query: 16 SLPSLPHR-----TRLSVLPVKCLSSRQSRDSDSDSDLRTTPSPSSTSGFSP----YGWC 66
S+ S P R R +P+KC SS DS L ++ S S++ + Y W
Sbjct: 24 SVTSYPRRFEVSDRRFPAIPIKCSSSEPENGEDSAPSLSSSSSSSTSEVSTSNSSTYNWY 83
Query: 67 AGIGGVGFLETTYLSYLKLTNSDAFCPIGGASCGDVLNSDYAVVFGVPLPFIGMFAY--- 123
GIGG+G L+T YL+YLK+T SDAFCPIGG +CGDVLNSDYAVVF + L + A
Sbjct: 84 TGIGGIGMLDTAYLTYLKVTGSDAFCPIGGGTCGDVLNSDYAVVFVLCLRCLSNIALQDV 143
Query: 124 GVEEIQKVLGVQLCIASLVVAALSTSYSSIQPLSSSVAEANLPFFETEITTSSSPFALSL 183
++EIQ+V+G+Q+C+A +VVA+L+ SYS+ QP+ S + LP+F TEI++SSSP+A++L
Sbjct: 144 KLQEIQQVVGLQICLAIIVVASLTASYSTAQPIPSRSGDIELPYFRTEISSSSSPYAIAL 203
Query: 184 AKHLHAIGAKMYGAFWCSHCLEQKQMFGSEAVKQLNYVECFPDGYRKGTKIAKACSDAKI 243
AKHL++IGAKMYGAFWCSHCLEQK+MFG EA K+LNYVECFPDGY+KGTKI KAC+DA I
Sbjct: 204 AKHLNSIGAKMYGAFWCSHCLEQKEMFGREAAKELNYVECFPDGYKKGTKILKACADAAI 263
Query: 244 EGFPTWVINGQVLSGEQDLSDLAKASGF 271
EGFPTW+IN +VLSGE +L++LA+ +GF
Sbjct: 264 EGFPTWIINDKVLSGEIELAELAEMTGF 291
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224133580|ref|XP_002327630.1| predicted protein [Populus trichocarpa] gi|222836715|gb|EEE75108.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255579785|ref|XP_002530730.1| conserved hypothetical protein [Ricinus communis] gi|223529694|gb|EEF31636.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449434454|ref|XP_004135011.1| PREDICTED: uncharacterized protein LOC101218748 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449491279|ref|XP_004158848.1| PREDICTED: uncharacterized LOC101218748 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297798346|ref|XP_002867057.1| hypothetical protein ARALYDRAFT_491070 [Arabidopsis lyrata subsp. lyrata] gi|297312893|gb|EFH43316.1| hypothetical protein ARALYDRAFT_491070 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|147782976|emb|CAN72958.1| hypothetical protein VITISV_010788 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|21593770|gb|AAM65737.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18419647|ref|NP_567988.1| NAD(P)H dehydrogenase (quinone)s [Arabidopsis thaliana] gi|20466524|gb|AAM20579.1| putative protein [Arabidopsis thaliana] gi|22136450|gb|AAM91303.1| putative protein [Arabidopsis thaliana] gi|332661159|gb|AEE86559.1| NAD(P)H dehydrogenase (quinone)s [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357483971|ref|XP_003612272.1| hypothetical protein MTR_5g023180 [Medicago truncatula] gi|355513607|gb|AES95230.1| hypothetical protein MTR_5g023180 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 278 | ||||||
| TAIR|locus:2128028 | 376 | LTO1 "Lumen Thiol Oxidoreducta | 0.629 | 0.465 | 0.589 | 6.1e-55 |
| TAIR|locus:2128028 LTO1 "Lumen Thiol Oxidoreductase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 567 (204.7 bits), Expect = 6.1e-55, P = 6.1e-55
Identities = 105/178 (58%), Positives = 142/178 (79%)
Query: 94 IGGASCGDVLNSDYAVVFGVPLPFIGMFAYGVEEIQKVLGVQLCIASLVVAALSTSYSSI 153
+ G+SC L S + L F+ + ++EIQ+V+G+Q+C+A +VVA+L+ SYS+
Sbjct: 190 LSGSSCLYCLVSAF---LSFSLFFLSVKDVKLQEIQQVVGLQICLAIIVVASLTASYSTA 246
Query: 154 QPLSSSVAEANLPFFETEITTSSSPFALSLAKHLHAIGAKMYGAFWCSHCLEQKQMFGSE 213
QP+ S + LP+F TEI++SSSP+A++LAKHL++IGAKMYGAFWCSHCLEQK+MFG E
Sbjct: 247 QPIPSRSGDIELPYFRTEISSSSSPYAIALAKHLNSIGAKMYGAFWCSHCLEQKEMFGRE 306
Query: 214 AVKQLNYVECFPDGYRKGTKIAKACSDAKIEGFPTWVINGQVLSGEQDLSDLAKASGF 271
A K+LNYVECFPDGY+KGTKI KAC+DA IEGFPTW+IN +VLSGE +L++LA+ +GF
Sbjct: 307 AAKELNYVECFPDGYKKGTKILKACADAAIEGFPTWIINDKVLSGEIELAELAEMTGF 364
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00570020 | hypothetical protein (329 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| estExt_Genewise1_v1.C_LG_V3745 | • | • | • | 0.458 | |||||||
| estExt_fgenesh4_kg.C_LG_VII0034 | • | • | • | 0.440 | |||||||
| eugene3.60030002 | • | 0.438 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 278 | |||
| cd12916 | 133 | cd12916, VKOR_1, Vitamin K epoxide reductase famil | 2e-20 | |
| smart00756 | 142 | smart00756, VKc, Family of likely enzymes that inc | 3e-14 | |
| pfam07884 | 138 | pfam07884, VKOR, Vitamin K epoxide reductase famil | 5e-12 | |
| COG4243 | 156 | COG4243, COG4243, Predicted membrane protein [Func | 2e-09 | |
| cd10546 | 126 | cd10546, VKOR, Vitamin K epoxide reductase (VKOR) | 5e-08 | |
| cd12918 | 126 | cd12918, VKOR_arc, Vitamin K epoxide reductase fam | 4e-06 | |
| PRK14889 | 143 | PRK14889, PRK14889, VKOR family protein; Provision | 2e-05 | |
| cd12922 | 133 | cd12922, VKOR_5, Vitamin K epoxide reductase famil | 2e-04 |
| >gnl|CDD|240599 cd12916, VKOR_1, Vitamin K epoxide reductase family in bacteria and plants | Back alignment and domain information |
|---|
Score = 84.6 bits (210), Expect = 2e-20
Identities = 31/64 (48%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
Query: 62 PYGWCAGIGGVGFLETTYLSYLKLTNSDAFCPIGGASCGDVLNSDYAVVFGVPLPFIGMF 121
AG+ +G LET YL+Y+KLT S A CP GG C VLNS YA + G+PL G
Sbjct: 1 SRRLIAGLALIGLLETAYLTYVKLTGSSAVCPGGG-GCDTVLNSPYATLLGIPLSLFGFL 59
Query: 122 AYGV 125
AY
Sbjct: 60 AYLA 63
|
This family includes vitamin K epoxide reductase (VKOR) present in bacteria and plant. VKOR (also named VKORC1) is an integral membrane protein that catalyzes the reduction of vitamin K 2,3-epoxide and vitamin K to vitamin K hydroquinone, an essential co-factor subsequently used in the gamma-carboxylation of glutamic acid residues in blood coagulation enzymes. All homologs of VKOR contain an active site CXXC motif, which is switched between reduced and disulfide-bonded states during the reaction cycle. In some plant and bacterial homologs, the VKOR domain is fused with domains of the thioredoxin family of oxidoreductases which may function as redox partners in initiating the reduction cascade. Length = 133 |
| >gnl|CDD|214805 smart00756, VKc, Family of likely enzymes that includes the catalytic subunit of vitamin K epoxide reductase | Back alignment and domain information |
|---|
| >gnl|CDD|149126 pfam07884, VKOR, Vitamin K epoxide reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|226694 COG4243, COG4243, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|240598 cd10546, VKOR, Vitamin K epoxide reductase (VKOR) family | Back alignment and domain information |
|---|
| >gnl|CDD|240601 cd12918, VKOR_arc, Vitamin K epoxide reductase family in archaea and some bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|184883 PRK14889, PRK14889, VKOR family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240605 cd12922, VKOR_5, Vitamin K epoxide reductase family in bacteria | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 278 | |||
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 99.56 | |
| smart00756 | 142 | VKc Family of likely enzymes that includes the cat | 99.55 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 99.53 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 99.51 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 99.48 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 99.46 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 99.46 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 99.46 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 99.46 | |
| PRK14889 | 143 | VKOR family protein; Provisional | 99.45 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 99.44 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 99.43 | |
| PF07884 | 137 | VKOR: Vitamin K epoxide reductase family; InterPro | 99.42 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 99.39 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 99.36 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 99.36 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 99.36 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 99.34 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 99.32 | |
| PHA02278 | 103 | thioredoxin-like protein | 99.31 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 99.3 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 99.3 | |
| PHA02125 | 75 | thioredoxin-like protein | 99.3 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 99.29 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 99.28 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 99.28 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 99.27 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 99.27 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 99.23 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 99.23 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 99.21 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 99.18 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 99.17 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 99.15 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 99.15 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 99.14 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 99.14 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 99.13 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 99.13 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 99.13 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 99.13 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 99.12 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 99.12 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 99.09 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 99.09 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 99.09 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 99.09 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 99.08 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 99.08 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 99.06 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 99.01 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 99.0 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 99.0 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 99.0 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 99.0 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 98.99 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 98.99 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 98.98 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 98.97 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 98.97 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 98.96 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 98.96 | |
| COG4243 | 156 | Predicted membrane protein [Function unknown] | 98.96 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 98.93 | |
| KOG1731 | 606 | consensus FAD-dependent sulfhydryl oxidase/quiesci | 98.93 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 98.91 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 98.9 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 98.86 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 98.85 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 98.81 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 98.74 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.69 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 98.69 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 98.67 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 98.66 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 98.66 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 98.66 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 98.64 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 98.61 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 98.59 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 98.58 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 98.55 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 98.54 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 98.54 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 98.54 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 98.53 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 98.52 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 98.51 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 98.5 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 98.5 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 98.5 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 98.47 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 98.47 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 98.44 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 98.42 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 98.42 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 98.41 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 98.39 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 98.39 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 98.39 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 98.36 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 98.36 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 98.35 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 98.34 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 98.31 | |
| smart00594 | 122 | UAS UAS domain. | 98.3 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 98.27 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 98.25 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 98.24 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 98.23 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 98.23 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 98.23 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 98.19 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 98.18 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 98.18 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 98.18 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 98.15 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 98.12 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 98.08 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 98.06 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 97.96 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 97.96 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 97.95 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 97.91 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 97.91 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 97.83 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 97.83 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 97.8 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.76 | |
| COG4232 | 569 | Thiol:disulfide interchange protein [Posttranslati | 97.67 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 97.62 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 97.53 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 97.51 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 97.51 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 97.51 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 97.46 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 97.45 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 97.44 | |
| KOG0913 | 248 | consensus Thiol-disulfide isomerase and thioredoxi | 97.42 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 97.41 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 97.36 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.22 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 97.17 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 97.17 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 97.08 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 96.81 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 96.68 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 96.6 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 96.52 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 96.36 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 96.29 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 96.24 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 96.19 | |
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 96.18 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 96.1 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 96.08 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 96.06 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 96.01 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 95.91 | |
| cd02991 | 116 | UAS_ETEA UAS family, ETEA subfamily; composed of p | 95.86 | |
| PF13462 | 162 | Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV | 95.81 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 95.72 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 95.63 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 95.56 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 95.52 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 95.49 | |
| PLN02412 | 167 | probable glutathione peroxidase | 95.24 | |
| cd03022 | 192 | DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-car | 95.13 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 95.08 | |
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 95.08 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 94.99 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 94.87 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 94.58 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 94.5 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 94.43 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 94.28 | |
| PF01323 | 193 | DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 | 94.12 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 93.94 | |
| PRK13190 | 202 | putative peroxiredoxin; Provisional | 93.88 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 93.71 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 93.55 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 93.48 | |
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 93.4 | |
| cd03018 | 149 | PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik | 93.37 | |
| cd03016 | 203 | PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub | 93.16 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 93.15 | |
| KOG3425 | 128 | consensus Uncharacterized conserved protein [Funct | 93.14 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 92.92 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 92.57 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 92.41 | |
| cd03024 | 201 | DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a D | 92.33 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 92.29 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 90.87 | |
| PTZ00253 | 199 | tryparedoxin peroxidase; Provisional | 90.81 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 90.66 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 90.29 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 90.12 | |
| cd03019 | 178 | DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m | 89.89 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 89.56 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 89.44 | |
| COG1651 | 244 | DsbG Protein-disulfide isomerase [Posttranslationa | 89.36 | |
| PRK15000 | 200 | peroxidase; Provisional | 89.21 | |
| cd02971 | 140 | PRX_family Peroxiredoxin (PRX) family; composed of | 89.15 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 89.14 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 88.37 | |
| KOG0914 | 265 | consensus Thioredoxin-like protein [Posttranslatio | 87.42 | |
| PRK13189 | 222 | peroxiredoxin; Provisional | 86.46 | |
| TIGR03137 | 187 | AhpC peroxiredoxin. This gene contains two invaria | 85.24 | |
| PRK10954 | 207 | periplasmic protein disulfide isomerase I; Provisi | 85.23 | |
| PRK00611 | 135 | putative disulfide oxidoreductase; Provisional | 83.18 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 82.99 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 82.48 | |
| PTZ00137 | 261 | 2-Cys peroxiredoxin; Provisional | 82.47 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 80.39 |
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
Probab=99.56 E-value=1.1e-14 Score=112.87 Aligned_cols=73 Identities=21% Similarity=0.381 Sum_probs=60.2
Q ss_pred ccceEEEccCCCHHHHHHHHhhhhHhh--h---cCcEEEccCCCCCCCcccHHhhhhcCCcccceeEE--CCE---EecC
Q 023700 189 AIGAKMYGAFWCSHCLEQKQMFGSEAV--K---QLNYVECFPDGYRKGTKIAKACSDAKIEGFPTWVI--NGQ---VLSG 258 (278)
Q Consensus 189 ~~gakmYGA~WCpHC~~qK~lFgkeA~--~---~l~yVEC~~dg~n~~~k~~~lC~~~~V~GyPTw~i--nGk---~y~G 258 (278)
..-+++|+|+||+||++++|.|.+.|. + .+..|||+.+ .++|++++|++|||+++ +|+ +|.|
T Consensus 19 ~~~~v~f~a~wC~~C~~~~p~~~~~a~~~~~~~~~~~vd~~~~--------~~~~~~~~v~~~Pt~~~~~~g~~~~~~~G 90 (101)
T cd03003 19 EIWFVNFYSPRCSHCHDLAPTWREFAKEMDGVIRIGAVNCGDD--------RMLCRSQGVNSYPSLYVFPSGMNPEKYYG 90 (101)
T ss_pred CeEEEEEECCCChHHHHhHHHHHHHHHHhcCceEEEEEeCCcc--------HHHHHHcCCCccCEEEEEcCCCCcccCCC
Confidence 455788999999999999999988542 2 2457999753 48999999999999987 776 7999
Q ss_pred CCCHHHHHHHh
Q 023700 259 EQDLSDLAKAS 269 (278)
Q Consensus 259 ~rsle~La~~s 269 (278)
.++.++|.+|+
T Consensus 91 ~~~~~~l~~f~ 101 (101)
T cd03003 91 DRSKESLVKFA 101 (101)
T ss_pred CCCHHHHHhhC
Confidence 99999999874
|
This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. |
| >smart00756 VKc Family of likely enzymes that includes the catalytic subunit of vitamin K epoxide reductase | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14889 VKOR family protein; Provisional | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >PF07884 VKOR: Vitamin K epoxide reductase family; InterPro: IPR012932 Vitamin K epoxide reductase (VKOR) recycles reduced vitamin K, which is used subsequently as a co-factor in the gamma-carboxylation of glutamic acid residues in blood coagulation enzymes | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >COG4243 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
| >PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PRK13190 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >KOG3425 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PTZ00253 tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15000 peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13189 peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR03137 AhpC peroxiredoxin | Back alignment and domain information |
|---|
| >PRK10954 periplasmic protein disulfide isomerase I; Provisional | Back alignment and domain information |
|---|
| >PRK00611 putative disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00137 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 278 | ||||
| 3kp9_A | 291 | Structure Of A Bacterial Homolog Of Vitamin K Epoxi | 5e-25 | ||
| 3kp8_A | 106 | The Thioredoxin-Like Domain Of A Vkor Homolog From | 2e-23 |
| >pdb|3KP9|A Chain A, Structure Of A Bacterial Homolog Of Vitamin K Epoxide Reductase Length = 291 | Back alignment and structure |
|
| >pdb|3KP8|A Chain A, The Thioredoxin-Like Domain Of A Vkor Homolog From Synechococcus Sp Length = 106 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 278 | |||
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 4e-45 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 2e-37 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 4e-05 |
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Length = 291 | Back alignment and structure |
|---|
Score = 153 bits (386), Expect = 4e-45
Identities = 78/281 (27%), Positives = 108/281 (38%), Gaps = 57/281 (20%)
Query: 44 SDSDLRTTPSPSSTSGFSPYGWCAGIGGVGFLETTYLSYLKLTNSDAFCPIGGASCGDVL 103
S L+ A + G+G L T YL+Y KLT A G VL
Sbjct: 3 SYLKLKAQEETWLQR--HSRLILAILAGLGSLLTAYLTYTKLTEQPAAFCTGDGGSDLVL 60
Query: 104 NSDYAVVFGVPLPFIGMFAYGVEEIQKVLGV----------------------------- 134
+S +A G+P +G+ + VL
Sbjct: 61 SSRWAEFLGIPTAAVGLLGFLGVLALAVLPDGLPLVKRWRWPALFGLVSAMTAFEMYMLY 120
Query: 135 -------QLCIASLVVAALSTSYSSIQPLSSSVAEANLPFFETEIT-------------- 173
Q C+ L + L + F +
Sbjct: 121 LMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLDGGKLAFSYILVAFLTLVTTIGVYAN 180
Query: 174 --TSSSPFALSLAKHLHAIGAKMYGAFWCSHCLEQKQMFGSEAVKQLNYVECFPDGYRKG 231
SP A+ LA HL IG MYGA+WC HC +QK++FG A Q+ YVEC P+G G
Sbjct: 181 QVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFG-AAFDQVPYVECSPNG--PG 237
Query: 232 TKIAKACSDAKIEGFPTWVINGQVLSGEQDLSDLAKASGFP 272
T A+ C++A I +PTW+ING+ +G + L LA ASG+P
Sbjct: 238 TPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYP 278
|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Length = 106 | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 278 | |||
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 100.0 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 99.86 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 99.54 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 99.53 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 99.48 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 99.45 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 99.45 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 99.44 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 99.44 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 99.44 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 99.43 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 99.43 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 99.42 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 99.42 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 99.41 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 99.41 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 99.41 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 99.41 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 99.41 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 99.4 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 99.4 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 99.4 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 99.4 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 99.4 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 99.4 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 99.4 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 99.4 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.39 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 99.39 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 99.39 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 99.38 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 99.38 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 99.38 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 99.38 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 99.38 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 99.38 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 99.38 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 99.37 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 99.37 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 99.37 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 99.37 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 99.37 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 99.37 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 99.36 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 99.36 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 99.36 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 99.35 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 99.35 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 99.34 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 99.33 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 99.32 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 99.32 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 99.32 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 99.31 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 99.31 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.31 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 99.3 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 99.3 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 99.3 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 99.3 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 99.3 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.3 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 99.29 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 99.29 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 99.29 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 99.29 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 99.29 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 99.28 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 99.28 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 99.27 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 99.27 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 99.27 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 99.27 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.27 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.27 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 99.26 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.26 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 99.25 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.25 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.24 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.23 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.22 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 99.21 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 99.21 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 99.2 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 99.19 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.19 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 98.81 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 99.18 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 98.8 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 99.17 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 99.17 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 99.16 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 99.15 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 99.14 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.14 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.13 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 99.13 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 99.12 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 99.12 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 99.12 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 99.11 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 99.1 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 99.1 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 99.08 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 99.06 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 99.06 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.05 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 99.05 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 99.03 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 99.03 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 99.03 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 99.02 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 99.02 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 99.02 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 99.02 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 99.01 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 98.99 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 98.99 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 98.99 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 98.98 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.98 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 98.98 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 98.98 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 98.98 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 98.97 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 98.96 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 98.95 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 98.94 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 98.93 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 98.92 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 98.91 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 98.91 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 98.91 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 98.89 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 98.88 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 98.88 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 98.88 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 98.85 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 98.85 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 98.85 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 98.84 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 98.84 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 98.84 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 98.83 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 98.83 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 98.82 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 98.81 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 98.81 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 98.8 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 98.79 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.79 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 98.78 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 98.77 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 98.76 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 98.72 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 98.71 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 98.71 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 98.69 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 98.69 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 98.68 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 98.68 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 98.66 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 98.66 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 98.66 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 98.64 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 98.64 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 98.63 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 98.63 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 98.62 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 98.6 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 98.6 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 98.59 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 98.57 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 98.56 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 98.55 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 98.53 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 98.49 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 98.47 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 98.47 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.47 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 98.44 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 98.42 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 98.4 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 98.39 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 98.39 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 98.38 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 98.37 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 97.72 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 98.36 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 98.32 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 98.31 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 98.3 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 98.29 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 98.29 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 97.62 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 98.29 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 98.27 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 98.27 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 98.23 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 98.22 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 98.21 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 98.19 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 98.16 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 98.14 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 98.14 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 98.13 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 98.11 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 98.06 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 98.03 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 98.01 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 98.0 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 98.0 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 97.96 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 97.95 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 97.95 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 97.93 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 97.9 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 97.89 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 97.88 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 97.82 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 97.8 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 97.78 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 97.71 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 97.7 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 97.68 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 97.67 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 97.63 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 97.61 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 97.61 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 97.46 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 97.42 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 97.38 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 97.37 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 97.37 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 97.33 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 97.3 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 97.28 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 97.12 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 97.1 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 97.08 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 97.06 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 97.05 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 97.04 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 97.0 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 96.98 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 96.96 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 96.94 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 96.92 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 96.91 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 96.82 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 96.8 | |
| 4g2e_A | 157 | Peroxiredoxin; redox protein, structural genomics, | 96.67 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 96.67 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 96.43 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 96.4 | |
| 3l9v_A | 189 | Putative thiol-disulfide isomerase or thioredoxin; | 96.28 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 96.22 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 96.08 | |
| 2pwj_A | 171 | Mitochondrial peroxiredoxin; alpha and beta protei | 96.02 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 96.01 | |
| 3feu_A | 185 | Putative lipoprotein; alpha-beta structure, struct | 96.0 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 95.95 | |
| 3bci_A | 186 | Disulfide bond protein A; thiol-disulfide oxidored | 95.94 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 95.82 | |
| 3gha_A | 202 | Disulfide bond formation protein D; BDBD, DSBA-lik | 95.6 | |
| 1q98_A | 165 | Thiol peroxidase, TPX; structural genomics, NYSGXR | 95.6 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 95.44 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 95.44 | |
| 3gmf_A | 205 | Protein-disulfide isomerase; oxidoreductase, PSI-2 | 95.41 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 95.38 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 95.35 | |
| 1tp9_A | 162 | Peroxiredoxin, PRX D (type II); oligomer, thioredo | 95.21 | |
| 2wfc_A | 167 | Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan | 95.13 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 95.06 | |
| 3gn3_A | 182 | Putative protein-disulfide isomerase; MCSG, PSI, s | 95.06 | |
| 2imf_A | 203 | HCCA isomerase, 2-hydroxychromene-2-carboxylate is | 94.99 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 94.92 | |
| 3fz5_A | 202 | Possible 2-hydroxychromene-2-carboxylate isomeras; | 94.8 | |
| 2ec4_A | 178 | FAS-associated factor 1; UAS domain, protein FAF1, | 94.74 | |
| 3zrd_A | 200 | Thiol peroxidase; oxidoreductase, 2Cys peroxiredox | 94.53 | |
| 3uma_A | 184 | Hypothetical peroxiredoxin protein; nysgrc, PSI bi | 94.45 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 94.45 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 94.36 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 94.28 | |
| 3mng_A | 173 | Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, | 94.01 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 93.97 | |
| 3me7_A | 170 | Putative uncharacterized protein; electron transfe | 93.94 | |
| 3l9s_A | 191 | Thiol:disulfide interchange protein; thioredoxin-f | 93.79 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 93.43 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 93.37 | |
| 3feu_A | 185 | Putative lipoprotein; alpha-beta structure, struct | 93.11 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 93.01 | |
| 2in3_A | 216 | Hypothetical protein; DSBA family, FRNE-like subfa | 93.01 | |
| 3gl5_A | 239 | Putative DSBA oxidoreductase SCO1869; probable DSB | 92.95 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 92.73 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 92.71 | |
| 1r4w_A | 226 | Glutathione S-transferase, mitochondrial; glutathi | 92.46 | |
| 4gqc_A | 164 | Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f | 92.29 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 92.05 | |
| 3c7m_A | 195 | Thiol:disulfide interchange protein DSBA-like; red | 91.92 | |
| 3f4s_A | 226 | Alpha-DSBA1, putative uncharacterized protein; thi | 91.51 | |
| 3keb_A | 224 | Probable thiol peroxidase; structural genomics, AP | 90.68 | |
| 3rpp_A | 234 | Glutathione S-transferase kappa 1; glutathione tra | 88.46 | |
| 1prx_A | 224 | HORF6; peroxiredoxin, hydrogen peroxide, redox reg | 88.18 | |
| 3sbc_A | 216 | Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c | 88.04 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 85.77 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 85.13 | |
| 4eo3_A | 322 | Bacterioferritin comigratory protein/NADH dehydro; | 85.04 | |
| 4f82_A | 176 | Thioredoxin reductase; structural genomics, niaid, | 84.88 | |
| 1xcc_A | 220 | 1-Cys peroxiredoxin; unknown function, structural | 84.41 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 83.97 | |
| 3l9v_A | 189 | Putative thiol-disulfide isomerase or thioredoxin; | 83.71 | |
| 2v2g_A | 233 | Peroxiredoxin 6; oxidoreductase, antioxidant enzym | 83.44 | |
| 3l9s_A | 191 | Thiol:disulfide interchange protein; thioredoxin-f | 82.72 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 82.17 | |
| 3kzq_A | 208 | Putative uncharacterized protein VP2116; protein w | 82.06 | |
| 3c7m_A | 195 | Thiol:disulfide interchange protein DSBA-like; red | 81.25 |
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
Probab=100.00 E-value=9.9e-49 Score=362.67 Aligned_cols=195 Identities=37% Similarity=0.657 Sum_probs=170.9
Q ss_pred CCCChhhH-HHHHHHHHHHHHHHHHHhhhcC-CCccCCCCCCCccccccchhhhhcCcchhHHHHHHHh-----------
Q 023700 58 SGFSPYGW-CAGIGGVGFLETTYLSYLKLTN-SDAFCPIGGASCGDVLNSDYAVVFGVPLPFIGMFAYG----------- 124 (278)
Q Consensus 58 ~~~~~~~~-i~~la~iGll~t~yLt~~kl~~-~~~~C~i~~~gC~~Vl~S~ya~vfGiPlsl~Gl~aY~----------- 124 (278)
|...+.++ |++++++|+++|+|||++|+++ ++++|++| .||++||+||||++||+||+++|+++|+
T Consensus 14 ~~~~~~~~~~~~l~~iGl~~s~yLt~~~~~~~~~~~C~~~-~sC~~Vl~S~~a~~fGiP~~~~G~~~y~~v~~l~~~~~~ 92 (291)
T 3kp9_A 14 WLQRHSRLILAILAGLGSLLTAYLTYTKLTEQPAAFCTGD-GGSDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPDG 92 (291)
T ss_dssp --CCSCSHHHHHHHHHHHHHHHHHHHHHHHCCCCSCCCC----CCSGGGSSSSEETTEEHHHHHHHHHHHHHHHHHCC--
T ss_pred cchhhHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCC-CChhhhcccccHhhcCCcHHHHHHHHHHHHHHHHHHHhh
Confidence 33444554 6689999999999999999997 78999987 7999999999999999999999999998
Q ss_pred ------------------------------------------------------------HHHHHHHHHHHHHHHHHHHH
Q 023700 125 ------------------------------------------------------------VEEIQKVLGVQLCIASLVVA 144 (278)
Q Consensus 125 ------------------------------------------------------------w~~~~~~~~~~~~v~~~~l~ 144 (278)
|+|+||++|++++|+++|++
T Consensus 93 ~~~~~~~~~~~l~~~~~~~~~fs~yL~y~~~~vi~a~C~~C~~~~~i~~~l~~~~~~g~~~~~~~~~~~~~~~~~~~~~~ 172 (291)
T 3kp9_A 93 LPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLDGGKLAFSYILVAFLTLV 172 (291)
T ss_dssp CTTCSTTHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCCHHHHHHHHHHHHHHHHHHSSCHHHHCTHHHHHHHHHHHHHHH
T ss_pred ccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCcHHHHHHHHHHHHHHHHHHhCCChhhhhHHHHHHHHHHHHHHH
Confidence 89999999999999999999
Q ss_pred HHHhhcccCCCCCcccccCCCCCCcccccCCCCHHHHHHHhhhcccceEEEccCCCHHHHHHHHhhhhHhhhcCcEEEcc
Q 023700 145 ALSTSYSSIQPLSSSVAEANLPFFETEITTSSSPFALSLAKHLHAIGAKMYGAFWCSHCLEQKQMFGSEAVKQLNYVECF 224 (278)
Q Consensus 145 ~~~~~y~~~~~~~~~~~~~~~~~~~~~it~~S~~~~~aLAkhL~~~gakmYGA~WCpHC~~qK~lFgkeA~~~l~yVEC~ 224 (278)
+++++|++.++ +|+|.++++|+|+++.++++|+|+|||||++++|.|++.| +++++|||+
T Consensus 173 ~~~~~~~~~~~-------------------~s~~~~~~la~~l~~~~vV~F~A~WC~~Ck~l~p~le~lA-~~l~~Vd~d 232 (291)
T 3kp9_A 173 TTIGVYANQVP-------------------PPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAF-DQVPYVECS 232 (291)
T ss_dssp HHHHHHHTTSC-------------------CCCSTHHHHHHHHHHTTCEEEECTTCHHHHHHHHHHGGGG-GGSCEEESC
T ss_pred HHHHHHhcCCC-------------------CCCHHHHHHHHHhCCCCEEEEECCCCHHHHHHHHHHHHHH-HHcCEEEEe
Confidence 99999998532 2889999999999999999999999999999999999965 678899999
Q ss_pred CCCC-CCCcccHHhhhhcCCcccceeEECCEEecCCCCHHHHHHHhCCCCCCC
Q 023700 225 PDGY-RKGTKIAKACSDAKIEGFPTWVINGQVLSGEQDLSDLAKASGFPEMSQ 276 (278)
Q Consensus 225 ~dg~-n~~~k~~~lC~~~~V~GyPTw~inGk~y~G~rsle~La~~sG~~g~~~ 276 (278)
+++. + +++++|++++|++||||++|||+|.|.++.++|.+++||++++.
T Consensus 233 ~~d~~~---~~~~la~~~gI~~vPT~~i~G~~~~G~~~~~~L~~~l~~~~~~~ 282 (291)
T 3kp9_A 233 PNGPGT---PQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPLEEG 282 (291)
T ss_dssp SSCSSS---CCCHHHHTTTCCSTTEEEETTEEEESCCCHHHHHHHTCCCC---
T ss_pred ecCchh---hHHHHHHHcCCcccCeEEECCEEecCCCCHHHHHHHHCCCCccc
Confidence 6543 2 25699999999999999999999999999999999999998764
|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A | Back alignment and structure |
|---|
| >1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A | Back alignment and structure |
|---|
| >1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} | Back alignment and structure |
|---|
| >3fz5_A Possible 2-hydroxychromene-2-carboxylate isomeras; 2-hydroxychromene-2-carboxylate ISO structural genomics, PSI-2; HET: MSE GSH PGE; 2.40A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A | Back alignment and structure |
|---|
| >3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A | Back alignment and structure |
|---|
| >3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3gl5_A Putative DSBA oxidoreductase SCO1869; probable DSBA oxidoreductase structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >1r4w_A Glutathione S-transferase, mitochondrial; glutathione transferase, kappa GST, RGSTK1-1; HET: GSH; 2.50A {Rattus norvegicus} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A | Back alignment and structure |
|---|
| >3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* | Back alignment and structure |
|---|
| >3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3rpp_A Glutathione S-transferase kappa 1; glutathione transferase, kappa GST, TRX domain, GSH binding, detoxification, APO form; 1.80A {Homo sapiens} PDB: 3rpn_A 1yzx_A* | Back alignment and structure |
|---|
| >1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A | Back alignment and structure |
|---|
| >3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, STRU genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 278 | ||||
| d1nhoa_ | 85 | c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik | 1e-05 | |
| d1z6ma1 | 172 | c.47.1.13 (A:1-172) Hypothetical protein EF0770 {E | 7e-05 | |
| d1fo5a_ | 85 | c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-lik | 6e-04 | |
| d1egoa_ | 85 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 0.002 |
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: MTH807, thioredoxin/glutaredoxin-like protein species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Score = 40.8 bits (95), Expect = 1e-05
Identities = 10/77 (12%), Positives = 26/77 (33%), Gaps = 4/77 (5%)
Query: 193 KMYGAFWCSHCLEQKQMFGSEAVKQLNYVECFPDGYRKGTKIAKACSDAKIEGFPTWVIN 252
+++ + C +C ++ + + ++ + + + P IN
Sbjct: 6 EVFTSPTCPYCPMAIEVVDEAKKEFGDKIDVEKIDIMVDREK---AIEYGLMAVPAIAIN 62
Query: 253 GQV-LSGEQDLSDLAKA 268
G V G +L +A
Sbjct: 63 GVVRFVGAPSREELFEA 79
|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Length = 172 | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 278 | |||
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 99.61 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 99.6 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 99.58 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.57 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 99.56 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 99.55 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 99.55 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.54 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 99.53 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.53 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 99.48 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.47 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 99.46 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 99.45 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.45 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.44 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 99.43 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.43 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 99.42 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 99.42 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 99.41 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 99.41 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.41 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.39 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 99.35 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 99.29 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 99.27 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 99.23 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 99.08 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 99.02 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 98.88 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.84 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 98.81 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 98.69 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 98.67 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 98.64 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 98.61 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 98.59 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 98.58 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 98.54 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.48 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 98.44 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 98.42 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.31 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 98.29 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.26 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 98.08 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 98.07 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 98.04 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 97.88 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 97.87 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 97.67 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 97.52 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 97.5 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 97.49 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 97.36 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 97.36 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 96.92 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 96.79 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 96.77 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 96.5 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 96.38 | |
| d2cx4a1 | 160 | Bacterioferritin comigratory protein {Archaeon Aer | 95.97 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 95.48 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 94.53 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 93.66 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 93.61 | |
| d1xvwa1 | 153 | Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri | 92.31 | |
| d1uula_ | 194 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 92.3 | |
| d1q98a_ | 164 | Thiol peroxidase Tpx {Haemophilus influenzae [TaxI | 92.15 | |
| d1psqa_ | 163 | Probable thiol peroxidase PsaD {Streptococcus pneu | 91.45 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 91.17 | |
| d2zcta1 | 237 | Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | 90.32 | |
| d1e2ya_ | 167 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 89.87 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 89.76 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 89.06 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 88.86 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 87.61 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 86.19 | |
| d1zyea1 | 158 | Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ | 85.94 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 85.32 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 84.68 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 84.63 | |
| d1r4wa_ | 221 | Mitochondrial class kappa glutathione S-transferas | 84.45 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 83.62 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 83.19 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 82.41 | |
| d1zofa1 | 170 | Thioredoxin reductase TsaA {Helicobacter pylori [T | 81.77 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 81.37 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 81.03 | |
| d1we0a1 | 166 | Alkyl hydroperoxide reductase AhpC {Amphibacillus | 80.45 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 80.04 |
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: PDI-like domain: Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain species: Salmonella typhimurium [TaxId: 90371]
Probab=99.61 E-value=8.5e-16 Score=117.25 Aligned_cols=78 Identities=15% Similarity=0.350 Sum_probs=62.2
Q ss_pred hhhcc-cceEEEccCCCHHHHHHHHhhhhHhh--hcC--cEEEccCCCCCCCcccHHhhhhcCCcccceeEECCE-EecC
Q 023700 185 KHLHA-IGAKMYGAFWCSHCLEQKQMFGSEAV--KQL--NYVECFPDGYRKGTKIAKACSDAKIEGFPTWVINGQ-VLSG 258 (278)
Q Consensus 185 khL~~-~gakmYGA~WCpHC~~qK~lFgkeA~--~~l--~yVEC~~dg~n~~~k~~~lC~~~~V~GyPTw~inGk-~y~G 258 (278)
+.|.. ..+++|+|+|||||++++|.|.+-|. .++ .+||++. .+++|++++|+++||+++||+ .+.|
T Consensus 11 k~l~~~~~i~~F~s~~C~~C~~~~p~~~~~a~~~~~i~~~~vd~~~--------~~~l~~~~~I~~vPt~~~ng~~~~~G 82 (96)
T d1hyua4 11 RDIDGDFEFETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGT--------FQNEITERNVMGVPAVFVNGKEFGQG 82 (96)
T ss_dssp HHCCSCEEEEEEECTTCSSHHHHHHHHHHHHHHCTTEEEEEEETTT--------CHHHHHHTTCCSSSEEEETTEEEEES
T ss_pred HhcCCCeEEEEEECCCCcchHHHHHHHHHHHHhCCceEEEEEeccc--------chHHHhhcccccccEEEECCEEEEec
Confidence 34433 45788999999999999999988542 233 4566653 369999999999999999998 6889
Q ss_pred CCCHHHHHHHhC
Q 023700 259 EQDLSDLAKASG 270 (278)
Q Consensus 259 ~rsle~La~~sG 270 (278)
.+++++|.++..
T Consensus 83 ~~~~~~l~~~le 94 (96)
T d1hyua4 83 RMTLTEIVAKVD 94 (96)
T ss_dssp CCCHHHHHHHHC
T ss_pred CCCHHHHHHHHh
Confidence 999999998764
|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r4wa_ c.47.1.13 (A:) Mitochondrial class kappa glutathione S-transferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|