Citrus Sinensis ID: 023757

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MRSFLRQSRVSINSRSWTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
cccccccccEEEEEccEEEEEEEEEccccccccccEEEEEcccccccEEEcccEEEEEEcccccccccEEcEEEEEEEccccccccEEEccccEEEEEEEEcccccccccEEEEEEEEEEccccEEEEEccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEcccccccEEEEccccEEEcHHHHHccccccccccccccccccccc
cccccccccEEEEEEEHHHHHHEEccccccccHHHHHHHHccccccEEEEcccEEEEEEccccccccccHEEEcccccccccHHHHHHHHHccccccccEEEEEEcccccEEEEEEEEEEccccEEEEcccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccEEEEEccccEEEcHHHHHHcccccccHHHHHHEEEEHcc
MRSFLRQSRVSINSRSWTERhflkhndagswiqDSALMLSMskevpwylddgtgcvfvvgargatgFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVkrigrllptgtsltvvgeavkddigtvriqrphkgpfyvspkTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAAAVQrseqdnegtngqaengsdstqrdrvmpDLCVICLEqeynavffpcghlccclicssrltncplcrrRIDQVVRTFRH
mrsflrqsrvsinsrswterhflkhndagsWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRllptgtsltvvgeavkddigtvriqrphkgpfyvspkTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAaavqrseqdnegtngqaengsdstqrdrVMPDLCVICLEQEYNAVFFPCGHLCCCLICssrltncplcrrRIDQVVRTFRH
MRSFLRQSRVSINSRSWTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILqrkrrwelrrrvlaaaavqrSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
****************WTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAAA***************************MPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRT***
***********INSRSWTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAV*************KGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRW*****************************************LCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
**********SINSRSWTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAA**************************DRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
**SFLRQSRVSINSRSWTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRV********************************MPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSFLRQSRVSINSRSWTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query277 2.2.26 [Sep-21-2011]
Q5M7X9341 Mitochondrial ubiquitin l yes no 0.920 0.747 0.286 9e-17
Q6NTT6353 Mitochondrial ubiquitin l N/A no 0.830 0.651 0.284 2e-16
Q969V5352 Mitochondrial ubiquitin l yes no 0.927 0.730 0.265 3e-15
Q4R7G8352 Mitochondrial ubiquitin l N/A no 0.927 0.730 0.265 4e-15
Q8VCM5352 Mitochondrial ubiquitin l yes no 0.931 0.732 0.262 7e-13
Q557E7665 E3 ubiquitin-protein liga yes no 0.216 0.090 0.439 3e-12
Q7XI08513 Probable E3 ubiquitin-pro no no 0.256 0.138 0.333 7e-09
Q24306438 Apoptosis 1 inhibitor OS= no no 0.231 0.146 0.397 7e-09
D3ZDI6445 E3 ubiquitin-protein liga no no 0.205 0.128 0.378 9e-09
Q8WY64445 E3 ubiquitin-protein liga no no 0.205 0.128 0.378 1e-08
>sp|Q5M7X9|MUL1A_DANRE Mitochondrial ubiquitin ligase activator of nfkb 1-A OS=Danio rerio GN=mul1a PE=2 SV=1 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 114/286 (39%), Gaps = 31/286 (10%)

Query: 1   MRSFLRQSRVSINSRSWTERHFLKHNDAGS-WIQDSALMLSMSKEVPW-YLDDGTGCVFV 58
           +RS  ++S V +  +     H L  N  G  W     ++L     VP+  L      V V
Sbjct: 76  LRSQFQESSVGVIQKLVLREHKLVWNSLGRIWTDSERVLLQRVNAVPFNLLGLNKSFVRV 135

Query: 59  VGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEA 118
           +    ATG  + +  E F ++          YL G K  G      +L  G SLTVVGE 
Sbjct: 136 LCPLEATGPKMEIVHEKFHQATYGFTDLIGQYLSGEKPKGQLETEEMLKVGASLTVVGEL 195

Query: 119 VKDDIGTVRIQRPHKGP-FYVSPKTIDELL-ENLGKWARWYKYASFGLTIFGAFLI--AK 174
           + D    ++I+ P  G  +++S    + LL E  G+   W  +A        A LI   +
Sbjct: 196 ILDTDRLLKIRPPTDGSEYFLSSADFETLLMEQEGQAEVWRVFACICALAGVAVLIWTGR 255

Query: 175 RVIRCILQRKRRWELR--RRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVI 232
           R  R   Q K RWE    RR          E+DN   N                   CVI
Sbjct: 256 RYYR---QLKLRWEQENLRREFEGMGTGEREEDNGVENA------------------CVI 294

Query: 233 CLEQEYNAVFFPCGHLCCCLICSSRLTN--CPLCRRRIDQVVRTFR 276
           CL      V   CGH+CCC  C   L    CP+CR+ I +VV  ++
Sbjct: 295 CLSNPRGCVLLDCGHVCCCFRCYQALPQPFCPICRQHIKRVVPLYQ 340
E3 ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Danio rerio (taxid: 7955)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q6NTT6|MUL1_XENLA Mitochondrial ubiquitin ligase activator of nfkb 1 OS=Xenopus laevis GN=mul1 PE=2 SV=1 Back     alignment and function description
>sp|Q969V5|MUL1_HUMAN Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Homo sapiens GN=MUL1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R7G8|MUL1_MACFA Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Macaca fascicularis GN=MUL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VCM5|MUL1_MOUSE Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Mus musculus GN=Mul1 PE=2 SV=2 Back     alignment and function description
>sp|Q557E7|CBLA_DICDI E3 ubiquitin-protein ligase cblA OS=Dictyostelium discoideum GN=cblA-1 PE=1 SV=1 Back     alignment and function description
>sp|Q7XI08|XB34_ORYSJ Probable E3 ubiquitin-protein ligase XBOS34 OS=Oryza sativa subsp. japonica GN=XBOS34 PE=2 SV=1 Back     alignment and function description
>sp|Q24306|IAP1_DROME Apoptosis 1 inhibitor OS=Drosophila melanogaster GN=th PE=1 SV=2 Back     alignment and function description
>sp|D3ZDI6|MYLIP_RAT E3 ubiquitin-protein ligase MYLIP OS=Rattus norvegicus GN=Mylip PE=2 SV=1 Back     alignment and function description
>sp|Q8WY64|MYLIP_HUMAN E3 ubiquitin-protein ligase MYLIP OS=Homo sapiens GN=MYLIP PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
255567656363 zinc ion binding protein, putative [Rici 0.913 0.696 0.818 1e-122
225436896343 PREDICTED: mitochondrial ubiquitin ligas 0.935 0.755 0.784 1e-121
449436571342 PREDICTED: mitochondrial ubiquitin ligas 0.935 0.757 0.776 1e-118
449515051337 PREDICTED: mitochondrial ubiquitin ligas 0.916 0.753 0.773 1e-117
224131332335 predicted protein [Populus trichocarpa] 0.906 0.749 0.756 1e-113
118486812238 unknown [Populus trichocarpa] 0.859 1.0 0.820 1e-113
356500224339 PREDICTED: mitochondrial ubiquitin ligas 0.927 0.758 0.780 1e-111
356535760339 PREDICTED: mitochondrial ubiquitin ligas 0.927 0.758 0.776 1e-111
312283085344 unnamed protein product [Thellungiella h 0.931 0.75 0.749 1e-110
297840101343 zinc finger family protein [Arabidopsis 0.935 0.755 0.726 1e-109
>gi|255567656|ref|XP_002524807.1| zinc ion binding protein, putative [Ricinus communis] gi|223535991|gb|EEF37650.1| zinc ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/254 (81%), Positives = 233/254 (91%), Gaps = 1/254 (0%)

Query: 18  TERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFE 77
            E+HFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGT   FVVGARGA+GFALTVGSEVFE
Sbjct: 75  AEQHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTDRTFVVGARGASGFALTVGSEVFE 134

Query: 78  ESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFY 137
           ESGRSLV GTLDYLQGLKMLGVKRI R+LPTGTSL+V+GEAVKDDIGTVRIQRPHKGPFY
Sbjct: 135 ESGRSLVRGTLDYLQGLKMLGVKRIERVLPTGTSLSVIGEAVKDDIGTVRIQRPHKGPFY 194

Query: 138 VSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAA 197
           VSPKTIDEL+ NLGKWARWY+YAS GLT+FG FLIAK  I+ I++R+RRWEL+ RVLAAA
Sbjct: 195 VSPKTIDELIGNLGKWARWYRYASVGLTVFGVFLIAKHAIQYIMERRRRWELQSRVLAAA 254

Query: 198 AVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSR 257
           A +R  QD++G+NG+AENGSDS++R+R +PDLCVICLEQEYNAVF PCGH+CCC  CSS 
Sbjct: 255 A-KRQGQDSDGSNGKAENGSDSSKRERPIPDLCVICLEQEYNAVFLPCGHMCCCTACSSH 313

Query: 258 LTNCPLCRRRIDQV 271
           LTNCPLCRRRI+Q+
Sbjct: 314 LTNCPLCRRRIEQI 327

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225436896|ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|296086688|emb|CBI32323.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436571|ref|XP_004136066.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515051|ref|XP_004164563.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224131332|ref|XP_002321058.1| predicted protein [Populus trichocarpa] gi|222861831|gb|EEE99373.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118486812|gb|ABK95241.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356500224|ref|XP_003518933.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356535760|ref|XP_003536411.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|312283085|dbj|BAJ34408.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|297840101|ref|XP_002887932.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297333773|gb|EFH64191.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
TAIR|locus:2202882338 ZCF61 [Arabidopsis thaliana (t 0.920 0.754 0.484 5.5e-61
ZFIN|ZDB-GENE-050102-5341 mul1a "mitochondrial E3 ubiqui 0.931 0.756 0.257 1.5e-16
UNIPROTKB|E1BGD5350 MUL1 "Uncharacterized protein" 0.808 0.64 0.3 1.8e-16
UNIPROTKB|Q6NTT6353 mul1 "Mitochondrial ubiquitin 0.830 0.651 0.262 9.2e-15
UNIPROTKB|H9KZ02285 MUL1 "Uncharacterized protein" 0.454 0.442 0.308 9.9e-14
UNIPROTKB|E2RBI8352 MUL1 "Uncharacterized protein" 0.530 0.417 0.280 1.9e-13
UNIPROTKB|I3LH19352 MUL1 "Uncharacterized protein" 0.830 0.653 0.252 7.4e-13
MGI|MGI:1915600352 Mul1 "mitochondrial ubiquitin 0.220 0.173 0.369 1.1e-12
FB|FBgn0035483338 Mul1 "Mitochondrial E3 ubiquit 0.458 0.375 0.257 1.4e-12
RGD|1309944352 Mul1 "mitochondrial E3 ubiquit 0.523 0.411 0.276 1.8e-12
TAIR|locus:2202882 ZCF61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 624 (224.7 bits), Expect = 5.5e-61, P = 5.5e-61
 Identities = 126/260 (48%), Positives = 164/260 (63%)

Query:    19 ERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEE 78
             E+  L+ N   SW+++S LM  M+KEVPWYLDDGTG V V  ++G  G ALTVGS+VFE+
Sbjct:    83 EQQVLRRNWRFSWVRNSTLMQPMTKEVPWYLDDGTGRVNVDVSQGELGLALTVGSDVFEK 142

Query:    79 SGR-SLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFY 137
             +   SLV G L YL+G K+LGV+ + R++P GT LTVVGEAV+D +G VRIQ+P +GPFY
Sbjct:   143 AEPVSLVQGALGYLKGFKILGVRHVERVVPIGTPLTVVGEAVRDGMGNVRIQKPEQGPFY 202

Query:   138 VSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILXXXXXXXXXXXXXXXX 197
             V+   +D+L+  LG  +R +KYAS GLT+ G  LI+K VI  IL                
Sbjct:   203 VTYIPLDQLISKLGDLSRRFKYASMGLTVLGVILISKPVIEYILKRIEDTLERRRRQFAL 262

Query:   198 XXXXSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSR 257
                    D      +   G   T RD   PDLCV+CL+Q+YN  F  CGH+CCC  CS +
Sbjct:   263 KRVV---DAAARRAKPVTGG-GTSRDGDTPDLCVVCLDQKYNTAFVECGHMCCCTPCSLQ 318

Query:   258 LTNCPLCRRRIDQVVRTFRH 277
             L  CPLCR RI QV++ +RH
Sbjct:   319 LRTCPLCRERIQQVLKIYRH 338
GO:0005739 "mitochondrion" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
ZFIN|ZDB-GENE-050102-5 mul1a "mitochondrial E3 ubiquitin ligase 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGD5 MUL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NTT6 mul1 "Mitochondrial ubiquitin ligase activator of nfkb 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZ02 MUL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBI8 MUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LH19 MUL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1915600 Mul1 "mitochondrial ubiquitin ligase activator of NFKB 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0035483 Mul1 "Mitochondrial E3 ubiquitin protein ligase 1 homologue" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1309944 Mul1 "mitochondrial E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023653001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (343 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
pfam12483154 pfam12483, GIDE, E3 Ubiquitin ligase 7e-58
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 1e-15
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-07
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 7e-06
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 4e-04
smart0018440 smart00184, RING, Ring finger 7e-04
COG5236 493 COG5236, COG5236, Uncharacterized conserved protei 0.001
>gnl|CDD|221597 pfam12483, GIDE, E3 Ubiquitin ligase Back     alignment and domain information 
 Score =  181 bits (462), Expect = 7e-58
 Identities = 66/153 (43%), Positives = 88/153 (57%), Gaps = 1/153 (0%)

Query: 18  TERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFE 77
            E    + + +GSW + S L+ S  +EVP+YL DGTG V VV         L    + FE
Sbjct: 1   EEVVTTRDSGSGSWRRRSELVASNEREVPFYLRDGTGRVLVVMDPSGAEIELVTVLDRFE 60

Query: 78  ESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKG-PF 136
            S  SL      +  G   LG + I R+LP GT LTVVGEAV+D+ GT+RIQ+P KG PF
Sbjct: 61  PSEGSLFSLLFGFFSGDVTLGYRYIERVLPVGTRLTVVGEAVRDEDGTLRIQKPSKGGPF 120

Query: 137 YVSPKTIDELLENLGKWARWYKYASFGLTIFGA 169
           ++S K+ +EL+E+L   AR   Y S GL + G 
Sbjct: 121 FISTKSEEELIESLASSARTLFYGSIGLGVVGI 153

This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length. There is a single completely conserved residue E that may be functionally important. GIDE is an E3 ubiquitin ligase which is involved in inducing apoptosis. Length = 154
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227561 COG5236, COG5236, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 277
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PF12483160 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 Thi 100.0
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.37
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.27
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 99.25
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.23
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.81
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.67
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.64
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 98.6
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.47
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.36
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.34
PHA02929238 N1R/p28-like protein; Provisional 98.32
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.24
PF1463444 zf-RING_5: zinc-RING finger domain 98.2
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.2
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.1
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.02
PHA02926242 zinc finger-like protein; Provisional 98.01
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.95
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.88
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.85
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.84
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.77
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.76
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.74
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.72
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.56
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.47
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.46
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.36
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.29
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.29
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.18
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.14
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.08
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 96.91
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.82
COG5152259 Uncharacterized conserved protein, contains RING a 96.5
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 96.33
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.29
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.09
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 95.83
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.56
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.51
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 95.49
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 95.47
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.26
PF04641260 Rtf2: Rtf2 RING-finger 94.54
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 94.47
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.26
KOG3002 299 consensus Zn finger protein [General function pred 94.2
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 93.65
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 93.25
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 93.13
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 93.05
KOG0825 1134 consensus PHD Zn-finger protein [General function 92.63
KOG0297 391 consensus TNF receptor-associated factor [Signal t 92.04
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.73
KOG3039303 consensus Uncharacterized conserved protein [Funct 90.58
KOG2113394 consensus Predicted RNA binding protein, contains 89.75
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 89.72
KOG1002 791 consensus Nucleotide excision repair protein RAD16 88.91
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 86.66
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 86.1
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 85.11
COG5175 480 MOT2 Transcriptional repressor [Transcription] 83.69
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 83.48
PF10272358 Tmpp129: Putative transmembrane protein precursor; 82.38
COG52191525 Uncharacterized conserved protein, contains RING Z 82.3
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-49  Score=358.95  Aligned_cols=275  Identities=34%  Similarity=0.580  Sum_probs=255.2

Q ss_pred             cccccccceeeeecceeEEEEEEeCCCCccccchhheeccccEeeEEEeCCCeE----EEEeCCCCcccceeeeeeeEee
Q 023757            2 RSFLRQSRVSINSRSWTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGC----VFVVGARGATGFALTVGSEVFE   77 (277)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~eh~~~~~~~~~W~~~~~~~~~~~~~vPf~L~d~~~~----V~V~~~~~a~~~~l~~v~~~f~   77 (277)
                      ++-+.+...||++.-|++||++..+..|.|++.+++++...|++||+|.++++.    |+|..++.+..++++++|+.|+
T Consensus        74 ~~~~v~~v~gvv~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~l~~q~~~~~~~~~~s~~~~~~~l~l~~~~d~f~  153 (355)
T KOG1571|consen   74 RSLCVSNVPGVVQALTLEEPKGRRDGGGHWNANSKIFHEGGNEVPFFLRSQTTGFACEVRVSKTLGRLFLPLNVVYDLFE  153 (355)
T ss_pred             HHhhcccCCceEEEeeeccceeeeccceeeccceeeccCCCcccceeeccCCcceeeeeeeecceeeeeecceeeecccc
Confidence            456778899999999999999998899999999999999999999999999887    9999999999999999999999


Q ss_pred             cCc-ccccccccccccceeeeeeeeeecccCCCceEEEEEEEEeCCCCCeEEeCCCCCCeEEecCChHHHHHHhhhhHHH
Q 023757           78 ESG-RSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARW  156 (277)
Q Consensus        78 ~~~-~~~~~~~~~~~~g~~~~G~~~~E~vL~~G~~lt~vGe~~~d~~g~~~iq~P~~g~f~ls~~s~~~Ll~~l~s~~r~  156 (277)
                      |+. .++.++.++|++|.++.|++++|++||+|+.+|++||++.|+.++.++|+|.+|++|+....+|+||.+++.+++.
T Consensus       154 ~s~p~s~~~~~~~~~sg~~~~~~~~~~~~l~~~~~~t~l~e~v~d~~~~~r~~~~~~g~~~v~~s~~d~LIsr~g~~s~~  233 (355)
T KOG1571|consen  154 PSDPCSLVDVGGGYHSGVRRGGFRETERVLPLGTRLTALGELVRDGYCGVRVQPPMQGPLYVTKSAADRLISREGDLSFF  233 (355)
T ss_pred             ccCcceeeecccccccceeeecccceEEeeccccceeeeehheecCCCceEecCCccCcceeeccchhhHHHhhccceee
Confidence            998 7999999999999999999999999999999999999999988999999999996555555599999999999999


Q ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHhhhhhccCCCCCCCCCCCCCcccCCcccccccccc
Q 023757          157 YKYASFGLTIFGAFLIAKRVIRCILQ--RKRRWELRRRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICL  234 (277)
Q Consensus       157 ~~~~si~~~~vGv~ll~~~~~r~~~~--~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~iC~  234 (277)
                      .++.++++++.+++++.+...++|.+  +++++++.++...++. .+.+..+.+.++.-++++++.+.+...+++|+||.
T Consensus       234 ~kv~~~~~~~~~~ills~~~~d~~led~r~~r~~l~k~~~~~~~-~rae~~s~g~~gtr~~~~~~~~~~~~~p~lcVVcl  312 (355)
T KOG1571|consen  234 VKVNGMVFGTLGVILLSFIVKDNYLEDDRRQRRELVKRVEDLAT-VRAELLSRGVRGTRIQNENGTFRELPQPDLCVVCL  312 (355)
T ss_pred             eeecceeeeeeeEEeehHHHHHHHHHHHHHHHHHHHHhhhhhhh-heeeeecccccccccccccCcccccCCCCceEEec
Confidence            99999999999999999999999988  8888888888888877 77777777777776777777777778889999999


Q ss_pred             ccccceEEecCCCcccCccchhcCCCCccccccccceeecccC
Q 023757          235 EQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH  277 (277)
Q Consensus       235 ~~~~~~~~~pCgH~~~C~~C~~~l~~CPiCR~~i~~~~~~f~~  277 (277)
                      +++.+++|+||||+|||..|+..++.||+||+.|..++++|+|
T Consensus       313 ~e~~~~~fvpcGh~ccct~cs~~l~~CPvCR~rI~~~~k~y~~  355 (355)
T KOG1571|consen  313 DEPKSAVFVPCGHVCCCTLCSKHLPQCPVCRQRIRLVRKRYRS  355 (355)
T ss_pred             CCccceeeecCCcEEEchHHHhhCCCCchhHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999987

>PF12483 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
2yhn_A79 The Idol-Ube2d Complex Mediates Sterol-Dependent De 9e-10
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 4e-08
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 3e-07
4ic2_A74 Crystal Structure Of The Xiap Ring Domain Length = 2e-05
4ic3_A74 Crystal Structure Of The F495l Mutant Xiap Ring Dom 2e-05
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 2e-05
4auq_B62 Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 3e-04
>pdb|2YHN|A Chain A, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 79 Back     alignment and structure 
Iteration: 1

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 33/47 (70%)
Query: 229 LCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTF 275
           LC++C E+E N+ F PCGH  CC  C+++L +CP+CR R++ V   +
Sbjct: 20  LCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVY 66
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 3e-22
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 1e-21
2ea5_A68 Cell growth regulator with ring finger domain prot 3e-21
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 4e-19
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 6e-17
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 1e-16
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 4e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 5e-07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 6e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 6e-06
1z6u_A150 NP95-like ring finger protein isoform B; structura 5e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 5e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 5e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 3e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 4e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 5e-04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 6e-04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 6e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 7e-04
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 86.7 bits (215), Expect = 3e-22
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 208 GTNGQAENGSDSTQRDRVMPD--LCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCR 265
           G++G  +    + ++ R + +  LC IC+++    VF PCGHL  C  C+  +  CP+C 
Sbjct: 4   GSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCY 63

Query: 266 RRIDQVVRTF 275
             I    + F
Sbjct: 64  TVITFKQKIF 73
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
2ea5_A68 Cell growth regulator with ring finger domain prot 99.55
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.44
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.37
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.34
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.3
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.28
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.89
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.86
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.82
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.82
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.81
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.74
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.73
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.71
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.7
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.69
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.69
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.69
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.68
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.66
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.66
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.66
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.65
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.65
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.64
2ect_A78 Ring finger protein 126; metal binding protein, st 98.64
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.62
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.58
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.57
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.57
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.57
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.56
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.53
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.51
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.51
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.5
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.49
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.45
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.43
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.43
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.4
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.39
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.38
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.34
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.33
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.33
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.3
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.24
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.22
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.21
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.2
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.18
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.17
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.15
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.09
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.08
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.08
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.93
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.88
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.86
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.7
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.69
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.52
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.47
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.43
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.19
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 96.82
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 95.85
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 93.54
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 93.19
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 85.9
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 82.23
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 80.7
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.55  E-value=1.8e-15  Score=107.88  Aligned_cols=55  Identities=27%  Similarity=0.664  Sum_probs=50.0

Q ss_pred             CCccccccccccccccceEEecCCCcccCccchhcCCCCccccccccceeecccC
Q 023757          223 DRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH  277 (277)
Q Consensus       223 ~~~~~~~C~iC~~~~~~~~~~pCgH~~~C~~C~~~l~~CPiCR~~i~~~~~~f~~  277 (277)
                      ...+...|+||++++++++++||||+++|..|+..+..||+||++|...+++|++
T Consensus        11 ~~~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~~   65 (68)
T 2ea5_A           11 SEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSGP   65 (68)
T ss_dssp             SCCCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCSS
T ss_pred             cCCCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeecC
Confidence            3444568999999999999999999988999999999999999999999999964
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 277
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-10
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-05
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-05
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.2 bits (130), Expect = 1e-10
 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 4/48 (8%)

Query: 228 DLCVICLEQEYNAVFFPCGHLCCC----LICSSRLTNCPLCRRRIDQV 271
            LC IC E + +    PCGHL C         S    CP CR  I   
Sbjct: 24  QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGT 71
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.88
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.81
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.65
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.59
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.47
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.43
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.42
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.41
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.35
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.31
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.19
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.16
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.97
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.75
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.66
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.77
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.97  E-value=6.7e-11  Score=84.73  Aligned_cols=47  Identities=36%  Similarity=0.857  Sum_probs=40.7

Q ss_pred             cccccccccccceEEecCCCcccCccchhcC-----CCCccccccccceeecc
Q 023757          228 DLCVICLEQEYNAVFFPCGHLCCCLICSSRL-----TNCPLCRRRIDQVVRTF  275 (277)
Q Consensus       228 ~~C~iC~~~~~~~~~~pCgH~~~C~~C~~~l-----~~CPiCR~~i~~~~~~f  275 (277)
                      ..|.||++...+++++||||.+ |..|+...     .+||+||..|.....+.
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~f-C~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~   75 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHLM-CTSCLTSWQESEGQGCPFCRCEIKGTEPIV   75 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCEE-CHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred             CCCccCCCcCCCeEEeCCCCee-eHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence            4799999999999999999998 99998652     57999999999866543
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure