Citrus Sinensis ID: 023713


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYGY
ccccccccccccccEEEEcccccEEcccccEEEccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccc
ccccccccccccccEEEEcccccEEcHHccEEEcccEccccccHEEccccccccccccccccccccccccccEEEEcccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MADSYCADCKRLTEVvfdhsagdticseCGLVLEaysvdetsewrifanessdhdpvrvggplnpllsggglstviakptaggstellsgslgklqarsshpdrNLIQAFKSISAMSDRLGLVTTIKDRANEIYKkvedqkplrgrnQEAIVAACLYIACrqenkprtvKEFCSVANGTTKKEIGRAKEFIVKHLEAemgqsvemgtiHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYGY
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFAnessdhdpvrVGGPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKsisamsdrlGLVTTIKDRANEIykkvedqkplrgrnQEAIVAACLYIACrqenkprtvKEFCSvangttkkeigRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYGY
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVggplnpllsggglsTVIAKPTAggstellsgslgklQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNqavkaaqeavqkSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYGY
****YCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFAN**********************L*TV*******************************IQAFKSISAMSDRLGLVTTIKDRANEIYKKV*******GRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYG*
**DSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEW********************PLLSGGGL********************************NLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYGY
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAGGSTELLSGSL*********PDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQ*********QKSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYGY
****YCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFAN***********GPLNPLLSGGGLSTVIAKPTA***TELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYGY
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRLILVFFSLFLVETHIQLIVWAFMRCIYTFRCYGY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query278 2.2.26 [Sep-21-2011]
Q8W0W3312 Transcription initiation yes no 0.935 0.833 0.743 1e-112
P48513313 Transcription initiation yes no 0.938 0.833 0.731 1e-111
Q9SS44312 Transcription initiation yes no 0.874 0.778 0.762 1e-110
P48512312 Transcription initiation no no 0.935 0.833 0.674 1e-102
P29052315 Transcription initiation yes no 0.805 0.711 0.476 8e-53
P29054316 Transcription initiation N/A no 0.798 0.702 0.467 2e-51
Q5R886316 Transcription initiation yes no 0.798 0.702 0.458 8e-49
Q4R3J5316 Transcription initiation N/A no 0.798 0.702 0.458 8e-49
Q00403316 Transcription initiation yes no 0.798 0.702 0.458 8e-49
P62916316 Transcription initiation yes no 0.798 0.702 0.458 8e-49
>sp|Q8W0W3|TF2B_ORYSJ Transcription initiation factor IIB OS=Oryza sativa subsp. japonica GN=TFIIB PE=1 SV=1 Back     alignment and function desciption
 Score =  405 bits (1041), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 222/261 (85%), Gaps = 1/261 (0%)

Query: 1   MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVG 60
           M+DS+C DCK+ TEV FDHSAGDT+C+ECGLVLEA+SVDETSEWR FANESSD+DPVRVG
Sbjct: 1   MSDSFCPDCKKHTEVAFDHSAGDTVCTECGLVLEAHSVDETSEWRTFANESSDNDPVRVG 60

Query: 61  GPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRL 120
           GP NPLL+ GGLSTVIAKP  G   E LS SLG+ Q R S+PDR+LI AF++I+ M+DRL
Sbjct: 61  GPTNPLLTDGGLSTVIAKPN-GAQGEFLSSSLGRWQNRGSNPDRSLILAFRTIANMADRL 119

Query: 121 GLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTT 180
           GLV TIKDRANEIYKKVED K +RGRNQ+AI+AACLYIACRQE++PRTVKE CSVANG T
Sbjct: 120 GLVATIKDRANEIYKKVEDLKSIRGRNQDAILAACLYIACRQEDRPRTVKEICSVANGAT 179

Query: 181 KKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED 240
           KKEIGRAKEFIVK LE EMGQS+EMGTIHA D+LRRFCS LGM NQAVKAAQEAVQ+SE+
Sbjct: 180 KKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDFLRRFCSTLGMNNQAVKAAQEAVQRSEE 239

Query: 241 LDIRLILVFFSLFLVETHIQL 261
           LDIR   +  +  ++    QL
Sbjct: 240 LDIRRSPISIAAAVIYMITQL 260




General factor that plays a major role in the activation of eukaryotic genes transcribed by RNA polymerase II.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|P48513|TF2B_SOYBN Transcription initiation factor IIB OS=Glycine max GN=TFIIB1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SS44|TF2B2_ARATH Transcription initiation factor IIB-2 OS=Arabidopsis thaliana GN=TFIIB2 PE=2 SV=1 Back     alignment and function description
>sp|P48512|TF2B1_ARATH Transcription initiation factor IIB-1 OS=Arabidopsis thaliana GN=TFIIB1 PE=1 SV=1 Back     alignment and function description
>sp|P29052|TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster GN=TfIIB PE=2 SV=1 Back     alignment and function description
>sp|P29054|TF2B_XENLA Transcription initiation factor IIB OS=Xenopus laevis GN=gtf2b PE=2 SV=1 Back     alignment and function description
>sp|Q5R886|TF2B_PONAB Transcription initiation factor IIB OS=Pongo abelii GN=GTF2B PE=2 SV=1 Back     alignment and function description
>sp|Q4R3J5|TF2B_MACFA Transcription initiation factor IIB OS=Macaca fascicularis GN=GTF2B PE=2 SV=1 Back     alignment and function description
>sp|Q00403|TF2B_HUMAN Transcription initiation factor IIB OS=Homo sapiens GN=GTF2B PE=1 SV=1 Back     alignment and function description
>sp|P62916|TF2B_RAT Transcription initiation factor IIB OS=Rattus norvegicus GN=Gtf2b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
224135681311 predicted protein [Populus trichocarpa] 0.874 0.781 0.852 1e-120
255544920312 transcription initiation factor iib, put 0.935 0.833 0.758 1e-115
225436547314 PREDICTED: transcription initiation fact 0.877 0.777 0.791 1e-113
225464249312 PREDICTED: transcription initiation fact 0.935 0.833 0.754 1e-111
225441886312 PREDICTED: transcription initiation fact 0.935 0.833 0.754 1e-111
255588003312 transcription initiation factor iib, put 0.874 0.778 0.790 1e-111
115480363312 Os09g0534800 [Oryza sativa Japonica Grou 0.935 0.833 0.743 1e-111
242045402312 hypothetical protein SORBIDRAFT_02g03102 0.935 0.833 0.739 1e-110
317106705312 JHL06B08.6 [Jatropha curcas] 0.874 0.778 0.786 1e-110
449465789312 PREDICTED: transcription initiation fact 0.935 0.833 0.739 1e-110
>gi|224135681|ref|XP_002322134.1| predicted protein [Populus trichocarpa] gi|222869130|gb|EEF06261.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 225/244 (92%), Gaps = 1/244 (0%)

Query: 1   MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVG 60
           M DSYC DCKRLTE+VFDHSAGDTICSECGL+LEA+SVDETSEWR F+NESSDHDP RVG
Sbjct: 1   MEDSYCPDCKRLTEIVFDHSAGDTICSECGLILEAHSVDETSEWRTFSNESSDHDPNRVG 60

Query: 61  GPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRL 120
           GPLNPLL+ GGLST I+K T GGS ELLS SLGK Q+R ++PDRN IQAFKSI+AM+DRL
Sbjct: 61  GPLNPLLADGGLSTTISK-TNGGSNELLSCSLGKWQSRGANPDRNRIQAFKSIAAMADRL 119

Query: 121 GLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTT 180
           GLVTTIKDRANEIYKKVEDQKPL+GRNQ+AI+AACLYIACRQENK RTVKE CSV NGTT
Sbjct: 120 GLVTTIKDRANEIYKKVEDQKPLKGRNQDAILAACLYIACRQENKARTVKEICSVVNGTT 179

Query: 181 KKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED 240
           KKEIGRAKEFIVKHLE EMG S+EMGTIHA+DYLRRFCSNLGMTNQAVKAA EAVQKSE+
Sbjct: 180 KKEIGRAKEFIVKHLEVEMGHSMEMGTIHAADYLRRFCSNLGMTNQAVKAAHEAVQKSEE 239

Query: 241 LDIR 244
           LDIR
Sbjct: 240 LDIR 243




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255544920|ref|XP_002513521.1| transcription initiation factor iib, putative [Ricinus communis] gi|223547429|gb|EEF48924.1| transcription initiation factor iib, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225436547|ref|XP_002277679.1| PREDICTED: transcription initiation factor IIB [Vitis vinifera] gi|297734946|emb|CBI17180.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464249|ref|XP_002269045.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera] gi|296088031|emb|CBI35314.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225441886|ref|XP_002284342.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera] gi|297739630|emb|CBI29812.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255588003|ref|XP_002534470.1| transcription initiation factor iib, putative [Ricinus communis] gi|223525233|gb|EEF27913.1| transcription initiation factor iib, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|115480363|ref|NP_001063775.1| Os09g0534800 [Oryza sativa Japonica Group] gi|21362998|sp|Q8W0W3.1|TF2B_ORYSJ RecName: Full=Transcription initiation factor IIB; AltName: Full=General transcription factor TFIIB gi|18481632|gb|AAL73491.1|AF464908_1 general transcription factor TFIIB [Oryza sativa] gi|50725809|dbj|BAD33339.1| Transcription initiation factor IIB [Oryza sativa Japonica Group] gi|50726577|dbj|BAD34211.1| Transcription initiation factor IIB [Oryza sativa Japonica Group] gi|113632008|dbj|BAF25689.1| Os09g0534800 [Oryza sativa Japonica Group] gi|125564497|gb|EAZ09877.1| hypothetical protein OsI_32170 [Oryza sativa Indica Group] gi|125606444|gb|EAZ45480.1| hypothetical protein OsJ_30135 [Oryza sativa Japonica Group] gi|347737122|gb|AEP20532.1| transcription factor [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242045402|ref|XP_002460572.1| hypothetical protein SORBIDRAFT_02g031020 [Sorghum bicolor] gi|241923949|gb|EER97093.1| hypothetical protein SORBIDRAFT_02g031020 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|317106705|dbj|BAJ53205.1| JHL06B08.6 [Jatropha curcas] Back     alignment and taxonomy information
>gi|449465789|ref|XP_004150610.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis sativus] gi|449529834|ref|XP_004171903.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
TAIR|locus:2076259312 AT3G10330 [Arabidopsis thalian 0.874 0.778 0.651 2.5e-81
TAIR|locus:2062703312 TFIIB "transcription factor II 0.874 0.778 0.606 3.1e-76
ZFIN|ZDB-GENE-030131-3544316 gtf2b "general transcription f 0.798 0.702 0.401 2.3e-39
FB|FBgn0004915315 TfIIB "Transcription factor II 0.798 0.704 0.410 2.9e-39
UNIPROTKB|F1NXP2306 GTF2B "Uncharacterized protein 0.798 0.725 0.401 3.7e-39
UNIPROTKB|F2Z4J6316 LOC786656 "Uncharacterized pro 0.798 0.702 0.393 1.5e-37
UNIPROTKB|Q2KIN8316 GTF2B "Transcription initiatio 0.798 0.702 0.393 1.5e-37
UNIPROTKB|E2RPG1316 GTF2B "Uncharacterized protein 0.798 0.702 0.393 1.5e-37
UNIPROTKB|Q00403316 GTF2B "Transcription initiatio 0.798 0.702 0.393 1.5e-37
UNIPROTKB|F2Z5J6316 GTF2B "Uncharacterized protein 0.798 0.702 0.393 1.5e-37
TAIR|locus:2076259 AT3G10330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 816 (292.3 bits), Expect = 2.5e-81, P = 2.5e-81
 Identities = 159/244 (65%), Positives = 182/244 (74%)

Query:     1 MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVX 60
             M+D++C+DCKR TEVVFDHSAGDT+CSECGLVLE++S+DETSEWR FANES D+DPVRV 
Sbjct:     1 MSDAFCSDCKRHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60

Query:    61 XXXXXXXXXXXXXTVIAKPTAXXXXXXXXXXXXXXQARSSHPDRNLIQAFKSISAMSDRL 120
                          TVI+KP                Q R S+PDR LI AFK+I+ M+DRL
Sbjct:    61 GPTNPLLADGGLTTVISKPNGSSGDFLSSSLGRW-QNRGSNPDRGLIVAFKTIATMADRL 119

Query:   121 GLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTT 180
             GLV TIKDRANEIYK+VEDQK  RGRNQ+A++AACLYIACRQE+KPRTVKE CSVANG T
Sbjct:   120 GLVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGAT 179

Query:   181 KKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNXXXXXXXXXXXXSED 240
             KKEIGRAKE+IVK L  E GQ VEMGTIHA D++RRFCSNLGMTN            SE+
Sbjct:   180 KKEIGRAKEYIVKQLGLETGQLVEMGTIHAGDFMRRFCSNLGMTNQTVKAAQESVQKSEE 239

Query:   241 LDIR 244
              DIR
Sbjct:   240 FDIR 243




GO:0003743 "translation initiation factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006352 "DNA-dependent transcription, initiation" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0006413 "translational initiation" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=RCA
TAIR|locus:2062703 TFIIB "transcription factor IIB" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3544 gtf2b "general transcription factor IIB" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0004915 TfIIB "Transcription factor IIB" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXP2 GTF2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4J6 LOC786656 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIN8 GTF2B "Transcription initiation factor IIB" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPG1 GTF2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q00403 GTF2B "Transcription initiation factor IIB" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5J6 GTF2B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W0W3TF2B_ORYSJNo assigned EC number0.74320.93520.8333yesno
Q9SS44TF2B2_ARATHNo assigned EC number0.76220.87410.7788yesno
P48513TF2B_SOYBNNo assigned EC number0.73180.93880.8338yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XV000426
hypothetical protein (311 aa)
(Populus trichocarpa)
Predicted Functional Partners:
GTF902
global transcription factor group (201 aa)
    0.839
GTF901
global transcription factor group (202 aa)
    0.835
estExt_Genewise1_v1.C_LG_I4990
hypothetical protein (176 aa)
    0.635
gw1.IX.2304.1
hypothetical protein (321 aa)
    0.633
gw1.IV.3113.1
hypothetical protein (690 aa)
    0.530
estExt_Genewise1_v1.C_LG_IV3101
hypothetical protein (421 aa)
     0.504
grail3.2024000101
hypothetical protein (140 aa)
       0.451
estExt_fgenesh4_pg.C_LG_XII1303
RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1;; The proteasome is a multicatalytic p [...] (236 aa)
       0.441
estExt_Genewise1_v1.C_LG_XV2760
RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1; (235 aa)
       0.439
gw1.I.2689.1
hypothetical protein (1334 aa)
     0.436

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
COG1405285 COG1405, SUA7, Transcription initiation factor TFI 4e-55
PRK00423310 PRK00423, tfb, transcription initiation factor IIB 1e-47
pfam0038271 pfam00382, TFIIB, Transcription factor TFIIB repea 6e-20
cd0004388 cd00043, CYCLIN, Cyclin box fold 6e-13
smart0038583 smart00385, CYCLIN, domain present in cyclins, TFI 6e-10
pfam0827140 pfam08271, TF_Zn_Ribbon, TFIIB zinc-binding 7e-09
COG1405285 COG1405, SUA7, Transcription initiation factor TFI 9e-08
COG5333297 COG5333, CCL1, Cdk activating kinase (CAK)/RNA pol 7e-06
PRK00423310 PRK00423, tfb, transcription initiation factor IIB 7e-05
pfam00134127 pfam00134, Cyclin_N, Cyclin, N-terminal domain 0.003
>gnl|CDD|224323 COG1405, SUA7, Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
 Score =  179 bits (456), Expect = 4e-55
 Identities = 85/238 (35%), Positives = 129/238 (54%), Gaps = 20/238 (8%)

Query: 6   CADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNP 65
           C +C   T ++ D+  G+ +C++CGLVLE   +D   EWR F          RVG PL P
Sbjct: 4   CPECGS-TNIITDYERGEIVCADCGLVLEDSLIDPGPEWRAFDERHER----RVGAPLTP 58

Query: 66  LLSGGGLSTVIAKPTAGGSTELLSGSLGKLQAR---SSHPDRNLIQAFKSISAMSDRLGL 122
            +   GLST+I     G   +     L K Q R   SS  +RNLI A + +  ++  LGL
Sbjct: 59  SIHDKGLSTII-----GWGDKDKMYRLRKWQIRIRVSSAKERNLITALEELERIASALGL 113

Query: 123 VTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKK 182
             ++++ A  IY+K  D+  LRGR+ E++ AAC+Y ACR    PRT+ E      G +KK
Sbjct: 114 PESVRETAARIYRKAVDKGLLRGRSIESVAAACIYAACRINGVPRTLDEIAKAL-GVSKK 172

Query: 183 EIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED 240
           EIGR    +V+ L       +++  +  SDY+ RF S LG++++  + A E V+K++ 
Sbjct: 173 EIGRTYRLLVREL------KLKIPPVDPSDYIPRFASKLGLSDEVRRKAIEIVKKAKR 224


Length = 285

>gnl|CDD|234758 PRK00423, tfb, transcription initiation factor IIB; Reviewed Back     alignment and domain information
>gnl|CDD|109440 pfam00382, TFIIB, Transcription factor TFIIB repeat Back     alignment and domain information
>gnl|CDD|238003 cd00043, CYCLIN, Cyclin box fold Back     alignment and domain information
>gnl|CDD|214641 smart00385, CYCLIN, domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>gnl|CDD|203895 pfam08271, TF_Zn_Ribbon, TFIIB zinc-binding Back     alignment and domain information
>gnl|CDD|224323 COG1405, SUA7, Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>gnl|CDD|227640 COG5333, CCL1, Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234758 PRK00423, tfb, transcription initiation factor IIB; Reviewed Back     alignment and domain information
>gnl|CDD|215740 pfam00134, Cyclin_N, Cyclin, N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 278
PRK00423310 tfb transcription initiation factor IIB; Reviewed 100.0
KOG1597308 consensus Transcription initiation factor TFIIB [T 100.0
COG1405285 SUA7 Transcription initiation factor TFIIIB, Brf1 100.0
KOG1598 521 consensus Transcription initiation factor TFIIIB, 100.0
PF0038271 TFIIB: Transcription factor TFIIB repeat; InterPro 99.79
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 99.63
PRK00423310 tfb transcription initiation factor IIB; Reviewed 99.58
KOG0834323 consensus CDK9 kinase-activating protein cyclin T 99.44
KOG0835 367 consensus Cyclin L [General function prediction on 99.43
TIGR00569305 ccl1 cyclin ccl1. University). 99.42
COG1405285 SUA7 Transcription initiation factor TFIIIB, Brf1 99.41
KOG1597308 consensus Transcription initiation factor TFIIB [T 99.34
cd0004388 CYCLIN Cyclin box fold. Protein binding domain fun 99.16
COG5333297 CCL1 Cdk activating kinase (CAK)/RNA polymerase II 99.12
smart0038583 CYCLIN domain present in cyclins, TFIIB and Retino 99.06
KOG0794264 consensus CDK8 kinase-activating protein cyclin C 98.85
PF0038271 TFIIB: Transcription factor TFIIB repeat; InterPro 98.81
KOG0656335 consensus G1/S-specific cyclin D [Cell cycle contr 98.77
KOG1598 521 consensus Transcription initiation factor TFIIIB, 98.64
PF00134127 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR 98.09
cd0004388 CYCLIN Cyclin box fold. Protein binding domain fun 97.91
KOG0653391 consensus Cyclin B and related kinase-activating p 97.8
smart0038583 CYCLIN domain present in cyclins, TFIIB and Retino 97.73
COG5024440 Cyclin [Cell division and chromosome partitioning] 97.69
PF01857135 RB_B: Retinoblastoma-associated protein B domain; 97.68
KOG2496325 consensus Cdk activating kinase (CAK)/RNA polymera 97.67
PF1178136 RRN7: RNA polymerase I-specific transcription init 97.11
KOG0835367 consensus Cyclin L [General function prediction on 96.93
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 96.83
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 96.58
PRK00420112 hypothetical protein; Validated 96.56
PHA0062659 hypothetical protein 96.49
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 96.44
PF0166755 Ribosomal_S27e: Ribosomal protein S27; InterPro: I 96.42
PF02984118 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR 96.39
PF1324826 zf-ribbon_3: zinc-ribbon domain 96.27
PF02984118 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR 96.24
KOG0655408 consensus G1/S-specific cyclin E [Cell cycle contr 96.22
KOG4164497 consensus Cyclin ik3-1/CABLES [Cell cycle control, 96.21
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 96.2
PF1324023 zinc_ribbon_2: zinc-ribbon domain 96.09
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 95.96
PLN0020986 ribosomal protein S27; Provisional 95.92
PTZ0008385 40S ribosomal protein S27; Provisional 95.86
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 95.74
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 95.63
COG1645131 Uncharacterized Zn-finger containing protein [Gene 95.46
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 95.2
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 95.05
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 95.02
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 95.01
PRK0043250 30S ribosomal protein S27ae; Validated 94.92
PRK1182760 hypothetical protein; Provisional 94.9
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 94.74
smart0066152 RPOL9 RNA polymerase subunit 9. 94.35
PRK10220111 hypothetical protein; Provisional 94.34
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 94.28
PF1435461 Lar_restr_allev: Restriction alleviation protein L 94.23
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 94.07
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 94.06
PRK00464154 nrdR transcriptional regulator NrdR; Validated 94.04
PF0396668 Trm112p: Trm112p-like protein; InterPro: IPR005651 94.03
PF08613149 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eu 93.99
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 93.83
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 93.65
COG283560 Uncharacterized conserved protein [Function unknow 93.65
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 93.22
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 93.17
KOG4557262 consensus Origin recognition complex, subunit 6 [R 93.12
COG2824112 PhnA Uncharacterized Zn-ribbon-containing protein 92.63
TIGR00244147 transcriptional regulator NrdR. Members of this al 92.47
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 92.12
TIGR00686109 phnA alkylphosphonate utilization operon protein P 91.99
PRK12495226 hypothetical protein; Provisional 91.89
KOG177984 consensus 40s ribosomal protein S27 [Translation, 91.59
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 90.98
PRK1489299 putative transcription elongation factor Elf1; Pro 90.96
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 90.52
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 90.35
PF00134127 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR 90.33
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 90.24
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 90.16
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 89.95
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 89.9
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 89.67
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 89.52
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 89.41
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 89.41
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 89.22
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 89.08
PF1371937 zinc_ribbon_5: zinc-ribbon domain 88.94
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 88.93
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 88.85
PTZ0025590 60S ribosomal protein L37a; Provisional 88.63
KOG4557262 consensus Origin recognition complex, subunit 6 [R 88.49
COG4640 465 Predicted membrane protein [Function unknown] 87.91
PF1277350 DZR: Double zinc ribbon 87.48
PF1425552 Cys_rich_CPXG: Cysteine-rich CPXCG 87.38
PF0311928 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f 87.35
COG406864 Uncharacterized protein containing a Zn-ribbon [Fu 87.32
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 87.05
PRK06266178 transcription initiation factor E subunit alpha; V 87.04
TIGR00569305 ccl1 cyclin ccl1. University). 86.9
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 86.81
PRK05978148 hypothetical protein; Provisional 86.57
PRK0971064 lar restriction alleviation and modification prote 86.44
COG1656165 Uncharacterized conserved protein [Function unknow 86.34
PF05460 353 ORC6: Origin recognition complex subunit 6 (ORC6); 86.18
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 85.89
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 85.67
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 85.65
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 85.53
PRK0967872 DNA-binding transcriptional regulator; Provisional 85.51
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 85.24
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 84.91
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 84.86
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 84.49
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 84.36
KOG1010920 consensus Rb (Retinoblastoma tumor suppressor)-rel 84.01
COG3877122 Uncharacterized protein conserved in bacteria [Fun 83.94
COG5349126 Uncharacterized protein conserved in bacteria [Fun 83.82
COG1327156 Predicted transcriptional regulator, consists of a 83.6
PF0178356 Ribosomal_L32p: Ribosomal L32p protein family; Int 83.57
TIGR0244359 conserved hypothetical metal-binding protein. Memb 82.88
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 82.64
PF1277350 DZR: Double zinc ribbon 82.59
KOG0794264 consensus CDK8 kinase-activating protein cyclin C 82.46
PF1412287 YokU: YokU-like protein 81.41
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 81.38
PRK02935110 hypothetical protein; Provisional 81.19
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 81.06
PF11672102 DUF3268: Protein of unknown function (DUF3268); In 81.05
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 80.88
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 80.78
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 80.78
TIGR0103155 rpmF_bact ribosomal protein L32. This protein desc 80.63
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 80.46
TIGR03826137 YvyF flagellar operon protein TIGR03826. This gene 80.3
KOG1088124 consensus Uncharacterized conserved protein [Funct 80.26
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 80.04
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
Probab=100.00  E-value=3.8e-63  Score=449.46  Aligned_cols=252  Identities=31%  Similarity=0.554  Sum_probs=233.6

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEcCCCcccccccccccccchhhccCCCCCCCCCcccCCCCCcccCCCcceEEecCCCC
Q 023713            3 DSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAG   82 (278)
Q Consensus         3 ~~~Cp~Cg~~~~vv~D~~~G~~vC~~CG~Vl~e~~id~~~ewr~f~~~~~~~~~~r~G~~~~~~~~~~~~~t~i~~~~~~   82 (278)
                      ...||+||+ +++|+|+.+|++||.+||+|++|++||+|||||+|++++ .+|++|+|+|.++++||.|++|.|+++..+
T Consensus        11 ~~~Cp~Cg~-~~iv~d~~~Ge~vC~~CG~Vl~e~~iD~g~EWR~f~~~~-~~~~~RvG~~~~~~~~~~gl~T~I~~~~~~   88 (310)
T PRK00423         11 KLVCPECGS-DKLIYDYERGEIVCADCGLVIEENIIDQGPEWRAFDPEQ-REKRSRVGAPMTYTIHDKGLSTDIDWRNKD   88 (310)
T ss_pred             CCcCcCCCC-CCeeEECCCCeEeecccCCcccccccccCCCccCCCccc-cCCccccCCCCCccccCCCCceEeecCCcc
Confidence            367999998 689999999999999999999999999999999999754 468999999999999999999999977655


Q ss_pred             CCccccc-------cccccccccC---CCchhHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhCCCCCCCcHHHHH
Q 023713           83 GSTELLS-------GSLGKLQARS---SHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIV  152 (278)
Q Consensus        83 ~~~~~l~-------~~l~~~~~~~---~~~er~l~~~~~~I~~i~~~L~Lp~~v~e~A~~i~k~~~~~~~~~gr~~~~~a  152 (278)
                      ++|..++       .+|++||++.   +++||+|..+++.|+++|+.|+||+.++|+|..||+++++.++++||+.++++
T Consensus        89 ~~g~~l~~~~~~~~~rl~~~~~~~~~~~~~er~l~~a~~~I~~~~~~L~Lp~~v~e~A~~iyk~~~~~~~~rgrs~~~i~  168 (310)
T PRK00423         89 SYGKSISGKNRAQLYRLRKWQRRIRVSNAAERNLAFALSELDRIASQLGLPRSVREEAAVIYRKAVEKGLIRGRSIEGVV  168 (310)
T ss_pred             cccccccHHHHHHHHHHHHHhhhcccCChHhHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCcccCCCHHHHH
Confidence            5555443       2477888875   56899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCCCHHHHHHHHcCCCHHHHHHHHHHHHHHhhhhcccccccCCCCHHHHHHHHHhhcCCCHHHHHHHH
Q 023713          153 AACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQ  232 (278)
Q Consensus       153 AAclY~acR~~~~p~tl~eia~~~~~v~~~~i~~~~~~l~~~L~~~~~~~~~~~~~~p~~~i~r~~~~L~l~~~v~~~A~  232 (278)
                      |||||+|||++++|+|++||+.+ +++++++|+++|+.|.+.|+++      +++.+|++||+|||+.|+|++++.+.|.
T Consensus       169 AAclYiACR~~~~prtl~eI~~~-~~v~~k~i~~~~~~l~k~L~~~------~~~~~p~~~i~r~~~~L~L~~~v~~~A~  241 (310)
T PRK00423        169 AAALYAACRRCKVPRTLDEIAEV-SRVSRKEIGRCYRFLLRELNLK------LPPTDPIDYVPRFASELGLSGEVQKKAI  241 (310)
T ss_pred             HHHHHHHHHHcCCCcCHHHHHHH-hCCCHHHHHHHHHHHHHHhCCC------CCCCCHHHHHHHHHHHcCCCHHHHHHHH
Confidence            99999999999999999999995 8999999999999999999987      7889999999999999999999999999


Q ss_pred             HHHHHhhhcC--CCCChhHHHHHHHHHHHHHHHHH
Q 023713          233 EAVQKSEDLD--IRLILVFFSLFLVETHIQLIVWA  265 (278)
Q Consensus       233 ~i~~~~~~~~--~Gr~P~~iaaA~v~~~~~~~~~~  265 (278)
                      +|++++.+.|  .||+|.+||||+|  ||++.+..
T Consensus       242 ~i~~~a~~~~l~~Gr~P~sIAAAaI--YlA~~~~g  274 (310)
T PRK00423        242 EILQKAKEKGLTSGKGPTGLAAAAI--YIASLLLG  274 (310)
T ss_pred             HHHHHHHhcCcccCCCHHHHHHHHH--HHHHHHhC
Confidence            9999999888  6999999999999  99998764



>KOG1597 consensus Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription] Back     alignment and domain information
>PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>KOG0834 consensus CDK9 kinase-activating protein cyclin T [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>TIGR00569 ccl1 cyclin ccl1 Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>KOG1597 consensus Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>cd00043 CYCLIN Cyclin box fold Back     alignment and domain information
>COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>KOG0794 consensus CDK8 kinase-activating protein cyclin C [Transcription] Back     alignment and domain information
>PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>KOG0656 consensus G1/S-specific cyclin D [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription] Back     alignment and domain information
>PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>cd00043 CYCLIN Cyclin box fold Back     alignment and domain information
>KOG0653 consensus Cyclin B and related kinase-activating proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>COG5024 Cyclin [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01857 RB_B: Retinoblastoma-associated protein B domain; InterPro: IPR002719 Retinoblastoma-like and retinoblastoma-associated proteins may have a function in cell cycle regulation Back     alignment and domain information
>KOG2496 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF02984 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF02984 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>KOG0655 consensus G1/S-specific cyclin E [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4164 consensus Cyclin ik3-1/CABLES [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PLN00209 ribosomal protein S27; Provisional Back     alignment and domain information
>PTZ00083 40S ribosomal protein S27; Provisional Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PRK11827 hypothetical protein; Provisional Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function Back     alignment and domain information
>PF08613 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG2835 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair] Back     alignment and domain information
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00244 transcriptional regulator NrdR Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>KOG1779 consensus 40s ribosomal protein S27 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair] Back     alignment and domain information
>COG4640 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG Back     alignment and domain information
>PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown] Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>TIGR00569 ccl1 cyclin ccl1 Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>COG1656 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05460 ORC6: Origin recognition complex subunit 6 (ORC6); InterPro: IPR008721 The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [] Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG1010 consensus Rb (Retinoblastoma tumor suppressor)-related protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>PF01783 Ribosomal_L32p: Ribosomal L32p protein family; InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02443 conserved hypothetical metal-binding protein Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>KOG0794 consensus CDK8 kinase-activating protein cyclin C [Transcription] Back     alignment and domain information
>PF14122 YokU: YokU-like protein Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>PRK02935 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF11672 DUF3268: Protein of unknown function (DUF3268); InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150 Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>TIGR01031 rpmF_bact ribosomal protein L32 Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>TIGR03826 YvyF flagellar operon protein TIGR03826 Back     alignment and domain information
>KOG1088 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
1c9b_A207 Crystal Structure Of A Human Tbp Core Domain-Human 2e-26
2phg_A206 Model For Vp16 Binding To Tfiib Length = 206 9e-26
1tfb_A208 Nmr Studies Of Human General Transcription Factor T 1e-25
1vol_A204 Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEME 1e-23
3k7a_M345 Crystal Structure Of An Rna Polymerase Ii-Tfiib Com 6e-20
1d3u_B201 Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BBRE+T 4e-12
1ais_B200 Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BTATA- 4e-12
1rly_A60 Rdc-Derived Models Of The Zinc Ribbon Domain Of Hum 5e-05
1dl6_A58 Solution Structure Of Human Tfiib N-Terminal Domain 7e-05
3k1f_M197 Crystal Structure Of Rna Polymerase Ii In Complex W 2e-04
>pdb|1C9B|A Chain A, Crystal Structure Of A Human Tbp Core Domain-Human Tfiib Core Domain Complex Bound To An Extended, Modified Adenoviral Major Late Promoter (Admlp) Length = 207 Back     alignment and structure

Iteration: 1

Score = 115 bits (289), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 62/141 (43%), Positives = 87/141 (61%), Gaps = 7/141 (4%) Query: 103 DRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQ 162 DR ++ AFK I+ M+DR+ L I DR N ++K+V +QK L+GR +AI +ACLYIACRQ Sbjct: 2 DRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQ 61 Query: 163 ENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLG 222 E PRT KE C+V+ +KKEIGR + I+K LE SV++ I D++ RFCSNL Sbjct: 62 EGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET----SVDL--ITTGDFMSRFCSNLC 114 Query: 223 MTNXXXXXXXXXXXXSEDLDI 243 + + +LD+ Sbjct: 115 LPKQVQMAATHIARKAVELDL 135
>pdb|2PHG|A Chain A, Model For Vp16 Binding To Tfiib Length = 206 Back     alignment and structure
>pdb|1TFB|A Chain A, Nmr Studies Of Human General Transcription Factor Tfiib: Dynamics And Interaction With Vp16 Activation Domain, 20 Structures Length = 208 Back     alignment and structure
>pdb|1VOL|A Chain A, Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEMENT Ternary Complex Length = 204 Back     alignment and structure
>pdb|3K7A|M Chain M, Crystal Structure Of An Rna Polymerase Ii-Tfiib Complex Length = 345 Back     alignment and structure
>pdb|1D3U|B Chain B, Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BBRE+TATA- Box Complex From Pyrococcus Woesei Length = 201 Back     alignment and structure
>pdb|1AIS|B Chain B, Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BTATA-Box Complex From Pyrococcus Woesei Length = 200 Back     alignment and structure
>pdb|1RLY|A Chain A, Rdc-Derived Models Of The Zinc Ribbon Domain Of Human General Transcription Tfiib (Zinc Bound Structures) Length = 60 Back     alignment and structure
>pdb|1DL6|A Chain A, Solution Structure Of Human Tfiib N-Terminal Domain Length = 58 Back     alignment and structure
>pdb|3K1F|M Chain M, Crystal Structure Of Rna Polymerase Ii In Complex With Tfiib Length = 197 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 2e-50
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 6e-10
1ais_B200 TFB TFIIB, protein (transcription initiation facto 3e-36
1ais_B200 TFB TFIIB, protein (transcription initiation facto 3e-11
1c9b_A207 General transcription factor IIB; protein-DNA comp 2e-34
1c9b_A207 General transcription factor IIB; protein-DNA comp 6e-10
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 5e-23
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 1e-12
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 1e-11
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 1e-04
2b9r_A269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 2e-04
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 9e-04
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Length = 345 Back     alignment and structure
 Score =  168 bits (425), Expect = 2e-50
 Identities = 79/246 (32%), Positives = 116/246 (47%), Gaps = 9/246 (3%)

Query: 6   CADCKRL-TEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANE-SSDHDPVRVGGPL 63
           C +CK    ++V   S GD +C+ CGLVL    VD  SEWR F+N+  +  DP RVG   
Sbjct: 24  CPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEAS 83

Query: 64  NPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLV 123
           NPLL G  LST I K            +  + +      D  +  AF  I+ + D   L 
Sbjct: 84  NPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELP 143

Query: 124 TTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKE 183
             +KD A E YK   D+K L+G++ E+I+AA + I CR+    RT KE  S+ +    KE
Sbjct: 144 KIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIH-VKTKE 202

Query: 184 IGRAKEFIVKHLE------AEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQK 237
            G+    +   L            +  M       Y+ RFCS+LG+  Q   +A+   +K
Sbjct: 203 FGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKK 262

Query: 238 SEDLDI 243
            +++  
Sbjct: 263 CKEIKE 268


>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Length = 345 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Length = 207 Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Length = 207 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Length = 58 Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Length = 50 Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Length = 260 Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Length = 269 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
4bbr_M345 Transcription initiation factor IIB; RNA polymeras 100.0
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 100.0
1ais_B200 TFB TFIIB, protein (transcription initiation facto 100.0
1c9b_A207 General transcription factor IIB; protein-DNA comp 99.97
1zp2_A235 RNA polymerase II holoenzyme cyclin-like subunit; 99.89
2ivx_A257 Cyclin-T2; transcription regulation, cell division 99.82
2i53_A258 Cyclin K; cell cycle, transcription, cyclin BOX, C 99.81
3rgf_B285 Cyclin-C; protein kinase complex, transferase,tran 99.8
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 99.77
2b9r_A269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 99.76
1jkw_A323 Cyclin H; cell cycle, cell division, nuclear prote 99.76
2pk2_A 358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 99.74
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 99.71
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 99.71
2w96_A271 G1/S-specific cyclin-D1; serine/threonine-protein 99.69
1g3n_C257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 99.63
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 99.6
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 99.58
1ais_B200 TFB TFIIB, protein (transcription initiation facto 99.57
1w98_B283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 99.55
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 99.52
1c9b_A207 General transcription factor IIB; protein-DNA comp 99.39
4bbr_M345 Transcription initiation factor IIB; RNA polymeras 99.17
1f5q_B252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 99.16
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 98.99
3h4c_A260 Transcription factor TFIIB-like; cyclin, transcrip 97.82
1zp2_A235 RNA polymerase II holoenzyme cyclin-like subunit; 97.66
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 97.64
2b9r_A269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 97.58
3rgf_B285 Cyclin-C; protein kinase complex, transferase,tran 97.45
2w96_A271 G1/S-specific cyclin-D1; serine/threonine-protein 97.37
2i53_A258 Cyclin K; cell cycle, transcription, cyclin BOX, C 97.35
2ivx_A257 Cyclin-T2; transcription regulation, cell division 97.27
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 97.16
3m03_A95 ORC6, origin recognition complex subunit 6; helix 97.1
1g3n_C257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 97.06
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 96.73
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 96.64
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 96.64
1qxf_A66 GR2, 30S ribosomal protein S27E; structural genomi 96.6
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 96.52
3j20_W63 30S ribosomal protein S27E; archaea, archaeal, KIN 96.49
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 96.47
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 96.42
2pk2_A358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 96.38
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 96.24
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 96.18
2r7g_A347 PP110, retinoblastoma-associated protein, P105-RB, 96.1
3u5c_b82 RP61, YS20, 40S ribosomal protein S27-A; translati 96.1
4ell_A411 Retinoblastoma-associated protein; cyclin fold, tu 96.07
3iz6_X86 40S ribosomal protein S27 (S27E); eukaryotic ribos 95.87
4elj_A656 Retinoblastoma-associated protein; cyclin fold, tu 95.57
2qdj_A 304 Retinoblastoma-associated protein; cyclin fold, cy 95.39
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 95.3
1w98_B283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 95.16
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding 94.76
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 94.28
1jkw_A323 Cyclin H; cell cycle, cell division, nuclear prote 94.24
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 93.85
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI- 93.64
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 93.11
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 92.6
4elj_A 656 Retinoblastoma-associated protein; cyclin fold, tu 92.52
2k5r_A97 Uncharacterized protein XF2673; solution structure 92.01
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 91.51
2pmi_B293 PHO85 cyclin PHO80, aminoglycoside anti; cyclin-de 91.26
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 91.17
1k81_A36 EIF-2-beta, probable translation initiation factor 91.16
1nui_A255 DNA primase/helicase; zinc-biding domain, toprim f 91.09
2lnb_A80 Z-DNA-binding protein 1; structural genomics, nort 90.99
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 90.78
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 90.1
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 89.54
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 89.45
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 89.08
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 89.08
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 88.72
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 88.37
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 88.33
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 88.24
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 88.16
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 87.77
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 87.75
1dxg_A36 Desulforedoxin; non-heme iron protein, rubredoxin 86.76
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 86.56
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 85.7
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 85.64
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 85.47
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 84.38
1tfi_A50 Transcriptional elongation factor SII; transcripti 83.56
1f5q_B252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 83.5
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 80.7
3lwf_A159 LIN1550 protein, putative transcriptional regulato 80.2
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
Probab=100.00  E-value=8e-64  Score=458.71  Aligned_cols=261  Identities=31%  Similarity=0.535  Sum_probs=173.4

Q ss_pred             CCCCCCCCC-CCceeEeCCCCceEcCCCcccccccccccccchhhccCCC-CCCCCCcccCCCCCcccCCCcceEEecCC
Q 023713            3 DSYCADCKR-LTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANES-SDHDPVRVGGPLNPLLSGGGLSTVIAKPT   80 (278)
Q Consensus         3 ~~~Cp~Cg~-~~~vv~D~~~G~~vC~~CG~Vl~e~~id~~~ewr~f~~~~-~~~~~~r~G~~~~~~~~~~~~~t~i~~~~   80 (278)
                      ...||+||+ ++++++|+.+|++||.+||+|++|++||+|||||+|++++ ++.|++|+|+|.++++||.|++|.|++++
T Consensus        21 ~~~Cp~C~~~~~~lv~D~~~G~~vC~~CGlVl~e~~iD~g~EWR~f~~d~~~~~d~sRvG~~~~~~~~~~glsT~I~~~~  100 (345)
T 4bbr_M           21 VLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE  100 (345)
T ss_dssp             -CCCSSCCCSSCCEEEEGGGTEEEETTTCBEEESCCBCHHHHHTTTSCSCSSSCCSSCCEEEECHHHHCSCCCCEEECCS
T ss_pred             CCcCCCCCCCCCceeEECCCCcEEeCCCCCCccCcccccCccccCCCcccccCCCcCCCCCCCCccccCCCcceeecCCC
Confidence            468999996 4689999999999999999999999999999999999765 47889999999999999999999999764


Q ss_pred             CCCCccccccccccccccC--CCchhHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhCCCCCCCcHHHHHHHHHHH
Q 023713           81 AGGSTELLSGSLGKLQARS--SHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYI  158 (278)
Q Consensus        81 ~~~~~~~l~~~l~~~~~~~--~~~er~l~~~~~~I~~i~~~L~Lp~~v~e~A~~i~k~~~~~~~~~gr~~~~~aAAclY~  158 (278)
                       +.++ ...++|++||++.  +++||+|.+++..|.++|+.|+||+.++++|..||+++++.++++||+.+.++|||||+
T Consensus       101 -~~~~-~~~~~L~r~q~r~~~~~~er~L~~a~~~I~~~~~~L~Lp~~v~d~A~~lyk~a~~~~~~rGrs~e~vaAAclYi  178 (345)
T 4bbr_M          101 -TTDM-RFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILI  178 (345)
T ss_dssp             -SCCH-HHHHHHHHHHHHTCCCCSSSSTTHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHTTCTTTTTCCHHHHHHHHHHH
T ss_pred             -Ccch-hhHHHHHHHHHhhhcChHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCCccCCCHHHHHHHHHHH
Confidence             2321 1234588898875  68999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCCHHHHHHHHcCCCHHHHHHHHHHHHHHhhhhcccc------cccCCCCHHHHHHHHHhhcCCCHHHHHHHH
Q 023713          159 ACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQS------VEMGTIHASDYLRRFCSNLGMTNQAVKAAQ  232 (278)
Q Consensus       159 acR~~~~p~tl~eia~~~~~v~~~~i~~~~~~l~~~L~~~~~~~------~~~~~~~p~~~i~r~~~~L~l~~~v~~~A~  232 (278)
                      |||++++|+|++||+++ +++++++|+++|+.|.+.|+++..+.      .++++++|++||+|||++|+|++++.+.|+
T Consensus       179 ACR~~~~prtl~eI~~~-~~v~~keigr~~k~l~~~L~l~~~~~~~~~~~~~~~~~~p~~~i~Rf~s~L~l~~~v~~~A~  257 (345)
T 4bbr_M          179 GCRRAEVARTFKEIQSL-IHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAE  257 (345)
T ss_dssp             HHHHTCCBCCHHHHHHH-HTCCTTHHHHHHHHHHHCC-------------------------------------------
T ss_pred             HHHhcCCCccHHHHHHH-hCCCHHHHHHHHHHHHHHhCccccccccccccccCCCCCHHHHHHHHHHHcCCcHHHHHHHH
Confidence            99999999999999996 89999999999999999999752111      136788999999999999999999999999


Q ss_pred             HHHHHhhhcC--CCCChhHHHHHHHHHHHHHHHHHHHh
Q 023713          233 EAVQKSEDLD--IRLILVFFSLFLVETHIQLIVWAFMR  268 (278)
Q Consensus       233 ~i~~~~~~~~--~Gr~P~~iaaA~v~~~~~~~~~~~~~  268 (278)
                      +|++.+.+.|  .||+|.+||||+|  |+++.++.+-+
T Consensus       258 ~i~~~~~~~~i~~GR~P~~IAAAaI--ylAa~l~g~~~  293 (345)
T 4bbr_M          258 YTAKKCKEIKEIAGKSPITIAVVSI--YLNILLFQIPI  293 (345)
T ss_dssp             --------------------------------------
T ss_pred             HHHHHHHhcccccCCChHHHHHHHH--HHHHHHhCCCC
Confidence            9999999988  6999999999999  99999887644



>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Back     alignment and structure
>1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4c_A Transcription factor TFIIB-like; cyclin, transcription factor TFIIB repeat; 2.30A {Trypanosoma brucei brucei} Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Back     alignment and structure
>3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Back     alignment and structure
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Back     alignment and structure
>3m03_A ORC6, origin recognition complex subunit 6; helix turn helix, DNA binding protein, origin recognition CO DNA replication; HET: MES; 2.50A {Homo sapiens} Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>2r7g_A PP110, retinoblastoma-associated protein, P105-RB, RB; retinoblastoma protein, E2F displacement, transcription repressor; 1.67A {Homo sapiens} SCOP: a.74.1.3 a.74.1.3 PDB: 1n4m_A 3pom_A 1gh6_B 1gux_A 1o9k_A 1ad6_A 1gux_B 1o9k_B Back     alignment and structure
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b Back     alignment and structure
>4ell_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor, cell cycle; 1.98A {Homo sapiens} Back     alignment and structure
>3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4elj_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor protein, phosphorylation, cell; HET: TPO; 2.70A {Homo sapiens} Back     alignment and structure
>2qdj_A Retinoblastoma-associated protein; cyclin fold, cyclin wedge, antitumor protein; 2.00A {Homo sapiens} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>4elj_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor protein, phosphorylation, cell; HET: TPO; 2.70A {Homo sapiens} Back     alignment and structure
>2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2pmi_B PHO85 cyclin PHO80, aminoglycoside anti; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_B* Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Back     alignment and structure
>1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 278
d1aisb198 a.74.1.2 (B:1108-1205) Transcription factor IIB (T 6e-25
d1vola195 a.74.1.2 (A:113-207) Transcription factor IIB (TFI 7e-23
d1vola2109 a.74.1.2 (A:208-316) Transcription factor IIB (TFI 8e-21
d1vola2109 a.74.1.2 (A:208-316) Transcription factor IIB (TFI 1e-06
d1aisb295 a.74.1.2 (B:1206-1300) Transcription factor IIB (T 3e-19
d1aisb295 a.74.1.2 (B:1206-1300) Transcription factor IIB (T 3e-04
d1dl6a_58 g.41.3.1 (A:) Transcription initiation factor TFII 1e-12
d1pfta_50 g.41.3.1 (A:) Transcription initiation factor TFII 4e-11
d1jkwa1151 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo s 0.001
d2ivxa1143 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) 0.002
d2cchb1128 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [T 0.002
d1g3nc1132 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma 0.003
d2i53a1144 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) 0.003
d1w98b2140 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human 0.003
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Cyclin-like
superfamily: Cyclin-like
family: Transcription factor IIB (TFIIB), core domain
domain: Transcription factor IIB (TFIIB), core domain
species: Archaeon Pyrococcus woesei [TaxId: 2262]
 Score = 93.4 bits (232), Expect = 6e-25
 Identities = 32/92 (34%), Positives = 54/92 (58%), Gaps = 1/92 (1%)

Query: 105 NLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQEN 164
           NL  A   +  ++ +L L   +++ A  +Y++   +  +RGR+ E+++AAC+Y ACR   
Sbjct: 1   NLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLK 60

Query: 165 KPRTVKEFCSVANGTTKKEIGRAKEFIVKHLE 196
            PRT+ E   +A    KKEIGR+  FI ++L 
Sbjct: 61  VPRTLDEIADIAR-VDKKEIGRSYRFIARNLN 91


>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 95 Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 95 Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 50 Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Length = 128 Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Length = 132 Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
d1aisb198 Transcription factor IIB (TFIIB), core domain {Arc 99.89
d1vola195 Transcription factor IIB (TFIIB), core domain {Hum 99.89
d1aisb295 Transcription factor IIB (TFIIB), core domain {Arc 99.84
d1vola2109 Transcription factor IIB (TFIIB), core domain {Hum 99.82
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 99.78
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 99.77
d1aisb295 Transcription factor IIB (TFIIB), core domain {Arc 99.12
d1vola2109 Transcription factor IIB (TFIIB), core domain {Hum 99.07
d2i53a1144 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 98.7
d2ivxa1143 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 98.62
d1vola195 Transcription factor IIB (TFIIB), core domain {Hum 98.53
d1jkwa1151 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 98.49
d1aisb198 Transcription factor IIB (TFIIB), core domain {Arc 98.41
d2cchb1128 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 97.83
d1bu2a1127 Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} 97.78
d1g3nc1132 Viral cyclin {Kaposi's sarcoma-associated herpesvi 97.78
d1f5qb1141 Viral cyclin {Murine herpesvirus 68 [TaxId: 33708] 97.68
d1w98b2140 G1/S-specific cyclin-E1 {Human (Homo sapiens) [Tax 97.63
d2ivxa2113 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 97.38
d2i53a2110 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 96.96
d2ivxa2113 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 96.78
d2r7ga2142 Retinoblastoma tumor suppressor domains {Human (Ho 96.75
d1qxfa_58 Ribosomal protein S27e {Archaeon Archaeoglobus ful 96.67
d2jnya159 Uncharacterized protein Cgl1405/cg1592 {Corynebact 96.01
d2pk7a159 Uncharacterized protein PFL1779 {Pseudomonas fluor 95.66
d2hf1a159 Hypothetical protein CV3345 {Chromobacterium viola 95.65
d2i53a2110 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 95.57
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 95.53
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 95.42
d2cchb2124 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 94.25
d1nuia254 Zinc-binding domain of primase-helicase {Bacteriop 93.09
d1neea237 Zinc-binding domain of translation initiation fact 92.72
d1k81a_36 Zinc-binding domain of translation initiation fact 92.2
d1jkwa2126 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 90.81
d2i53a1144 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 90.57
d2ivxa1143 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 90.45
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 90.39
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 89.87
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 89.62
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 89.41
d1u5ka2157 Recombinational repair protein RecO, C-terminal do 89.35
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 88.75
d2cchb2124 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 88.36
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 88.14
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 87.57
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 87.14
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 87.06
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 86.41
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 86.02
d1twfi272 RBP9 subunit of RNA polymerase II {Baker's yeast ( 85.65
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 85.49
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 85.44
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 84.44
d1jkwa1151 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 84.32
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 84.24
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 83.71
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 83.5
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 81.48
d2j015159 Ribosomal protein L32p {Thermus thermophilus [TaxI 81.07
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 80.96
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
class: All alpha proteins
fold: Cyclin-like
superfamily: Cyclin-like
family: Transcription factor IIB (TFIIB), core domain
domain: Transcription factor IIB (TFIIB), core domain
species: Archaeon Pyrococcus woesei [TaxId: 2262]
Probab=99.89  E-value=3.8e-23  Score=154.27  Aligned_cols=93  Identities=33%  Similarity=0.629  Sum_probs=90.1

Q ss_pred             HHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhCCCCCCCcHHHHHHHHHHHHHHhcCCCCCHHHHHHHHcCCCHHHH
Q 023713          105 NLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEI  184 (278)
Q Consensus       105 ~l~~~~~~I~~i~~~L~Lp~~v~e~A~~i~k~~~~~~~~~gr~~~~~aAAclY~acR~~~~p~tl~eia~~~~~v~~~~i  184 (278)
                      +|..+++.|+++|+.|+||+.+.++|..||+++.+.+.++|+++.+++|||||+|||+++.|+|++||+++ +++++++|
T Consensus         1 nL~~a~~~I~~~~~~L~L~~~i~~~A~~i~k~~~~~~~~~g~~~~~iaaA~iY~Acr~~~~~~t~~eIa~~-~~is~~ti   79 (98)
T d1aisb1           1 NLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADI-ARVDKKEI   79 (98)
T ss_dssp             CHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHTTTTTTTCCHHHHHHHHHHHHHHHHTCCCCHHHHHHH-TTSCHHHH
T ss_pred             CHHHHHHHHHHHHHHcCcCHHHHHHHHHHHHHHHHhhhhcCCCHHHHHHHHHHHHHHHcCCCCCHHHHHHH-HCCCHHHH
Confidence            47889999999999999999999999999999999999999999999999999999999999999999995 99999999


Q ss_pred             HHHHHHHHHHhhhh
Q 023713          185 GRAKEFIVKHLEAE  198 (278)
Q Consensus       185 ~~~~~~l~~~L~~~  198 (278)
                      +++|+.|.+.|+++
T Consensus        80 ~k~yk~i~~~L~l~   93 (98)
T d1aisb1          80 GRSYRFIARNLNLT   93 (98)
T ss_dssp             HHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHcCCC
Confidence            99999999999986



>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Back     information, alignment and structure
>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r7ga2 a.74.1.3 (A:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cchb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nuia2 g.41.3.2 (A:10-63) Zinc-binding domain of primase-helicase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jkwa2 a.74.1.1 (A:162-287) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2cchb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure