Citrus Sinensis ID: 023723

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

MEKDMCKNDGEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG

cccccccccccccEEEEEEccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHccccHHHHHcccccccccccccEEEccccccccccccccccccccccccccccccHHHHHHHccccccccccccccEEEEEEEEEEEEcccccEEEEcccccccccHHHccccccccHHHHHHHccccccccccccccHHHHHHHHcccEEHHHHHHHHHHHHHHcc

cccccccccccccEEEEEEcccHHHHHHHHHcccccEEEEEEcccccEEEcccccccccccHccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccHcccccccHHccccccccccccccccccccccccHHHccccHHHHHHHHHHHcEEccccccEEEEEccccEEEcccccEEEcccccHHHHHHHHHHcccccccHHHHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHcc

mekdmckndgEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFdindkandvyelnfghrpyqakrkplSFRCQLLNnqllrspspllgnddmtvitkhdqpddswdkllescdpverflefsnsgdqvntetgflstgtaavddfgaaeetvevdrcvsidhflvPLSLIERWGsamdivypdskrcccftksyYRYVKGTGsllatvqpknkgkasslkeqhlryftprevanlhsfpgdfqfphhlSLRQRYALLGNSLSIAVVAPLLQYLFAQAG

mekdmckndgeaWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLatvqpknkgkasslkEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG

*********GEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQAKRKPLSFRCQLLNNQLLR************VI*********WDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATV**************HLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFA***

***************LEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTV****DQ*DDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPK*KG***SLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQA*

MEKDMCKNDGEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQ**********KEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQAG

*********GEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQAKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFSNSGDQVNTETGFLSTG****DDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQA*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		278	2.2.26 [Sep-21-2011]
P40999		330	tRNA (cytosine(38)-C(5))-	yes	no	0.935	0.787	0.300	2e-24
Q7YS61		391	tRNA (cytosine-5-)-methyl	yes	no	0.395	0.281	0.475	4e-22
O14717		391	tRNA (cytosine(38)-C(5))-	yes	no	0.413	0.294	0.437	4e-22
Q4G073		391	tRNA (cytosine(38)-C(5))-	yes	no	0.402	0.286	0.44	3e-21
O55055		415	tRNA (cytosine(38)-C(5))-	yes	no	0.395	0.265	0.449	4e-20
Q54JH6		379	DNA (cytosine-5)-methyltr	yes	no	0.402	0.295	0.4	2e-16

>sp\|P40999\|PMT1M_SCHPO tRNA (cytosine(38)-C(5))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt1 PE=1 SV=1	Back alignment and function desciption

 Score =  113 bits (282), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 96/319 (30%), Positives = 142/319 (44%), Gaps = 59/319 (18%)

Query: 14  RVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQAKRKPLS---- 69
           RVLE YSGIGGM Y+L  A++ A +V A DIN +AN++Y LN G          L+    
Sbjct: 8   RVLELYSGIGGMHYALNLANIPADIVCAIDINPQANEIYNLNHGKLAKHMDISTLTAKDF 67

Query: 70  --FRCQLL-------------NNQLLRSPS-----------PLLGNDDMTVITKHDQPDD 103
             F C+L              N + +  P            P + N    ++ ++ Q  +
Sbjct: 68  DAFDCKLWTMSPSCQPFTRIGNRKDILDPRSQAFLNILNVLPHVNNLPEYILIENVQGFE 127

Query: 104 SWDKLLESCDPVER-----FLEFSNSGDQVNTETG---------FLSTGTAAVDDF---- 145
              K  E C  V R      +E   S +Q N                 G  ++DD     
Sbjct: 128 E-SKAAEECRKVLRNCGYNLIEGILSPNQFNIPNSRSRWYGLARLNFKGEWSIDDVFQFS 186

Query: 146 GAAEETVEVDRC---VSIDH----FLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYV 198
             A++  EV R    + I+     ++V  S++ +WG   DIV PDS  CCCFT+ Y   V
Sbjct: 187 EVAQKEGEVKRIRDYLEIERDWSSYMVLESVLNKWGHQFDIVKPDSSSCCCFTRGYTHLV 246

Query: 199 KGTGSLLATVQPKNKGKASSLKEQ--HLRYFTPREVANLHSFPGDFQFPH-HLSLRQRYA 255
           +G GS+L     +N  +          LRYFT REVA L  FP   ++   +++ +  Y 
Sbjct: 247 QGAGSILQMSDHENTHEQFERNRMALQLRYFTAREVARLMGFPESLEWSKSNVTEKCMYR 306

Query: 256 LLGNSLSIAVVAPLLQYLF 274
           LLGNS+++ VV+ L+  L 
Sbjct: 307 LLGNSINVKVVSYLISLLL 325

Does not have a cytosine-5 methyltransferase activity due to the insertion of a Ser residue between the Pro-Cys motif found at the active site of C5 MTases. When this serine is deleted it becomes catalytically active and recognizes and methylates the sequence CC[AT]GG.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)

>sp\|Q7YS61\|TRDMT_BOVIN tRNA (cytosine-5-)-methyltransferase OS=Bos taurus GN=TRDMT1 PE=2 SV=1	Back alignment and function description

>sp\|O14717\|TRDMT_HUMAN tRNA (cytosine(38)-C(5))-methyltransferase OS=Homo sapiens GN=TRDMT1 PE=1 SV=1	Back alignment and function description

>sp\|Q4G073\|TRDMT_RAT tRNA (cytosine(38)-C(5))-methyltransferase OS=Rattus norvegicus GN=Trdmt1 PE=2 SV=1	Back alignment and function description

>sp\|O55055\|TRDMT_MOUSE tRNA (cytosine(38)-C(5))-methyltransferase OS=Mus musculus GN=Trdmt1 PE=2 SV=2	Back alignment and function description

>sp\|Q54JH6\|CMT1_DICDI DNA (cytosine-5)-methyltransferase OS=Dictyostelium discoideum GN=dnmA PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		278
359476106		393	PREDICTED: tRNA (cytosine-5-)-methyltran	0.762	0.539	0.699	1e-77
296081999		366	unnamed protein product [Vitis vinifera]	0.672	0.510	0.663	9e-72
224092438		350	DNA methyltransferase [Populus trichocar	0.672	0.534	0.630	2e-68
297812763		383	DNA methyltransferase-2 [Arabidopsis lyr	0.733	0.532	0.643	9e-68
21553420		383	DNA methyltransferase PMT1-like protein	0.737	0.535	0.641	2e-67
18420929		383	DNA methyltransferase-2 [Arabidopsis tha	0.737	0.535	0.641	5e-67
449441930		385	PREDICTED: tRNA (cytosine(38)-C(5))-meth	0.748	0.540	0.613	2e-64
255548992		404	DNA (cytosine-5)-methyltransferase, puta	0.712	0.490	0.604	3e-64
363814463		385	uncharacterized protein LOC100792567 [Gl	0.751	0.542	0.611	6e-62
357445897		378	tRNA (cytosine-5-)-methyltransferase [Me	0.856	0.629	0.528	2e-60

>gi\|359476106\|ref\|XP_002282454.2\| PREDICTED: tRNA (cytosine-5-)-methyltransferase-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 151/216 (69%), Positives = 171/216 (79%), Gaps = 4/216 (1%)

Query: 63  AKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFS 122
           AKRKPLSF  QL NNQLL +PSPL G++D ++I +HDQ +  WDKLL+SC+PVERFLEF 
Sbjct: 176 AKRKPLSFENQLFNNQLLSTPSPLFGHEDDSLIDEHDQSEKIWDKLLQSCEPVERFLEFK 235

Query: 123 NSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRC--VSIDHFLVPLSLIERWGSAMDIV 180
           N+ + + TE+ +L T + + D  G  E   E DR    S D F VPLSLIERWGSAMDIV
Sbjct: 236 NTINPLETESSYLDTLSVSTDASGELENN-ERDRSDSNSWDQFSVPLSLIERWGSAMDIV 294

Query: 181 YPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPG 240
           YPDSKRCCCFTKSYYRYVKGTGSLLAT Q K K KAS L+EQ LRYFTPREVANLHSFP 
Sbjct: 295 YPDSKRCCCFTKSYYRYVKGTGSLLATGQSK-KDKASLLEEQCLRYFTPREVANLHSFPE 353

Query: 241 DFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLFAQ 276
           DF FP H++LRQRYALLGNSLS+AVVAPLL YLF Q
Sbjct: 354 DFHFPQHVNLRQRYALLGNSLSVAVVAPLLTYLFTQ 389

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296081999\|emb\|CBI21004.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224092438\|ref\|XP_002309610.1\| DNA methyltransferase [Populus trichocarpa] gi\|222855586\|gb\|EEE93133.1\| DNA methyltransferase [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297812763\|ref\|XP_002874265.1\| DNA methyltransferase-2 [Arabidopsis lyrata subsp. lyrata] gi\|297320102\|gb\|EFH50524.1\| DNA methyltransferase-2 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|21553420\|gb\|AAM62513.1\| DNA methyltransferase PMT1-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|18420929\|ref\|NP_568474.1\| DNA methyltransferase-2 [Arabidopsis thaliana] gi\|332006070\|gb\|AED93453.1\| DNA methyltransferase-2 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449441930\|ref\|XP_004138735.1\| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase-like [Cucumis sativus] gi\|449514978\|ref\|XP_004164528.1\| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255548992\|ref\|XP_002515552.1\| DNA (cytosine-5)-methyltransferase, putative [Ricinus communis] gi\|223545496\|gb\|EEF47001.1\| DNA (cytosine-5)-methyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|363814463\|ref\|NP_001242866.1\| uncharacterized protein LOC100792567 [Glycine max] gi\|255640237\|gb\|ACU20409.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|357445897\|ref\|XP_003593226.1\| tRNA (cytosine-5-)-methyltransferase [Medicago truncatula] gi\|355482274\|gb\|AES63477.1\| tRNA (cytosine-5-)-methyltransferase [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		278
TAIR\|locus:2179469		383	DNMT2 "DNA methyltransferase-2	0.737	0.535	0.646	2.4e-85
UNIPROTKB\|O14717		391	TRDMT1 "tRNA (cytosine(38)-C(5	0.604	0.429	0.373	4.2e-34
UNIPROTKB\|E2RM86		391	TRDMT1 "Uncharacterized protei	0.402	0.286	0.452	1.2e-33
UNIPROTKB\|F1NJ02		398	TRDMT1 "Uncharacterized protei	0.446	0.311	0.442	1.5e-33
UNIPROTKB\|Q7YS61		391	TRDMT1 "tRNA (cytosine-5-)-met	0.395	0.281	0.475	1.7e-33
MGI\|MGI:1274787		415	Trdmt1 "tRNA aspartic acid met	0.395	0.265	0.449	5.1e-33
RGD\|1306292		391	Trdmt1 "tRNA aspartic acid met	0.399	0.283	0.443	3e-32
ZFIN\|ZDB-GENE-041008-138		381	trdmt1 "tRNA aspartic acid met	0.420	0.307	0.407	4.9e-31
POMBASE\|SPBC19C2.02		330	pmt1 "tRNA methyltransferase"	0.431	0.363	0.376	2.9e-29
DICTYBASE\|DDB_G0288047		379	dnmA "DNA (cytosine-5-)-methyl	0.395	0.290	0.406	5e-28

TAIR\|locus:2179469 DNMT2 "DNA methyltransferase-2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 659 (237.0 bits), Expect = 2.4e-85, Sum P(2) = 2.4e-85
 Identities = 137/212 (64%), Positives = 156/212 (73%)

Query:    63 AKRKPLSFRCQLLNNQLLRSPSPLLGNDDMTVITKHDQPDDSWDKLLESCDPVERFLEFS 122
             AKRKPL F+ Q  NN+LL SP PL G DD     K  Q ++  DKLLE C PVE+FLE +
Sbjct:   177 AKRKPLPFKSQHSNNKLLWSPDPLYGRDDQVEFGKC-QAEEGLDKLLEFCKPVEKFLELA 235

Query:   123 NSGDQVNTETGFLSTGTAAVDDFGAAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYP 182
                D   +       G+   D  G   ++V  D   S+  +LVP+SLIERWG+AMDIVYP
Sbjct:   236 AHVDGEPSSVDDSENGSK--DCCGQEGDSVP-D---SVHQYLVPVSLIERWGNAMDIVYP 289

Query:   183 DSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASSLKEQHLRYFTPREVANLHSFPGDF 242
             DSKRCCCFTKSYYRYVKGTGSLLATVQPK KGK S LKEQ LRYFTPREVAN HSFP DF
Sbjct:   290 DSKRCCCFTKSYYRYVKGTGSLLATVQPKIKGKESCLKEQRLRYFTPREVANFHSFPEDF 349

Query:   243 QFPHHLSLRQRYALLGNSLSIAVVAPLLQYLF 274
             +FP H+SLRQRYA+LGNSLS+AVVAPLL+YLF
Sbjct:   350 EFPKHISLRQRYAMLGNSLSVAVVAPLLRYLF 381

GO:0003677 "DNA binding" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0006306 "DNA methylation" evidence=IEA;ISS

UNIPROTKB\|O14717 TRDMT1 "tRNA (cytosine(38)-C(5))-methyltransferase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RM86 TRDMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NJ02 TRDMT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7YS61 TRDMT1 "tRNA (cytosine-5-)-methyltransferase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:1274787 Trdmt1 "tRNA aspartic acid methyltransferase 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1306292 Trdmt1 "tRNA aspartic acid methyltransferase 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-041008-138 trdmt1 "tRNA aspartic acid methyltransferase 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

POMBASE\|SPBC19C2.02 pmt1 "tRNA methyltransferase" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0288047 dnmA "DNA (cytosine-5-)-methyltransferase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1.37	LOW CONFIDENCE prediction!
3rd Layer	2.1.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00032604001	SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (377 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00035341001	RecName- Full=Cytosine-specific methyltransferase; EC=2.1.1.37; (444 aa)	•	•	0.483

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		278
cd00315		275	cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi	2e-18
cd00315		275	cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi	9e-12
COG0270		328	COG0270, Dcm, Site-specific DNA methylase [DNA rep	2e-05
TIGR00675		315	TIGR00675, dcm, DNA-methyltransferase (dcm)	5e-05
pfam00145		320	pfam00145, DNA_methylase, C-5 cytosine-specific DN	1e-04
COG0270		328	COG0270, Dcm, Site-specific DNA methylase [DNA rep	2e-04
pfam00145		320	pfam00145, DNA_methylase, C-5 cytosine-specific DN	3e-04

>gnl\|CDD\|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology	Back alignment and domain information

 Score = 82.3 bits (204), Expect = 2e-18
 Identities = 36/116 (31%), Positives = 49/116 (42%), Gaps = 11/116 (9%)

Query: 159 SIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKNKGKASS 218
               F  P    +     + I  PD       T SY    KGTGS+  T           
Sbjct: 170 FFSPFPKPSEKKKTLKDILRIRDPDE-PSPTLTASYG---KGTGSVHPTAPDMI------ 219

Query: 219 LKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLF 274
            KE ++R  TPRE A L  FP DF+FP   S+ Q Y  +GNS+ + V   + + + 
Sbjct: 220 GKESNIRRLTPRECARLQGFPDDFEFPGK-SVTQAYRQIGNSVPVPVAEAIAKAIK 274

Cytosine-specific DNA methylases are found both in prokaryotes and eukaryotes. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the mammalian genome. These effects include transcriptional repression via inhibition of transcription factor binding or the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. Length = 275

>gnl\|CDD\|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology	Back alignment and domain information

>gnl\|CDD\|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233085 TIGR00675, dcm, DNA-methyltransferase (dcm)	Back alignment and domain information

>gnl\|CDD\|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase	Back alignment and domain information

>gnl\|CDD\|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		278
PF00145		335	DNA_methylase: C-5 cytosine-specific DNA methylase	100.0
cd00315		275	Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth	100.0
TIGR00675		315	dcm DNA-methyltransferase (dcm). All proteins in t	100.0
COG0270		328	Dcm Site-specific DNA methylase [DNA replication,	100.0
PRK10458		467	DNA cytosine methylase; Provisional	100.0
KOG0919		338	consensus C-5 cytosine-specific DNA methylase [Tra	100.0
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	97.81
PF03602		183	Cons_hypoth95: Conserved hypothetical protein 95;	97.74
PF09445		163	Methyltransf_15: RNA cap guanine-N2 methyltransfer	97.73
COG2263		198	Predicted RNA methylase [Translation, ribosomal st	97.67
TIGR03704		251	PrmC_rel_meth putative protein-(glutamine-N5) meth	97.66
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	97.57
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	97.49
TIGR00095		189	RNA methyltransferase, RsmD family. This model rep	97.49
PRK10909		199	rsmD 16S rRNA m(2)G966-methyltransferase; Provisio	97.47
TIGR02085		374	meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer	97.43
PHA03412		241	putative methyltransferase; Provisional	97.35
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	97.25
COG2520		341	Predicted methyltransferase [General function pred	97.23
KOG3420		185	consensus Predicted RNA methylase [Translation, ri	97.18
COG0742		187	N6-adenine-specific methylase [DNA replication, re	97.16
PF02475		200	Met_10: Met-10+ like-protein; InterPro: IPR003402	97.16
PRK10901		427	16S rRNA methyltransferase B; Provisional	97.15
COG2890		280	HemK Methylase of polypeptide chain release factor	97.14
PRK15128		396	23S rRNA m(5)C1962 methyltransferase; Provisional	97.13
PRK03522		315	rumB 23S rRNA methyluridine methyltransferase; Rev	97.13
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	97.11
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	97.1
COG2265		432	TrmA SAM-dependent methyltransferases related to t	97.07
PHA03411		279	putative methyltransferase; Provisional	96.98
PRK14904		445	16S rRNA methyltransferase B; Provisional	96.96
PRK14902		444	16S rRNA methyltransferase B; Provisional	96.91
PRK05031		362	tRNA (uracil-5-)-methyltransferase; Validated	96.89
PRK14901		434	16S rRNA methyltransferase B; Provisional	96.87
smart00650		169	rADc Ribosomal RNA adenine dimethylases.	96.84
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	96.78
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	96.76
TIGR02143		353	trmA_only tRNA (uracil-5-)-methyltransferase. This	96.75
COG2264		300	PrmA Ribosomal protein L11 methylase [Translation,	96.67
PRK13168		443	rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe	96.64
PRK14967		223	putative methyltransferase; Provisional	96.59
PRK04338		382	N(2),N(2)-dimethylguanosine tRNA methyltransferase	96.55
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	96.53
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	96.52
TIGR00479		431	rumA 23S rRNA (uracil-5-)-methyltransferase RumA.	96.5
PF06325		295	PrmA: Ribosomal protein L11 methyltransferase (Prm	96.49
PRK14903		431	16S rRNA methyltransferase B; Provisional	96.46
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	96.44
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	96.32
PF05958		352	tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas	96.29
TIGR00308		374	TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi	96.29
COG4123		248	Predicted O-methyltransferase [General function pr	96.27
KOG1227		351	consensus Putative methyltransferase [General func	96.27
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	96.13
PF01170		179	UPF0020: Putative RNA methylase family UPF0020; In	96.11
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	96.06
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	96.01
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	95.98
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	95.91
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	95.88
PRK14896		258	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	95.84
PRK14968		188	putative methyltransferase; Provisional	95.59
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	95.54
PF10672		286	Methyltrans_SAM: S-adenosylmethionine-dependent me	95.51
PRK00274		272	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	95.51
TIGR00755		253	ksgA dimethyladenosine transferase. Alternate name	95.17
PTZ00338		294	dimethyladenosine transferase-like protein; Provis	95.13
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	95.0
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	94.98
TIGR02987		524	met_A_Alw26 type II restriction m6 adenine DNA met	94.9
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	94.87
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	94.79
KOG2904		328	consensus Predicted methyltransferase [General fun	94.74
TIGR02021		219	BchM-ChlM magnesium protoporphyrin O-methyltransfe	94.72
PRK11933		470	yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF;	94.65
COG3897		218	Predicted methyltransferase [General function pred	94.65
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	94.65
PRK05785		226	hypothetical protein; Provisional	94.61
TIGR03587		204	Pse_Me-ase pseudaminic acid biosynthesis-associate	94.58
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	94.54
COG1092		393	Predicted SAM-dependent methyltransferases [Genera	94.25
PF02005		377	TRM: N2,N2-dimethylguanosine tRNA methyltransferas	93.98
PF02384		311	N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T	93.98
COG0144		355	Sun tRNA and rRNA cytosine-C5-methylases [Translat	93.98
PLN02672		1082	methionine S-methyltransferase	93.94
PRK11727		321	23S rRNA mA1618 methyltransferase; Provisional	93.94
PRK07402		196	precorrin-6B methylase; Provisional	93.94
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	93.77
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	93.65
PRK07580		230	Mg-protoporphyrin IX methyl transferase; Validated	93.57
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	93.56
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	93.33
COG1041		347	Predicted DNA modification methylase [DNA replicat	93.18
PLN02233		261	ubiquinone biosynthesis methyltransferase	93.13
PRK10258		251	biotin biosynthesis protein BioC; Provisional	93.1
PRK04148		134	hypothetical protein; Provisional	93.05
PRK10742		250	putative methyltransferase; Provisional	92.98
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	92.94
COG3963		194	Phospholipid N-methyltransferase [Lipid metabolism	92.86
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	92.46
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	92.2
COG2521		287	Predicted archaeal methyltransferase [General func	92.19
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	92.16
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	92.07
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	92.07
PF00398		262	RrnaAD: Ribosomal RNA adenine dimethylase; InterPr	92.05
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	92.01
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	92.0
PF01189		283	Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR	91.6
KOG2730		263	consensus Methylase [General function prediction o	91.57
PF13649		101	Methyltransf_25: Methyltransferase domain; PDB: 3B	91.47
PRK06202		232	hypothetical protein; Provisional	91.46
PF02086		260	MethyltransfD12: D12 class N6 adenine-specific DNA	91.41
COG0030		259	KsgA Dimethyladenosine transferase (rRNA methylati	91.25
PLN02585		315	magnesium protoporphyrin IX methyltransferase	91.16
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	91.15
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	91.13
PRK00811		283	spermidine synthase; Provisional	91.07
TIGR00478		228	tly hemolysin TlyA family protein. Hemolysins are	90.99
PRK05134		233	bifunctional 3-demethylubiquinone-9 3-methyltransf	90.68
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	90.45
PLN02336		475	phosphoethanolamine N-methyltransferase	90.31
COG2813		300	RsmC 16S RNA G1207 methylase RsmC [Translation, ri	90.21
PLN02244		340	tocopherol O-methyltransferase	90.16
TIGR02081		194	metW methionine biosynthesis protein MetW. This pr	90.14
KOG3191		209	consensus Predicted N6-DNA-methyltransferase [Tran	89.98
TIGR01983		224	UbiG ubiquinone biosynthesis O-methyltransferase.	89.77
PRK12335		287	tellurite resistance protein TehB; Provisional	89.72
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	89.5
PRK11207		197	tellurite resistance protein TehB; Provisional	89.49
PHA01634		156	hypothetical protein	89.27
PRK03612		521	spermidine synthase; Provisional	89.04
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	88.92
KOG2187		534	consensus tRNA uracil-5-methyltransferase and rela	88.91
PRK13255		218	thiopurine S-methyltransferase; Reviewed	88.72
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	88.71
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	88.41
TIGR00091		194	tRNA (guanine-N(7)-)-methyltransferase. In E. coli	87.87
PRK00050		296	16S rRNA m(4)C1402 methyltranserfase; Provisional	87.75
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	87.52
PRK11524		284	putative methyltransferase; Provisional	87.29
PRK04266		226	fibrillarin; Provisional	87.07
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	86.98
PRK13699		227	putative methylase; Provisional	86.85
PRK08317		241	hypothetical protein; Provisional	86.54
TIGR00740		239	methyltransferase, putative. A simple BLAST search	86.43
PRK06922		677	hypothetical protein; Provisional	86.19
PTZ00146		293	fibrillarin; Provisional	86.08
KOG0820		315	consensus Ribosomal RNA adenine dimethylase [RNA p	85.9
TIGR01444		143	fkbM_fam methyltransferase, FkbM family. Members o	85.5
COG1867		380	TRM1 N2,N2-dimethylguanosine tRNA methyltransferas	85.21
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	85.0
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	84.74
PLN02490		340	MPBQ/MSBQ methyltransferase	84.49
PLN02781		234	Probable caffeoyl-CoA O-methyltransferase	84.1
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	84.04
KOG2078		495	consensus tRNA modification enzyme [RNA processing	83.72
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	83.59
PF05185		448	PRMT5: PRMT5 arginine-N-methyltransferase; InterPr	83.54
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	83.02
COG4076		252	Predicted RNA methylase [General function predicti	81.93
KOG1122		460	consensus tRNA and rRNA cytosine-C5-methylase (nuc	81.84
PF03291		331	Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971	81.76
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	81.73
PF01728		181	FtsJ: FtsJ-like methyltransferase; InterPro: IPR00	81.48
PF10294		173	Methyltransf_16: Putative methyltransferase; Inter	80.45
PF07021		193	MetW: Methionine biosynthesis protein MetW; InterP	80.3

>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2	Back alignment and domain information

Probab=100.00  E-value=2.8e-55  Score=400.69  Aligned_cols=253  Identities=22%  Similarity=0.256  Sum_probs=164.0

Q ss_pred             CeEEeeecchhhHHHHHHhcCCCceEEEEEcCCHHHHHHHHHHcCCCCcccccccccccccc-CCCEEEeCCCCCCCCcc
Q 023723           13 WRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRPYQAKRKPLSFRCQL-LNNQLLRSPSPLLGNDD   91 (278)
Q Consensus        13 ~~v~dLFsG~Gg~~~gl~~aG~~~~~v~a~e~~~~a~~~y~~N~~~~~~~~~~~~~~~~~~~-~~Dll~~g~PCq~fS~a   91 (278)
                      ||++|||||+||+++||++||  |++++|+|+|+.|++||++||| .....|+..++....+ ++|||+||||||+||.+
T Consensus         1 ~~~~dlFsG~Gg~~~g~~~ag--~~~~~a~e~~~~a~~~y~~N~~-~~~~~Di~~~~~~~l~~~~D~l~ggpPCQ~fS~a   77 (335)
T PF00145_consen    1 MKVIDLFSGIGGFSLGLEQAG--FEVVWAVEIDPDACETYKANFP-EVICGDITEIDPSDLPKDVDLLIGGPPCQGFSIA   77 (335)
T ss_dssp             EEEEEET-TTTHHHHHHHHTT--EEEEEEEESSHHHHHHHHHHHT-EEEESHGGGCHHHHHHHT-SEEEEE---TTTSTT
T ss_pred             CcEEEEccCccHHHHHHHhcC--cEEEEEeecCHHHHHhhhhccc-ccccccccccccccccccceEEEeccCCceEecc
Confidence            689999999999999999999  8999999999999999999999 3333333334444555 79999999999999999


Q ss_pred             cccCCCCCCCCchHHHHhhh---cCCcEEEEE-eCC---Cc--------cchhhccCc------eeccCcccCcccc-cc
Q 023723           92 MTVITKHDQPDDSWDKLLES---CDPVERFLE-FSN---SG--------DQVNTETGF------LSTGTAAVDDFGA-AE  149 (278)
Q Consensus        92 g~~~g~~d~r~~l~~~~i~~---~~P~~~i~E-v~~---~~--------~~~l~~~GY------l~A~~~~~~dfGv-Q~  149 (278)
                      |++++.+|+|+.||++++++   .+|++|||| |++   +.        ++.|+++||      |||+     +||+ |+
T Consensus        78 g~~~~~~d~r~~L~~~~~~~v~~~~Pk~~~~ENV~~l~~~~~~~~~~~i~~~l~~lGY~v~~~vlna~-----~yGvPQ~  152 (335)
T PF00145_consen   78 GKRKGFDDPRNSLFFEFLRIVKELKPKYFLLENVPGLLSSKNGEVFKEILEELEELGYNVQWRVLNAA-----DYGVPQN  152 (335)
T ss_dssp             STHHCCCCHTTSHHHHHHHHHHHHS-SEEEEEEEGGGGTGGGHHHHHHHHHHHHHTTEEEEEEEEEGG-----GGTSSBE
T ss_pred             ccccccccccchhhHHHHHHHhhccceEEEecccceeeccccccccccccccccccceeehhccccHh-----hCCCCCc
Confidence            99999999999999998775   899999999 653   21        788999999      8999     9999 99


Q ss_pred             cccc--ccccccc--------ccCCCChhh-hhcCCccccccCCC-----------------------------CCCc--
Q 023723          150 ETVE--VDRCVSI--------DHFLVPLSL-IERWGSAMDIVYPD-----------------------------SKRC--  187 (278)
Q Consensus       150 r~~f--l~~~~~~--------~~~~~p~~~-~~~~~~~~d~~~~~-----------------------------~~~~--  187 (278)
                      |+|+  ++.+.+.        ....+|... ........|+....                             ....  
T Consensus       153 R~R~fivg~r~~~~~~~~~~~~~~~~~~~~~~~~~~~i~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  232 (335)
T PF00145_consen  153 RERVFIVGIRKDLPLPPPFPIPKFDFPEPKDPTVSDAIRDLPDEPSPKDEDKYNFSDRVIEDLNRIRNNTIKPGKGIPNK  232 (335)
T ss_dssp             -EEEEEEEEEGGG--TSSCCGTTEEC-SSCG-SHHHHHGGGSTSCCECCCCCGBHSHCHHCSHCCSHHHHHHHCCCCSTH
T ss_pred             eeeEEEEEECCCCCcccccccccccccccccccceeeEeecccccccccccccccchhhhhhhccccccccccccchhhh
Confidence            9984  3333221        011111100 00000011111000                             0000  


Q ss_pred             ------------ccccccceecccCCCceeeecCCC--CCCC---CccccCCcccccCHHHHHHhCCCCCCcccCCCCCH
Q 023723          188 ------------CCFTKSYYRYVKGTGSLLATVQPK--NKGK---ASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSL  250 (278)
Q Consensus       188 ------------~~~~~~y~r~~~~~~s~~~~~~~~--~~~~---~~~~~~~~~R~lT~rE~~rLqgFPd~~~~~~~~s~  250 (278)
                                  ......|++..+.......+....  ....   ...+||.+.|.|||||+||||||||+|.|.+  +.
T Consensus       233 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hp~~~R~LT~rE~aRLqgFPd~~~f~g--~~  310 (335)
T PF00145_consen  233 ISRNRIDKIEDLKGPSRTYRRSGRGEKMPPQIPTTGSTGKNGHRFRPFIHPEQNRRLTPREAARLQGFPDDFKFPG--SK  310 (335)
T ss_dssp             EECTSTTTTCECTTTCTCCTTSCTCC-BCCCCCSTSTTTTTHEHCCTEBTTSSSCB-BHHHHHHHTTSSTTS-S-S--SH
T ss_pred             hhhhhccccccccccccccccccccccccccccccccccccCCccccccCCCCCCcCcHHHHHHhCCCCCceEccC--CH
Confidence                        000111111111000000000000  0000   1258999999999999999999999999999  78


Q ss_pred             HHHHHHcCCccCHHHHHHHHHHHHh
Q 023723          251 RQRYALLGNSLSIAVVAPLLQYLFA  275 (278)
Q Consensus       251 ~~~~~~iGNaVp~~v~~~i~~~l~~  275 (278)
                      +++|+||||||||+|+++|+++|++
T Consensus       311 ~~~~~qiGNAVpp~v~~~I~~~i~~  335 (335)
T PF00145_consen  311 TQQYKQIGNAVPPPVAEAIAKAIKK  335 (335)
T ss_dssp             HHHHHHHHCS--HHHHHHHHHHHH-
T ss_pred             HHHhceECCCcCHHHHHHHHHHhhC
Confidence            8999999999999999999999974

1.1.37 from EC) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine [, , ]. In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA [, ]. The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A []: the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain.; GO: 0003677 DNA binding, 0006306 DNA methylation; PDB: 4DA4_A 3PT6_B 3AV6_A 3AV5_A 3AV4_A 3PT9_A 1DCT_A 3LX6_A 3ME5_A 2QRV_A ....

>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology	Back alignment and domain information

>TIGR00675 dcm DNA-methyltransferase (dcm)	Back alignment and domain information

>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK10458 DNA cytosine methylase; Provisional	Back alignment and domain information

>KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription]	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH	Back alignment and domain information

>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ]

Back alignment and domain information

>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>TIGR00095 RNA methyltransferase, RsmD family	Back alignment and domain information

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional	Back alignment and domain information

>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB	Back alignment and domain information

>PHA03412 putative methyltransferase; Provisional	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>COG2520 Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional	Back alignment and domain information

>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>smart00650 rADc Ribosomal RNA adenine dimethylases	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase	Back alignment and domain information

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA	Back alignment and domain information

>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2	Back alignment and domain information

>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase	Back alignment and domain information

>COG4123 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>KOG1227 consensus Putative methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species	Back alignment and domain information

>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed	Back alignment and domain information

>TIGR00755 ksgA dimethyladenosine transferase	Back alignment and domain information

>PTZ00338 dimethyladenosine transferase-like protein; Provisional	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>KOG2904 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase	Back alignment and domain information

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed	Back alignment and domain information

>COG3897 Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>PRK05785 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2	Back alignment and domain information

>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2	Back alignment and domain information

>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02672 methionine S-methyltransferase	Back alignment and domain information

>PRK11727 23S rRNA mA1618 methyltransferase; Provisional	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK10742 putative methyltransferase; Provisional	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>COG3963 Phospholipid N-methyltransferase [Lipid metabolism]	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>COG2521 Predicted archaeal methyltransferase [General function prediction only]	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins	Back alignment and domain information

>KOG2730 consensus Methylase [General function prediction only]	Back alignment and domain information

>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A	Back alignment and domain information

>PRK06202 hypothetical protein; Provisional	Back alignment and domain information

>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes	Back alignment and domain information

>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02585 magnesium protoporphyrin IX methyltransferase	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>TIGR00478 tly hemolysin TlyA family protein	Back alignment and domain information

>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>TIGR02081 metW methionine biosynthesis protein MetW	Back alignment and domain information

>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PHA01634 hypothetical protein	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase	Back alignment and domain information

>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>PRK11524 putative methyltransferase; Provisional	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>PRK13699 putative methylase; Provisional	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>PRK06922 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification]	Back alignment and domain information

>TIGR01444 fkbM_fam methyltransferase, FkbM family	Back alignment and domain information

>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>PLN02781 Probable caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>KOG2078 consensus tRNA modification enzyme [RNA processing and modification]	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase []	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>COG4076 Predicted RNA methylase [General function prediction only]	Back alignment and domain information

>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification]	Back alignment and domain information

>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes	Back alignment and domain information

>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases	Back alignment and domain information

>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		278
4h0n_A		333	Crystal Structure Of Spodoptera Frugiperda Dnmt2 E2		3e-24
1g55_A		343	Structure Of Human Dnmt2, An Enigmatic Dna Methyltr		3e-23
3qv2_A		327	Structure Analysis Of Entamoeba Histolytica Methylt		5e-20

>pdb|4H0N|A Chain A, Crystal Structure Of Spodoptera Frugiperda Dnmt2 E260a/e261a/k263a Mutant Length = 333

Back alignment and structure

Iteration: 1

Score = 108 bits (271), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 100/337 (29%), Positives = 145/337 (43%), Gaps = 77/337 (22%) Query: 10 GEAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVY-----ELNFGHRPYQAK 64 G + ++LE YSGIGGM + ++ + ++V A DIN AN VY E N +R Q + Sbjct: 1 GMSHKILELYSGIGGMHCAWKESGLDGEIVAAVDINTVANSVYKHNFPETNLLNRNIQ-Q 59 Query: 65 RKPLSFRCQLLNNQLLRSP-SPLLGN----DD--------MTVITKHDQPDDS------- 104 P + ++ L+ P P N DD + +I DQ D+ Sbjct: 60 LTPQVIKKWNVDTILMSPPCQPFTRNGKYLDDNDPRTNSFLYLIGILDQLDNVDYILMEN 119 Query: 105 -------------WDKLLESCDPVERFLEFSNSGDQVNTETGFLSTG------------- 138 DKL E + FL ++ N+ + T Sbjct: 120 VKGFENSTVRNLFIDKLKECNFIYQEFLLCPSTVGVPNSRLRYYCTARRNNLTWPFKRRD 179 Query: 139 ---TAAVDDFG---AAEETVEVDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTK 192 T DFG + E +E D + FLVP ++ R DI Y SKR CCFTK Sbjct: 180 EIITRLPKDFGVPHSLESIIEED---VDEKFLVPEKML-RCAKVFDICYKTSKRSCCFTK 235 Query: 193 SYYRYVKGTGSLL-------------ATVQPKNKGK--ASSLKEQHLRYFTPREVANLHS 237 +Y Y GTGS+ A Q + G+ KE LRYFTP+EV + Sbjct: 236 AYTHYADGTGSIFTDKPREVVQKCYAAAAQNEIGGEKFVELFKELKLRYFTPKEVLMIMC 295 Query: 238 FPGDFQFPHHLSLRQRYALLGNSLSIAVVAPLLQYLF 274 FP + P ++S++Q Y LLGNS+++ V++ LL+ LF Sbjct: 296 FPKSYNLPTNISMKQCYRLLGNSVNVKVISELLKILF 332

PyMOL of 4h0n

>pdb|1G55|A Chain A, Structure Of Human Dnmt2, An Enigmatic Dna Methyltransferase Homologue Length = 343

Back alignment and structure

>pdb|3QV2|A Chain A, Structure Analysis Of Entamoeba Histolytica Methyltransferase Ehmeth Length = 327

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		278
1g55_A		343	DNA cytosine methyltransferase DNMT2; human DNA me	4e-23
1g55_A		343	DNA cytosine methyltransferase DNMT2; human DNA me	6e-14
3qv2_A		327	5-cytosine DNA methyltransferase; DNMT2, ehmeth; H	1e-21
3qv2_A		327	5-cytosine DNA methyltransferase; DNMT2, ehmeth; H	8e-13
1dct_A		324	Protein (modification methylase HAEIII); enzyme, c	5e-09
1dct_A		324	Protein (modification methylase HAEIII); enzyme, c	2e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-09
2c7p_A		327	Modification methylase HHAI; DNA methyltransferase	3e-06
2c7p_A		327	Modification methylase HHAI; DNA methyltransferase	2e-04
3me5_A		482	Cytosine-specific methyltransferase; structural ge	4e-06
3me5_A		482	Cytosine-specific methyltransferase; structural ge	3e-05
3g7u_A		376	Cytosine-specific methyltransferase; DNA-binding,	7e-06
3g7u_A		376	Cytosine-specific methyltransferase; DNA-binding,	9e-04
2qrv_A		295	DNA (cytosine-5)-methyltransferase 3A; DNA methylt	3e-05
2qrv_A		295	DNA (cytosine-5)-methyltransferase 3A; DNA methylt	2e-04
3swr_A		1002	DNA (cytosine-5)-methyltransferase 1; epigenetics,	8e-04

>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343	Back alignment and structure

 Score = 95.6 bits (238), Expect = 4e-23
 Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 13/130 (10%)

Query: 158 VSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQ-------- 209
             ++ +L+P   + R+   +DIV P  +R  CFTK Y  Y++GTGS+L T +        
Sbjct: 213 TDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSYIEGTGSVLQTAEDVQVENIY 272

Query: 210 --PKNKGKASSLKEQH---LRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNSLSIA 264
               N  +   + +     LRYFTP+E+ANL  FP +F FP  ++++QRY LLGNSL++ 
Sbjct: 273 KSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGFPEKITVKQRYRLLGNSLNVH 332

Query: 265 VVAPLLQYLF 274
           VVA L++ L+
Sbjct: 333 VVAKLIKILY 342

PyMOL of 1g55

>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343	Back alignment and structure

>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327	Back alignment and structure

>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327	Back alignment and structure

>1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324	Back alignment and structure

>1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327	Back alignment and structure

>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327	Back alignment and structure

>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482	Back alignment and structure

>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482	Back alignment and structure

>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376	Back alignment and structure

>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376	Back alignment and structure

>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295	Back alignment and structure

>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295	Back alignment and structure

>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		278
3qv2_A		327	5-cytosine DNA methyltransferase; DNMT2, ehmeth; H	100.0
3ubt_Y		331	Modification methylase HAEIII; protein-DNA complex	100.0
4h0n_A		333	DNMT2; SAH binding, transferase; HET: SAH; 2.71A {	100.0
2c7p_A		327	Modification methylase HHAI; DNA methyltransferase	100.0
3g7u_A		376	Cytosine-specific methyltransferase; DNA-binding,	100.0
1g55_A		343	DNA cytosine methyltransferase DNMT2; human DNA me	100.0
4ft4_B		784	DNA (cytosine-5)-methyltransferase 1; chromodomain	100.0
2qrv_A		295	DNA (cytosine-5)-methyltransferase 3A; DNA methylt	100.0
4dkj_A		403	Cytosine-specific methyltransferase; CG-specificit	100.0
3swr_A		1002	DNA (cytosine-5)-methyltransferase 1; epigenetics,	100.0
3av4_A		1330	DNA (cytosine-5)-methyltransferase 1; CXXC-type zi	100.0
3me5_A		482	Cytosine-specific methyltransferase; structural ge	100.0
2qrv_B		230	DNA (cytosine-5)-methyltransferase 3-like; DNA met	99.88
2pv0_B		386	DNA (cytosine-5)-methyltransferase 3-like; DNMT3L,	99.87
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	98.05
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	97.93
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	97.73
3k6r_A		278	Putative transferase PH0793; structural genomics,	97.72
2frn_A		278	Hypothetical protein PH0793; structural genomics,	97.69
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	97.56
1ne2_A		200	Hypothetical protein TA1320; structural genomics,	97.52
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	97.52
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	97.5
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	97.43
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	97.38
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	97.35
3lpm_A		259	Putative methyltransferase; structural genomics, p	97.26
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	97.26
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	97.26
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	97.19
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	97.19
3bt7_A		369	TRNA (uracil-5-)-methyltransferase; methyluridine,	97.14
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	97.14
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	97.11
2esr_A		177	Methyltransferase; structural genomics, hypothetic	97.1
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	97.06
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	97.04
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	97.01
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	96.96
2b9e_A		309	NOL1/NOP2/SUN domain family, member 5 isoform 2; m	96.93
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	96.92
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	96.92
1ws6_A		171	Methyltransferase; structural genomics, riken stru	96.91
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	96.9
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	96.9
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	96.88
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	96.88
2jjq_A		425	Uncharacterized RNA methyltransferase pyrab10780;	96.83
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	96.73
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	96.71
3fut_A		271	Dimethyladenosine transferase; methyltransferase,	96.68
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	96.62
2b3t_A		276	Protein methyltransferase HEMK; translation termin	96.59
1uwv_A		433	23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m	96.57
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	96.56
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	96.54
2h1r_A		299	Dimethyladenosine transferase, putative; SGC toron	96.51
3ll7_A		410	Putative methyltransferase; methytransferase, stru	96.45
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	96.43
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	96.43
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	96.4
2h00_A		254	Methyltransferase 10 domain containing protein; st	96.38
1zq9_A		285	Probable dimethyladenosine transferase; SGC, struc	96.37
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	96.33
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	96.33
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	96.3
3ftd_A		249	Dimethyladenosine transferase; KSGA, rossmann-like	96.27
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	96.26
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	96.2
1qam_A		244	ERMC' methyltransferase; rRNA methyltransferase ER	96.16
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	96.14
4fzv_A		359	Putative methyltransferase NSUN4; mterf fold, meth	96.12
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	96.11
2qm3_A		373	Predicted methyltransferase; putative methyltransf	96.1
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	96.08
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	96.05
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	96.03
3gru_A		295	Dimethyladenosine transferase; rossman fold, ribos	95.99
3tqs_A		255	Ribosomal RNA small subunit methyltransferase A; p	95.96
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	95.93
2oyr_A		258	UPF0341 protein YHIQ; alpha-beta protein, structur	95.91
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	95.89
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	95.86
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	95.86
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	95.85
2f8l_A		344	Hypothetical protein LMO1582; structural genomics,	95.85
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	95.8
3ldg_A		384	Putative uncharacterized protein SMU.472; YPSC, me	95.74
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	95.72
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	95.71
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	95.71
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	95.7
1m6y_A		301	S-adenosyl-methyltransferase MRAW; SAM-dependent m	95.68
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	95.66
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	95.66
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	95.58
3i9f_A		170	Putative type 11 methyltransferase; structural gen	95.55
2zig_A		297	TTHA0409, putative modification methylase; methylt	95.53
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	95.48
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	95.47
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	95.44
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	95.43
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	95.38
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	95.37
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	95.37
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	95.36
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	95.31
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	95.27
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	95.25
3ldu_A		385	Putative methylase; structural genomics, PSI-2, pr	95.24
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	95.18
3k0b_A		393	Predicted N6-adenine-specific DNA methylase; methy	95.16
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	95.14
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	95.13
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	95.09
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	95.03
3lcc_A		235	Putative methyl chloride transferase; halide methy	95.01
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	94.94
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	94.94
2okc_A		445	Type I restriction enzyme stysji M protein; NP_813	94.92
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	94.92
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	94.88
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	94.87
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	94.77
2qfm_A		364	Spermine synthase; spermidine aminopropyltransfera	94.73
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	94.69
3khk_A		544	Type I restriction-modification system methylation	94.65
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	94.62
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	94.62
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	94.61
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	94.61
3s1s_A		878	Restriction endonuclease bpusi; PD--(D/E)XK cataly	94.59
2ar0_A		541	M.ecoki, type I restriction enzyme ecoki M protein	94.57
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	94.54
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	94.51
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	94.5
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	94.48
3lkd_A		542	Type I restriction-modification system methyltrans	94.47
2b25_A		336	Hypothetical protein; structural genomics, methyl	94.39
2oo3_A		283	Protein involved in catabolism of external DNA; st	94.38
3uzu_A		279	Ribosomal RNA small subunit methyltransferase A; s	94.34
1g6q_1		328	HnRNP arginine N-methyltransferase; SAM-binding do	94.33
3q7e_A		349	Protein arginine N-methyltransferase 1; HET: SAH;	94.32
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	94.31
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	94.3
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	94.29
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	94.29
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	94.26
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	94.24
2pt6_A		321	Spermidine synthase; transferase, structural genom	94.24
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	94.2
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	94.12
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	94.09
2avd_A		229	Catechol-O-methyltransferase; structural genomics,	94.08
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	94.03
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	93.95
2r6z_A		258	UPF0341 protein in RSP 3' region; alpha-beta prote	93.95
4hc4_A		376	Protein arginine N-methyltransferase 6; HRMT1L6, S	93.94
2ih2_A		421	Modification methylase TAQI; DNA, DNA methyltransf	93.87
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	93.86
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	93.84
1qyr_A		252	KSGA, high level kasugamycin resistance protein, S	93.79
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	93.73
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	93.66
3kr9_A		225	SAM-dependent methyltransferase; class I rossmann-	93.65
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	93.62
3lec_A		230	NADB-rossmann superfamily protein; PSI, MCSG, stru	93.62
3cc8_A		230	Putative methyltransferase; structural genomics, j	93.6
3gnl_A		244	Uncharacterized protein, DUF633, LMOF2365_1472; st	93.6
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	93.59
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	93.58
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	93.57
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	93.57
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	93.54
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	93.52
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	93.47
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	93.45
3lcv_B		281	Sisomicin-gentamicin resistance methylase SGM; ant	93.44
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	93.43
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	93.36
2o07_A		304	Spermidine synthase; structural genomics, structur	93.3
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	93.28
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	93.23
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	93.09
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	93.09
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	92.98
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	92.96
2i7c_A		283	Spermidine synthase; transferase, structural genom	92.94
2p7i_A		250	Hypothetical protein; putative methyltransferase,	92.89
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	92.87
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	92.8
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	92.71
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	92.69
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	92.67
3f4k_A		257	Putative methyltransferase; structural genomics, P	92.67
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	92.55
3fzg_A		200	16S rRNA methylase; methyltransferase, plasmid, tr	92.53
1xxl_A		239	YCGJ protein; structural genomics, protein structu	92.39
4azs_A		569	Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15	92.37
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	92.32
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	92.3
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	92.21
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	92.1
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	92.03
3hp7_A		291	Hemolysin, putative; structural genomics, APC64019	91.97
3b3j_A		480	Histone-arginine methyltransferase CARM1; protein	91.95
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	91.89
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	91.85
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	91.83
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	91.75
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	91.66
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	91.51
3ckk_A		235	TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-	91.49
2y1w_A		348	Histone-arginine methyltransferase CARM1; histone	91.46
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	91.17
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	91.14
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	91.11
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	91.07
3ocj_A		305	Putative exported protein; structural genomics, PS	90.9
1yub_A		245	Ermam, rRNA methyltransferase; MLS antibiotics; NM	90.87
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	90.8
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	90.4
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	90.35
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	90.13
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	90.1
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	89.83
1boo_A		323	Protein (N-4 cytosine-specific methyltransferase P	89.81
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	89.67
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	89.51
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	89.44
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	89.26
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	89.26
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	89.05
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	89.05
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	88.91
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	88.54
3ege_A		261	Putative methyltransferase from antibiotic biosyn	87.98
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	87.87
2hnk_A		239	SAM-dependent O-methyltransferase; modified rossma	87.61
2vdw_A		302	Vaccinia virus capping enzyme D1 subunit; nucleoti	87.57
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	87.25
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	87.2
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	87.08
1eg2_A		319	Modification methylase RSRI; rossmann fold, exocyc	86.97
3ufb_A		530	Type I restriction-modification system methyltran	86.74
3c3y_A		237	Pfomt, O-methyltransferase; plant secondary metabo	86.68
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	86.19
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	85.95
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	85.7
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	85.7
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	85.69
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	85.48
1x19_A		359	CRTF-related protein; methyltransferase, bacterioc	85.14
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	84.25
1u2z_A		433	Histone-lysine N-methyltransferase, H3 lysine-79 s	84.11
3cbg_A		232	O-methyltransferase; cyanobacterium; HET: SAH FER	84.09
3frh_A		253	16S rRNA methylase; methyltransferase domain, heli	84.03
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	83.85
3dp7_A		363	SAM-dependent methyltransferase; structural genomi	83.8
2cmg_A		262	Spermidine synthase; transferase, putrescine amino	82.45
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	80.49
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	80.37
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	80.23

>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica}	Back alignment and structure

Probab=100.00  E-value=1.8e-60  Score=435.70  Aligned_cols=269  Identities=31%  Similarity=0.463  Sum_probs=219.7

Q ss_pred             ccccCCCCCCeEEeeecchhhHHHHHHhcCCCceEE-EEEcCCHHHHHHHHHHcCCCCcccccccccccccc--CCCEEE
Q 023723            4 DMCKNDGEAWRVLEFYSGIGGMRYSLMKADVSAQVV-EAFDINDKANDVYELNFGHRPYQAKRKPLSFRCQL--LNNQLL   80 (278)
Q Consensus         4 ~~~~~~~~~~~v~dLFsG~Gg~~~gl~~aG~~~~~v-~a~e~~~~a~~~y~~N~~~~~~~~~~~~~~~~~~~--~~Dll~   80 (278)
                      +|..-+.++++++|||||+||+++||++||+++++| +|+|+|+.|++||++|||+..+..|+..+...+.+  ++|+|+
T Consensus         2 ~l~~m~~~~~~vidLFaG~GG~~~G~~~aG~~~~~v~~a~e~d~~a~~ty~~N~~~~~~~~DI~~~~~~~i~~~~~Dil~   81 (327)
T 3qv2_A            2 PLGSMQQKQVNVIEFFSGIGGLRSSYERSSININATFIPFDINEIANKIYSKNFKEEVQVKNLDSISIKQIESLNCNTWF   81 (327)
T ss_dssp             ------CCCEEEEEETCTTTHHHHHHHHSSCCCCEEEEEECCCHHHHHHHHHHHCCCCBCCCTTTCCHHHHHHTCCCEEE
T ss_pred             CCccccCCCCEEEEECCChhHHHHHHHHcCCCceEEEEEEECCHHHHHHHHHHCCCCcccCChhhcCHHHhccCCCCEEE
Confidence            344455668999999999999999999999767999 99999999999999999998655554444443333  799999


Q ss_pred             eCCCCCCC--CcccccCCCCCCCCchHHHHhh-h---c--CCcEEEEE-eCCC---c-----cchhhccCc------eec
Q 023723           81 RSPSPLLG--NDDMTVITKHDQPDDSWDKLLE-S---C--DPVERFLE-FSNS---G-----DQVNTETGF------LST  137 (278)
Q Consensus        81 ~g~PCq~f--S~ag~~~g~~d~r~~l~~~~i~-~---~--~P~~~i~E-v~~~---~-----~~~l~~~GY------l~A  137 (278)
                      ||||||+|  |.+|++++.+|+|+.||+++++ +   .  +|++|++| |++.   .     ++.|+++||      |||
T Consensus        82 ggpPCQ~fs~S~ag~~~~~~d~r~~L~~~~~r~~i~~~~~~P~~~~lENV~gl~~~~~~~~i~~~l~~~GY~v~~~vl~a  161 (327)
T 3qv2_A           82 MSPPCQPYNNSIMSKHKDINDPRAKSVLHLYRDILPYLINKPKHIFIENVPLFKESLVFKEIYNILIKNQYYIKDIICSP  161 (327)
T ss_dssp             ECCCCTTCSHHHHTTTCTTTCGGGHHHHHHHHTTGGGCSSCCSEEEEEECGGGGGSHHHHHHHHHHHHTTCEEEEEEECG
T ss_pred             ecCCccCcccccCCCCCCCccccchhHHHHHHHHHHHhccCCCEEEEEchhhhcChHHHHHHHHHHHhCCCEEEEEEEeH
Confidence            99999999  9999999999999999999888 5   5  89999999 7642   2     788999999      899


Q ss_pred             cCcccCcccc-cccccc--cccccc-----------------------cccCCCChhhhhcCCccccccCCCCCCccccc
Q 023723          138 GTAAVDDFGA-AEETVE--VDRCVS-----------------------IDHFLVPLSLIERWGSAMDIVYPDSKRCCCFT  191 (278)
Q Consensus       138 ~~~~~~dfGv-Q~r~~f--l~~~~~-----------------------~~~~~~p~~~~~~~~~~~d~~~~~~~~~~~~~  191 (278)
                      +     +||+ |+|+|+  +..+.+                       ..+|.+|.+.+.+++..+|++.|++.++.|++
T Consensus       162 ~-----~yGvPQ~R~R~fivg~r~~f~fP~~~~~~~~~~l~d~Le~~~~~~y~l~~~~~~~~~~~~di~~~~~~~~~~~t  236 (327)
T 3qv2_A          162 I-----DIGIPNSRTRYYVMARLTPFKNEIQLHQEKESMISNYLDNNVNESYSIPSDLILKKGMLFDIVGKDDKRTCCFT  236 (327)
T ss_dssp             G-----GGTCSBCCCEEEEEEESSCCCSCCCCCCCSCCCGGGGCCSSCCGGGBCCHHHHHHHGGGSCEEETTSSCBCCCC
T ss_pred             H-----HcCCCccceEEEEEEEeCCCCCCCcccccccccHHHHhcccccccccCCHHHHHhhhccccccccccccccccc
Confidence            9     9999 999884  222211                       12355666666667778899999888889999


Q ss_pred             ccceecccCCCceeeecCCC--CCCCCccccCCcccccCHHHHHHhCCCCCCcccC-CCCCHHHHHHHcCCccCHHHHHH
Q 023723          192 KSYYRYVKGTGSLLATVQPK--NKGKASSLKEQHLRYFTPREVANLHSFPGDFQFP-HHLSLRQRYALLGNSLSIAVVAP  268 (278)
Q Consensus       192 ~~y~r~~~~~~s~~~~~~~~--~~~~~~~~~~~~~R~lT~rE~~rLqgFPd~~~~~-~~~s~~~~~~~iGNaVp~~v~~~  268 (278)
                      ++|+++..++++.++.....  .......+|+.+.|+|||||++|||||||+|.|+ +++|.+++|+|+||||||+|+++
T Consensus       237 ~~y~~y~~~~gs~l~~~~~~~~~~~~~~~~~~~~~R~lt~~E~~rlqgfP~~~~~~~~~~s~~~~y~~~GNsv~v~v~~~  316 (327)
T 3qv2_A          237 KSYTKIVEGTGSIYCPIEPHFIPVKKAEDLLNKNLRYFTPNEIKKIHGFSSNFTTQIDGLTDKQQYQCLGNSVSCFVIAQ  316 (327)
T ss_dssp             TTTTTSSTTSCCEEESSCSSCCCCSSGGGGTTSCCBCCCHHHHHHHTTCCTTCCSCCTTCCHHHHHHHHHTSCCHHHHHH
T ss_pred             ccceEEecCCCceeecccccccccCCceeecCCccccCcHHHHHHhCcCCHHHcCCcCCCCHHHHHHHccCccCHHHHHH
Confidence            99999999999887433211  1223456789999999999999999999999999 66799999999999999999999


Q ss_pred             HHHHHHhhc
Q 023723          269 LLQYLFAQA  277 (278)
Q Consensus       269 i~~~l~~~~  277 (278)
                      |+++|++..
T Consensus       317 i~~~l~~~l  325 (327)
T 3qv2_A          317 LMEYLFDDL  325 (327)
T ss_dssp             HHHHHTTTS
T ss_pred             HHHHHHHHh
Confidence            999998754

PyMOL of 3qv2

>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A*	Back alignment and structure

>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda}	Back alignment and structure

>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ...	Back alignment and structure

>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157}	Back alignment and structure

>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26	Back alignment and structure

>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A*	Back alignment and structure

>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens}	Back alignment and structure

>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans}	Back alignment and structure

>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A*	Back alignment and structure

>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A*	Back alignment and structure

>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A	Back alignment and structure

>2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens}	Back alignment and structure

>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B*	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A*	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli}	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A*	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A*	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A*	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A*	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A*	Back alignment and structure

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A*	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum}	Back alignment and structure

>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis}	Back alignment and structure

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54	Back alignment and structure

>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B*	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A*	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*	Back alignment and structure

>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans}	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A*	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile}	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei}	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus}	Back alignment and structure

>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B*	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59	Back alignment and structure

>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei}	Back alignment and structure

>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6	Back alignment and structure

>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A*	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae}	Back alignment and structure

>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens}	Back alignment and structure

>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A*	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli}	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A*	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus}	Back alignment and structure

>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus}	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana}	Back alignment and structure

>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}	Back alignment and structure

>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca}	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}	Back alignment and structure

>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus}	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A	Back alignment and structure

>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus}	Back alignment and structure

>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31	Back alignment and structure

>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}	Back alignment and structure

>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A*	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus}	Back alignment and structure

>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		278
d1g55a_		343	c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId:	1e-19
d1g55a_		343	c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId:	2e-10
d2c7pa1		327	c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu	2e-11
d1dcta_		324	c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a	1e-09
d1dcta_		324	c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a	1e-07

>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: C5 cytosine-specific DNA methylase, DCM
domain: DNMT2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 85.1 bits (209), Expect = 1e-19
 Identities = 50/134 (37%), Positives = 79/134 (58%), Gaps = 13/134 (9%)

Query: 154 VDRCVSIDHFLVPLSLIERWGSAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATVQPKN- 212
           ++    ++ +L+P   + R+   +DIV P  +R  CFTK Y  Y++GTGS+L T +    
Sbjct: 209 LEDDTDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSYIEGTGSVLQTAEDVQV 268

Query: 213 ------------KGKASSLKEQHLRYFTPREVANLHSFPGDFQFPHHLSLRQRYALLGNS 260
                       + + + L    LRYFTP+E+ANL  FP +F FP  ++++QRY LLGNS
Sbjct: 269 ENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGFPEKITVKQRYRLLGNS 328

Query: 261 LSIAVVAPLLQYLF 274
           L++ VVA L++ L+
Sbjct: 329 LNVHVVAKLIKILY 342

PyMOL of d1g55a_

>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343	Back information, alignment and structure

>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327	Back information, alignment and structure

>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324	Back information, alignment and structure

>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		278
d1g55a_		343	DNMT2 {Human (Homo sapiens) [TaxId: 9606]}	100.0
d2c7pa1		327	DNA methylase HhaI {Haemophilus haemolyticus [TaxI	100.0
d1dcta_		324	DNA methylase HaeIII {Haemophilus aegyptius [TaxId	100.0
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	98.37
d2esra1		152	Putative methyltransferase SPy1538 {Streptococcus	98.3
d1ne2a_		197	Hypothetical protein Ta1320 {Archaeon Thermoplasma	98.27
d2fpoa1		183	Methylase YhhF {Escherichia coli [TaxId: 562]}	98.11
d2ifta1		183	Putative methylase HI0767 {Haemophilus influenzae	97.95
d1ws6a1		171	Methyltransferase TTHA0928 {Thermus thermophilus [	97.94
d2fhpa1		182	Putative methylase EF2452 {Enterococcus faecalis [	97.85
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	97.83
d2frna1		260	Hypothetical protein PH0793 {Pyrococcus horikoshii	97.76
d2igta1		309	Putative methyltransferase Atu0340 {Agrobacterium	97.71
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	97.71
d2b78a2		317	Hypothetical protein SMu776, middle and C-terminal	97.68
d1uwva2		358	rRNA (Uracil-5-)-methyltransferase RumA, catalytic	97.41
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	97.26
d1nv8a_		271	N5-glutamine methyltransferase, HemK {Thermotoga m	97.24
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	97.05
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	96.77
d2h00a1		250	Methyltransferase 10 domain containing protein MET	96.42
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	96.33
d2f8la1		328	Hypothetical protein Lmo1582 {Listeria monocytogen	96.18
d2b9ea1		293	NOL1R {Human (Homo sapiens) [TaxId: 9606]}	95.86
d2dula1		375	N(2),N(2)-dimethylguanosine tRNA methyltransferase	95.64
d1g6q1_		328	Arginine methyltransferase, HMT1 {Baker's yeast (S	95.0
d2fyta1		311	Protein arginine N-methyltransferase 3, PRMT3 {Hum	94.75
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	94.73
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	94.72
d1sqga2		284	Ribosomal RNA small subunit methyltransferase B, R	94.35
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	94.23
d1qama_		235	rRNA adenine dimethylase {Bacillus subtilis, Ermc'	94.17
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	94.11
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	93.96
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	93.91
d2ih2a1		223	DNA methylase TaqI, N-terminal domain {Thermus aqu	93.82
d1oria_		316	Protein arginine N-methyltransferase 1, PRMT1 {Rat	93.69
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	93.68
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	93.58
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	93.54
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	93.15
d1ixka_		313	Hypothetical methyltransferase PH1374 {Archaeon Py	93.14
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	93.03
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	92.75
d1eg2a_		279	m.RsrI N6 adenosine-specific DNA methyltransferase	92.14
d1zq9a1		278	Probable dimethyladenosine transferase {Human (Hom	91.93
d1pjza_		201	Thiopurine S-methyltransferase {Pseudomonas syring	91.82
d2bzga1		229	Thiopurine S-methyltransferase {Human (Homo sapien	91.63
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	91.37
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	91.37
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	91.34
d1xvaa_		292	Glycine N-methyltransferase {Rat (Rattus norvegicu	91.34
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	91.21
d1booa_		320	m.PvuII N4 cytosine-specific DNA methyltransferase	91.04
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	90.44
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	90.0
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	89.94
d1m6ya2		192	TM0872, methyltransferase domain {Thermotoga marit	89.86
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	89.36
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	88.18
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	87.19
d2okca1		425	Type I restriction enzyme StySJI M protein {Bacter	86.67
d2a14a1		257	Indolethylamine N-methyltransferase, INMT {Human (	86.64
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	84.6
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	84.05
d2oyra1		250	Hypothetical protein YhiQ {Shigella flexneri [TaxI	83.11
d1qyra_		252	High level kasugamycin resistance protein KsgA {Es	81.8
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	81.25
d2ar0a1		524	M.EcoKI {Escherichia coli [TaxId: 562]}	81.2
d1nw3a_		328	Catalytic, N-terminal domain of histone methyltran	81.18
d1tw3a2		253	Carminomycin 4-O-methyltransferase {Streptomyces p	80.42
d1i4wa_		322	Transcription factor sc-mtTFB {Baker's yeast (Sacc	80.14

>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: C5 cytosine-specific DNA methylase, DCM
domain: DNMT2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-59  Score=427.58  Aligned_cols=260  Identities=35%  Similarity=0.522  Sum_probs=172.0

Q ss_pred             CCCeEEeeecchhhHHHHHHhcCCCceEEEEEcCCHHHHHHHHHHcCCCC-ccccccccccc--cccCCCEEEeCCCCCC
Q 023723           11 EAWRVLEFYSGIGGMRYSLMKADVSAQVVEAFDINDKANDVYELNFGHRP-YQAKRKPLSFR--CQLLNNQLLRSPSPLL   87 (278)
Q Consensus        11 ~~~~v~dLFsG~Gg~~~gl~~aG~~~~~v~a~e~~~~a~~~y~~N~~~~~-~~~~~~~~~~~--~~~~~Dll~~g~PCq~   87 (278)
                      ++|+|+|||||+||+++||++||+++++|+|+|+|+.|++||++|||+.. +.+|+..+...  ..+++|||+||||||+
T Consensus         1 ~p~kv~~lF~G~Gg~~~gl~~aG~~~~~~~a~E~~~~a~~~~~~n~~~~~~~~~di~~~~~~~~~~~~~Dll~ggpPCq~   80 (343)
T d1g55a_           1 EPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQP   80 (343)
T ss_dssp             CCEEEEEETCTTCHHHHHHHHHTCSEEEEEEECCCHHHHHHHHHHCTTSCEECSCGGGCCHHHHHHHCCSEEEECCC---
T ss_pred             CCCEEEEcCcCccHHHHHHHHcCCCCeEEEEEECCHHHHHHHHHHCCCCCcccCchhhCCHhHcCCCCccEEEeeccccc
Confidence            47899999999999999999999877999999999999999999999876 45554333333  3358999999999999


Q ss_pred             CCcccccCCCCCCCCchHHHHhhh---c--CCcEEEEE-eCCCc--------cchhhccCc------eeccCcccCcccc
Q 023723           88 GNDDMTVITKHDQPDDSWDKLLES---C--DPVERFLE-FSNSG--------DQVNTETGF------LSTGTAAVDDFGA  147 (278)
Q Consensus        88 fS~ag~~~g~~d~r~~l~~~~i~~---~--~P~~~i~E-v~~~~--------~~~l~~~GY------l~A~~~~~~dfGv  147 (278)
                      ||.||++++.+|+|+.||++++++   .  +|++|++| |++..        ++.|+++||      |||+     +||+
T Consensus        81 fS~ag~~~~~~d~r~~l~~~~~~~i~~~~~kPk~~i~ENV~~l~~~~~~~~i~~~l~~~GY~v~~~vlna~-----dyGv  155 (343)
T d1g55a_          81 FTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENVKGFEVSSTRDLLIQTIENCGFQYQEFLLSPT-----SLGI  155 (343)
T ss_dssp             ---------------CHHHHHHHHGGGCSSCCSEEEEEEETTGGGSHHHHHHHHHHHHTTEEEEEEEECGG-----GGTC
T ss_pred             ccccccccccccccccccchhhhhHhhhcCCCceeeeeccCCcccchhhHHHHhhhhccccccceeeeecc-----ccCC
Confidence            999999999999999999998776   2  79999999 77532        788999999      8999     9999


Q ss_pred             -cccccc--cccccc-cccCCCChhhh--------h---------cCCccccc--------------------------c
Q 023723          148 -AEETVE--VDRCVS-IDHFLVPLSLI--------E---------RWGSAMDI--------------------------V  180 (278)
Q Consensus       148 -Q~r~~f--l~~~~~-~~~~~~p~~~~--------~---------~~~~~~d~--------------------------~  180 (278)
                       |+|+|+  +..+.+ ...+..|....        .         ......|+                          .
T Consensus       156 PQ~R~Rvfivg~r~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  235 (343)
T d1g55a_         156 PNSRLRYFLIAKLQSEPLPFQAPGQVLMEFPKIEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYALLLDIV  235 (343)
T ss_dssp             SCCCCEEEEEEEESSSCCTTCCTTCEESSCCC------------CCCCCGGGGCCTTCCHHHHBCCHHHHHHHGGGCCEE
T ss_pred             cccceeEEEEEEeCCccccCCCcccccccCCcccccccccccccccccchhhhcccccchhhcccChHhhhhhhhhcccc
Confidence             999983  333221 01111111100        0         00011111                          1


Q ss_pred             CCCCCCcccccccceecccCCCceeeecCCCC--------C-----CCCccccCCcccccCHHHHHHhCCCCCCcccCCC
Q 023723          181 YPDSKRCCCFTKSYYRYVKGTGSLLATVQPKN--------K-----GKASSLKEQHLRYFTPREVANLHSFPGDFQFPHH  247 (278)
Q Consensus       181 ~~~~~~~~~~~~~y~r~~~~~~s~~~~~~~~~--------~-----~~~~~~~~~~~R~lT~rE~~rLqgFPd~~~~~~~  247 (278)
                      .+...+..++++.++......++.+.+.....        .     .....+|+.+.|+||||||+|||||||+|.|++.
T Consensus       236 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R~LT~rE~arLQgFPd~f~~~~~  315 (343)
T d1g55a_         236 QPTCRRSVCFTKGYGSYIEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGFPEK  315 (343)
T ss_dssp             CTTCSCCCCCCTTTTTCCTTSCCEEECCSSCCHHHHHHTTTTCCHHHHHHHHHTTCEECCCHHHHHHHTTCCTTCCCCTT
T ss_pred             cccccccchhcccccccccCCCcccccccccccCCcccccccCCCCCCcccCCCCCCcCCCHHHHHHhCCCCCCCEECCC
Confidence            12222223344434333333333222211100        0     0123468999999999999999999999999998


Q ss_pred             CCHHHHHHHcCCccCHHHHHHHHHHHHh
Q 023723          248 LSLRQRYALLGNSLSIAVVAPLLQYLFA  275 (278)
Q Consensus       248 ~s~~~~~~~iGNaVp~~v~~~i~~~l~~  275 (278)
                      +|.+++|+||||||||+|+++|++.|++
T Consensus       316 ~s~~~~ykqiGNaVp~~v~~~i~k~l~e  343 (343)
T d1g55a_         316 ITVKQRYRLLGNSLNVHVVAKLIKILYE  343 (343)
T ss_dssp             SCHHHHHHHHHHSCCHHHHHHHHHHHHC
T ss_pred             CCHHHHhhhEeCCccHHHHHHHHHHhcC
Confidence            9999999999999999999999999975

PyMOL of d1g55a_

>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}	Back information, alignment and structure

>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]}	Back information, alignment and structure

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]}	Back information, alignment and structure

>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}	Back information, alignment and structure

>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure