Citrus Sinensis ID: 023805

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MDGFIPSQAAGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLESSLPNTFNSNLQSSLTVTTRSRSNGKLPCREETSRKSPPISLGYQRSAVPYTRTSLGKMTESVKNLLCKSQGSQPLNTLLKHSHSLLR
ccccccccccccccEEEEEEccccccccccccEEEEEEEEEEEccEEEEccEEEEcccccccccccccccccccccHHHHHccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHcc
cccccccccccccEEEEEEEEcccccccccccEEEEEEEEEEEccccEEEEEEEEEEccccccccccccEEEccccHHHHcccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHccccccccccHHcHHHHHHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccccccccccccccccEcccccccccccccccccccccHHcccccccHHHHHHHHHHHHHc
mdgfipsqaagtAEIVFFdlettvprragqrfWVLEFGAIIVCPRKLVELEsfstlikpkdlsAVALkssrcdgitreavesapefeEVADKIFSILNGrvwaghnirrfDCARIKEAFAeigkpapvpvgmidslGVLTEKFGRRAGNMKMATLASYFglgqqkhrsldDVRMNLEVLKHCATVLFlesslpntfnsnlQSSLTVTtrsrsngklpcreetsrksppislgyqrsavpytrtsLGKMTESVKNLLCksqgsqplntllkhshsllr
mdgfipsqaagtaeivffDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFStlikpkdlsavalKSSRCDGITReavesapefeeVADKIFSILNGRVWAGHNIRRFDCARIKEAFAeigkpapvpvgmIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLesslpntfnsnlqssltvttrsrsngklpcreetsrksppislgyqrsaVPYTRTSLGKMTESVKNLLCksqgsqplntllkhshsllr
MDGFIPSQAAGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLESSLPNTFNSNLQSSLTVTTRSRSNGKLPCREETSRKSPPISLGYQRSAVPYTRTSLGKMTESVKNLLCKSQGSQPLNTLLKHSHSLLR
*********AGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLESSL*************************************************************************************
*********AGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLESSLPNTF***********************************GYQRSAVPYT*T**************************KHSHSL**
MDGFIPSQAAGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLESSLPNTFNSNLQS*************************PISLGYQRSAVPYTRTSLGKMTESVKNLLCKSQGSQPLNTLLKHSHSLLR
***********TAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLESSLPNTFNSNLQ**********************************S*V***R*SLGKMTESVKNLLCKSQGSQPLNTLLKHSHSLLR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGFIPSQAAGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLESSLPNTFNSNLQSSLTVTTRSRSNGKLPCREETSRKSPPISLGYQRSAVPYTRTSLGKMTESVKNLLCKSQGSQPLNTLLKHSHSLLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query277 2.2.26 [Sep-21-2011]
Q8RA32 1401 DNA polymerase III PolC-t yes no 0.588 0.116 0.281 2e-08
Q8XJR3 1449 DNA polymerase III PolC-t yes no 0.566 0.108 0.285 4e-08
Q10384 645 Uncharacterized protein R yes no 0.624 0.268 0.279 4e-06
P47729 1435 DNA polymerase III PolC-t yes no 0.364 0.070 0.314 8e-05
O83649215 DNA polymerase III subuni yes no 0.555 0.716 0.268 0.0001
A5IJJ8 1367 DNA polymerase III PolC-t yes no 0.555 0.112 0.277 0.0002
P54394 931 Probable ATP-dependent he yes no 0.379 0.112 0.269 0.0002
Q9ZHF6 1367 DNA polymerase III PolC-t yes no 0.559 0.113 0.287 0.0003
>sp|Q8RA32|DPO3_THETN DNA polymerase III PolC-type OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=polC PE=3 SV=1 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 83/174 (47%), Gaps = 11/174 (6%)

Query: 7   SQAAGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVA 66
           S+A+   E V FD+ETT          ++E GA+ +  +K+V+  +F T + P+    ++
Sbjct: 380 SEASLEGEFVVFDIETTGLSNINDE--IIEIGAVKIKNKKIVD--TFETFVNPQ--IPIS 433

Query: 67  LKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPA 126
              ++  GI    V+ AP  EEV  K      G V   HN   FD + IK    ++G   
Sbjct: 434 SFITKLTGIDESMVKDAPLIEEVLPKFLEFAKGAVLVAHN-ANFDVSFIKSKAKKLG--L 490

Query: 127 PVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLG-QQKHRSLDDVRMNLEVL 179
            V   ++D+L  L+    +   N K+ TLA +F +     HR+++D +   E+ 
Sbjct: 491 TVENTVLDTLE-LSRHLYQDLKNYKLDTLAEFFEVKLLHHHRAVEDAKATAEIF 543
Required for replicative DNA synthesis. This DNA polymerase also exhibits 3' to 5' exonuclease activity.
Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (taxid: 273068)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 7
>sp|Q8XJR3|DPO3_CLOPE DNA polymerase III PolC-type OS=Clostridium perfringens (strain 13 / Type A) GN=polC PE=3 SV=1 Back     alignment and function description
>sp|Q10384|Y2191_MYCTU Uncharacterized protein Rv2191/MT2247 OS=Mycobacterium tuberculosis GN=Rv2191 PE=4 SV=1 Back     alignment and function description
>sp|P47729|DPO3_MYCPU DNA polymerase III PolC-type OS=Mycoplasma pulmonis (strain UAB CTIP) GN=polC PE=3 SV=2 Back     alignment and function description
>sp|O83649|DPO3E_TREPA DNA polymerase III subunit epsilon OS=Treponema pallidum (strain Nichols) GN=dnaQ PE=3 SV=1 Back     alignment and function description
>sp|A5IJJ8|DPO3_THEP1 DNA polymerase III PolC-type OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=polC PE=3 SV=1 Back     alignment and function description
>sp|P54394|DING_BACSU Probable ATP-dependent helicase DinG homolog OS=Bacillus subtilis (strain 168) GN=dinG PE=3 SV=1 Back     alignment and function description
>sp|Q9ZHF6|DPO3_THEMA DNA polymerase III PolC-type OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=polC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
296082445303 unnamed protein product [Vitis vinifera] 0.996 0.910 0.730 1e-121
356528495276 PREDICTED: uncharacterized protein LOC10 0.949 0.952 0.799 1e-118
356511111276 PREDICTED: uncharacterized protein LOC10 0.949 0.952 0.795 1e-117
357519533281 DNA polymerase III polC-type [Medicago t 0.949 0.935 0.756 1e-114
147791948293 hypothetical protein VITISV_013817 [Viti 0.938 0.887 0.781 1e-113
224083745244 predicted protein [Populus trichocarpa] 0.870 0.987 0.801 1e-111
449451459269 PREDICTED: DNA polymerase III PolC-type- 0.924 0.951 0.752 1e-107
224096223231 predicted protein [Populus trichocarpa] 0.801 0.961 0.833 1e-105
240256240255 exonuclease/ nucleic acid binding protei 0.891 0.968 0.662 2e-94
297802094227 predicted protein [Arabidopsis lyrata su 0.790 0.964 0.677 9e-85
>gi|296082445|emb|CBI21450.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 237/304 (77%), Gaps = 28/304 (9%)

Query: 1   MDGFIPSQAAGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPK 60
           MD    S     AEIVFFDLETTVP RAGQRFWVLEFGAI+VCPRKLVELES+STLI+P 
Sbjct: 1   MDSSDDSSQERAAEIVFFDLETTVPNRAGQRFWVLEFGAIVVCPRKLVELESYSTLIRPG 60

Query: 61  DLSAVALKSSRCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFA 120
           DLSAVAL+S R DGITRE V  AP FEEVAD+IFSILNGRVWAGHNI+RFDC RIKEAFA
Sbjct: 61  DLSAVALRSGRSDGITREVVAGAPGFEEVADQIFSILNGRVWAGHNIQRFDCVRIKEAFA 120

Query: 121 EIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLK 180
           EIG+ APVPVGMIDSLGVLTEKFGRRAGNMKMATLA+YFGLGQQKHRSLDDVRMNLEVLK
Sbjct: 121 EIGRAAPVPVGMIDSLGVLTEKFGRRAGNMKMATLATYFGLGQQKHRSLDDVRMNLEVLK 180

Query: 181 HCATVLFLESSLPNTFNSNLQSSLTVTTRSRSNGKLPCREETSRKSPPISLGYQRSAVPY 240
           HCATVLFLESSLP+  +     S T+TTRSRSNGKL CREE+SRKSP  SLGYQR AVPY
Sbjct: 181 HCATVLFLESSLPSVLSGKWHDSTTITTRSRSNGKLMCREESSRKSPTTSLGYQR-AVPY 239

Query: 241 TRTSLGK---------------------------MTESVKNLLCKSQGSQPLNTLLKHSH 273
            R  LGK                           MTE VKNLLCK++    LN +LKHSH
Sbjct: 240 ARGGLGKVSSFPFSLLKNLHGYLSMPLTNNKSKQMTERVKNLLCKAREKPALNNILKHSH 299

Query: 274 SLLR 277
           SLLR
Sbjct: 300 SLLR 303

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356528495|ref|XP_003532838.1| PREDICTED: uncharacterized protein LOC100791906 [Glycine max] Back     alignment and taxonomy information
>gi|356511111|ref|XP_003524273.1| PREDICTED: uncharacterized protein LOC100805245 [Glycine max] Back     alignment and taxonomy information
>gi|357519533|ref|XP_003630055.1| DNA polymerase III polC-type [Medicago truncatula] gi|355524077|gb|AET04531.1| DNA polymerase III polC-type [Medicago truncatula] Back     alignment and taxonomy information
>gi|147791948|emb|CAN61478.1| hypothetical protein VITISV_013817 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224083745|ref|XP_002307108.1| predicted protein [Populus trichocarpa] gi|222856557|gb|EEE94104.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449451459|ref|XP_004143479.1| PREDICTED: DNA polymerase III PolC-type-like [Cucumis sativus] gi|449504833|ref|XP_004162307.1| PREDICTED: DNA polymerase III PolC-type-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224096223|ref|XP_002310581.1| predicted protein [Populus trichocarpa] gi|222853484|gb|EEE91031.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|240256240|ref|NP_195691.4| exonuclease/ nucleic acid binding protein [Arabidopsis thaliana] gi|332661722|gb|AEE87122.1| exonuclease/ nucleic acid binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297802094|ref|XP_002868931.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314767|gb|EFH45190.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
TAIR|locus:2135302255 AT4G39810 [Arabidopsis thalian 0.743 0.807 0.723 1.5e-89
TAIR|locus:2160359 468 AT5G07710 [Arabidopsis thalian 0.837 0.495 0.594 5.6e-68
TAIR|locus:2163208 487 AT5G61390 [Arabidopsis thalian 0.787 0.447 0.577 3.6e-66
TAIR|locus:2019100 506 AT1G74390 [Arabidopsis thalian 0.779 0.426 0.604 3.2e-65
TIGR_CMR|CJE_0502233 CJE_0502 "exonuclease, DNA pol 0.537 0.639 0.275 2.1e-08
UNIPROTKB|Q9KPX9247 VC_2233 "DNA polymerase III, e 0.703 0.789 0.259 2e-06
TIGR_CMR|VC_2233247 VC_2233 "DNA polymerase III, e 0.703 0.789 0.259 2e-06
TIGR_CMR|BA_3672315 BA_3672 "DNA polymerase III, e 0.588 0.517 0.267 3e-06
UNIPROTKB|Q10384 645 MT2247 "Uncharacterized protei 0.570 0.244 0.288 4.8e-06
TIGR_CMR|CHY_1772 1407 CHY_1772 "DNA polymerase III, 0.588 0.115 0.274 1.3e-05
TAIR|locus:2135302 AT4G39810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 776 (278.2 bits), Expect = 1.5e-89, Sum P(2) = 1.5e-89
 Identities = 149/206 (72%), Positives = 174/206 (84%)

Query:    14 EIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCD 73
             EIVFFDLET VP +AGQ F +LEFGAIIVCP+KL ELESF+TLI+PKDLS V+++SSR D
Sbjct:     9 EIVFFDLETNVPNKAGQHFHILEFGAIIVCPKKLEELESFTTLIQPKDLSVVSIRSSRSD 68

Query:    74 GITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMI 133
             GITR  V +AP FE+VA+KI  +LNGR+WAGHNIRRFDC RIKEAFAEIGK AP P G+I
Sbjct:    69 GITRAKVTNAPSFEDVAEKIHGLLNGRIWAGHNIRRFDCVRIKEAFAEIGKAAPEPSGII 128

Query:   134 DSLGVLTEKFGRRAGNMKMATLASYFGLGQQKHRSLDDVRMNLEVLKHCATVLFLESSLP 193
             DSLG+L++KFG+RAGNMKMA+LA+YFGLG QKHRSLDDVRMNLEVLKHCATVLFLES+LP
Sbjct:   129 DSLGLLSDKFGKRAGNMKMASLAAYFGLGVQKHRSLDDVRMNLEVLKHCATVLFLESTLP 188

Query:   194 NTFNSNLQSSLTVTTRSRSNGKLPCR 219
             N       +S  + TRSR N ++  R
Sbjct:   189 NHLEGKWHTSSKIMTRSRRNYQIAQR 214
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004527 "exonuclease activity" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
TAIR|locus:2160359 AT5G07710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163208 AT5G61390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019100 AT1G74390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0502 CJE_0502 "exonuclease, DNA polymerase III, epsilon subunit family" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPX9 VC_2233 "DNA polymerase III, epsilon subunit" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2233 VC_2233 "DNA polymerase III, epsilon subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3672 BA_3672 "DNA polymerase III, epsilon subunit, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q10384 MT2247 "Uncharacterized protein Rv2191/MT2247" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1772 CHY_1772 "DNA polymerase III, alpha subunit, Gram-positive type" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.7LOW CONFIDENCE prediction!
4th Layer2.7.7.7LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
smart00479169 smart00479, EXOIII, exonuclease domain in DNA-poly 7e-32
cd06127159 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain fam 2e-27
pfam00929161 pfam00929, RNase_T, Exonuclease 2e-24
COG0847243 COG0847, DnaQ, DNA polymerase III, epsilon subunit 7e-23
PRK06063313 PRK06063, PRK06063, DNA polymerase III subunit eps 3e-15
cd06133176 cd06133, ERI-1_3'hExo_like, DEDDh 3'-5' exonucleas 1e-14
cd06130156 cd06130, DNA_pol_III_epsilon_like, an uncharacteri 8e-14
PRK00448 1437 PRK00448, polC, DNA polymerase III PolC; Validated 2e-13
PRK07883 557 PRK07883, PRK07883, hypothetical protein; Validate 2e-13
TIGR01405 1213 TIGR01405, polC_Gram_pos, DNA polymerase III, alph 1e-12
TIGR00573217 TIGR00573, dnaq, exonuclease, DNA polymerase III, 1e-10
COG2176 1444 COG2176, PolC, DNA polymerase III, alpha subunit ( 1e-10
TIGR01407 850 TIGR01407, dinG_rel, DnaQ family exonuclease/DinG 1e-09
PRK08074 928 PRK08074, PRK08074, bifunctional ATP-dependent DNA 1e-09
PRK06807313 PRK06807, PRK06807, DNA polymerase III subunit eps 6e-09
cd06131167 cd06131, DNA_pol_III_epsilon_Ecoli_like, DEDDh 3'- 4e-08
PRK07740244 PRK07740, PRK07740, hypothetical protein; Provisio 1e-06
PRK08517257 PRK08517, PRK08517, DNA polymerase III subunit eps 2e-06
PRK07247195 PRK07247, PRK07247, DNA polymerase III subunit eps 3e-06
PRK06310250 PRK06310, PRK06310, DNA polymerase III subunit eps 4e-06
TIGR01406225 TIGR01406, dnaQ_proteo, DNA polymerase III, epsilo 3e-05
COG5018210 COG5018, KapD, Inhibitor of the KinA pathway to sp 2e-04
PRK06309232 PRK06309, PRK06309, DNA polymerase III subunit eps 3e-04
PRK07246 820 PRK07246, PRK07246, bifunctional ATP-dependent DNA 8e-04
PRK05711240 PRK05711, PRK05711, DNA polymerase III subunit eps 0.003
>gnl|CDD|214685 smart00479, EXOIII, exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information 
 Score =  115 bits (290), Expect = 7e-32
 Identities = 47/177 (26%), Positives = 76/177 (42%), Gaps = 11/177 (6%)

Query: 14  EIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKP-KDLSAVALKSSRC 72
            +V  D ETT          ++E  A+ V   +++E   F T +KP + ++  A +    
Sbjct: 1   TLVVIDCETTGLDPGKDE--IIEIAAVDVDGGEIIE--VFDTYVKPDRPITDYATEIH-- 54

Query: 73  DGITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGM 132
            GIT E ++ AP FEEV +++   L GR+    N   FD   +K     +G   P  + +
Sbjct: 55  -GITPEMLDDAPTFEEVLEELLEFLRGRILVAGNSAHFDLRFLKLEHPRLGIKQPPKLPV 113

Query: 133 IDSLGVLTEKFGRRAGNMKMATLASYFGLGQQK--HRSLDDVRMNLEVLKHCATVLF 187
           ID+L +             +  LA    L   +  HR+LDD R   ++ K     L 
Sbjct: 114 IDTLKLARATNPGL-PKYSLKKLAKRLLLEVIQRAHRALDDARATAKLFKKLLERLE 169

Length = 169
>gnl|CDD|176648 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>gnl|CDD|216200 pfam00929, RNase_T, Exonuclease Back     alignment and domain information
>gnl|CDD|223916 COG0847, DnaQ, DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|180377 PRK06063, PRK06063, DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|99836 cd06133, ERI-1_3'hExo_like, DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins Back     alignment and domain information
>gnl|CDD|99834 cd06130, DNA_pol_III_epsilon_like, an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III Back     alignment and domain information
>gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|236123 PRK07883, PRK07883, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|233397 TIGR01405, polC_Gram_pos, DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>gnl|CDD|129663 TIGR00573, dnaq, exonuclease, DNA polymerase III, epsilon subunit family Back     alignment and domain information
>gnl|CDD|225087 COG2176, PolC, DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233398 TIGR01407, dinG_rel, DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>gnl|CDD|236148 PRK08074, PRK08074, bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|235864 PRK06807, PRK06807, DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|99835 cd06131, DNA_pol_III_epsilon_Ecoli_like, DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins Back     alignment and domain information
>gnl|CDD|236085 PRK07740, PRK07740, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236281 PRK08517, PRK08517, DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|180906 PRK07247, PRK07247, DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|180525 PRK06310, PRK06310, DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|130473 TIGR01406, dnaQ_proteo, DNA polymerase III, epsilon subunit, Proteobacterial Back     alignment and domain information
>gnl|CDD|227351 COG5018, KapD, Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only] Back     alignment and domain information
>gnl|CDD|180524 PRK06309, PRK06309, DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|180905 PRK07246, PRK07246, bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|235574 PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 277
PRK09146239 DNA polymerase III subunit epsilon; Validated 100.0
PRK06063313 DNA polymerase III subunit epsilon; Provisional 99.98
PRK05711240 DNA polymerase III subunit epsilon; Provisional 99.98
TIGR01406225 dnaQ_proteo DNA polymerase III, epsilon subunit, P 99.97
smart00479169 EXOIII exonuclease domain in DNA-polymerase alpha 99.97
PRK07740244 hypothetical protein; Provisional 99.97
PRK09145202 DNA polymerase III subunit epsilon; Validated 99.97
PRK07748207 sporulation inhibitor KapD; Provisional 99.97
TIGR00573217 dnaq exonuclease, DNA polymerase III, epsilon subu 99.97
PRK06310250 DNA polymerase III subunit epsilon; Validated 99.97
PRK07942232 DNA polymerase III subunit epsilon; Provisional 99.97
cd06131167 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl 99.97
cd06130156 DNA_pol_III_epsilon_like an uncharacterized bacter 99.97
PRK08517257 DNA polymerase III subunit epsilon; Provisional 99.97
PRK06807313 DNA polymerase III subunit epsilon; Validated 99.97
PRK06195309 DNA polymerase III subunit epsilon; Validated 99.97
PRK06309232 DNA polymerase III subunit epsilon; Validated 99.97
PRK07247195 DNA polymerase III subunit epsilon; Validated 99.97
PRK06722281 exonuclease; Provisional 99.97
cd06136177 TREX1_2 DEDDh 3'-5' exonuclease domain of three pr 99.96
PRK07883 557 hypothetical protein; Validated 99.96
PRK05168211 ribonuclease T; Provisional 99.96
cd06133176 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain o 99.96
TIGR01298200 RNaseT ribonuclease T. in gamma-subdivision Proteo 99.96
cd06134189 RNaseT DEDDh 3'-5' exonuclease domain of RNase T. 99.96
PRK05601377 DNA polymerase III subunit epsilon; Validated 99.96
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.96
cd06138183 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain o 99.95
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-posit 99.95
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.95
PTZ00315 582 2'-phosphotransferase; Provisional 99.95
cd06127159 DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh 99.95
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 99.95
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.95
cd06149157 ISG20 DEDDh 3'-5' exonuclease domain of Interferon 99.94
cd06137161 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the 99.94
PRK07983219 exodeoxyribonuclease X; Provisional 99.94
cd06145150 REX1_like DEDDh 3'-5' exonuclease domain of RNA ex 99.93
cd06144152 REX4_like DEDDh 3'-5' exonuclease domain of RNA ex 99.93
PRK09182294 DNA polymerase III subunit epsilon; Validated 99.93
COG0847243 DnaQ DNA polymerase III, epsilon subunit and relat 99.93
cd06135173 Orn DEDDh 3'-5' exonuclease domain of oligoribonuc 99.93
PRK05359181 oligoribonuclease; Provisional 99.93
PF00929164 RNase_T: Exonuclease; InterPro: IPR013520 This ent 99.92
PRK11779 476 sbcB exonuclease I; Provisional 99.91
PRK00448 1437 polC DNA polymerase III PolC; Validated 99.9
KOG0542280 consensus Predicted exonuclease [Replication, reco 99.87
COG5018210 KapD Inhibitor of the KinA pathway to sporulation, 99.81
KOG2249280 consensus 3'-5' exonuclease [Replication, recombin 99.81
cd06143174 PAN2_exo DEDDh 3'-5' exonuclease domain of the euk 99.68
COG1949184 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA 99.53
KOG3242208 consensus Oligoribonuclease (3'->5' exoribonucleas 99.49
COG2925 475 SbcB Exonuclease I [DNA replication, recombination 99.46
KOG2248380 consensus 3'-5' exonuclease [Replication, recombin 99.45
cd05160199 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain 99.34
cd0612596 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas 99.1
PF13482164 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 98.99
cd06139193 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease 98.94
COG3359278 Predicted exonuclease [DNA replication, recombinat 98.92
cd05780195 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease dom 98.87
cd05781188 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of 98.79
KOG4793318 consensus Three prime repair exonuclease [Replicat 98.74
cd05779204 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domai 98.7
PRK05755 880 DNA polymerase I; Provisional 98.68
cd05785207 DNA_polB_like2_exo Uncharacterized bacterial subgr 98.67
cd05782208 DNA_polB_like1_exo Uncharacterized bacterial subgr 98.48
cd05777230 DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain 98.38
cd05783204 DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of 98.37
PF01612176 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00 98.37
PF10108209 DNA_pol_B_exo2: Predicted 3'-5' exonuclease relate 98.35
cd05784193 DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of 98.33
PHA02570220 dexA exonuclease; Provisional 98.26
PF04857262 CAF1: CAF1 family ribonuclease; InterPro: IPR00694 98.22
cd00007155 35EXOc 3'-5' exonuclease. The 35EXOc domain is res 98.06
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 98.04
cd06129161 RNaseD_like DEDDy 3'-5' exonuclease domain of RNas 97.99
cd06146193 mut-7_like_exo DEDDy 3'-5' exonuclease domain of C 97.88
cd06141170 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and 97.88
TIGR01388 367 rnd ribonuclease D. This model describes ribonucle 97.88
PRK10829 373 ribonuclease D; Provisional 97.83
COG0349 361 Rnd Ribonuclease D [Translation, ribosomal structu 97.79
cd06140178 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' 97.78
PRK05762 786 DNA polymerase II; Reviewed 97.73
cd05778231 DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease 97.65
PTZ00166 1054 DNA polymerase delta catalytic subunit; Provisiona 97.63
smart00474172 35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proo 97.58
PHA02528 881 43 DNA polymerase; Provisional 97.51
COG0749 593 PolA DNA polymerase I - 3'-5' exonuclease and poly 97.5
KOG0304239 consensus mRNA deadenylase subunit [RNA processing 97.45
smart00486 471 POLBc DNA polymerase type-B family. DNA polymerase 97.37
cd06148197 Egl_like_exo DEDDy 3'-5' exonuclease domain of Dro 97.34
TIGR03491457 RecB family nuclease, putative, TM0106 family. Mem 97.32
cd06142178 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribon 97.21
cd05776234 DNA_polB_alpha_exo inactive DEDDy 3'-5' exonucleas 97.06
PF03104325 DNA_pol_B_exo1: DNA polymerase family B, exonuclea 97.04
cd06147192 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of y 96.26
cd09018150 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease 96.24
TIGR00593 887 pola DNA polymerase I. This family is based on the 96.1
PHA02524498 43A DNA polymerase subunit A; Provisional 96.09
KOG1798 2173 consensus DNA polymerase epsilon, catalytic subuni 95.95
TIGR00592 1172 pol2 DNA polymerase (pol2). This family is based o 95.69
COG0417 792 PolB DNA polymerase elongation subunit (family B) 95.09
PHA03036 1004 DNA polymerase; Provisional 94.82
cd06128151 DNA_polA_exo DEDDy 3'-5' exonuclease domain of fam 94.71
PRK05761 787 DNA polymerase I; Reviewed 94.36
PHA02563 630 DNA polymerase; Provisional 91.25
KOG4793318 consensus Three prime repair exonuclease [Replicat 91.2
COG5228299 POP2 mRNA deadenylase subunit [RNA processing and 88.31
PF00843533 Arena_nucleocap: Arenavirus nucleocapsid protein; 81.73
>PRK09146 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information 
Probab=100.00  E-value=4e-31  Score=231.54  Aligned_cols=177  Identities=19%  Similarity=0.285  Sum_probs=154.4

Q ss_pred             CCCCCCCCcEEEEEeccCCCCCCCCCCceEEEEEEEEECCeeeeeceEEEeecCCCCCCCCchhhhhcCCCHHHHhCCCC
Q 023805            6 PSQAAGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPE   85 (277)
Q Consensus         6 ~~~~~~~~~~v~~D~ETTg~~~~~~~~~IieIg~v~v~~~~~~~~~sf~~~v~P~~~~~i~~~~~~~~GIt~e~l~~a~~   85 (277)
                      ...+.....|++||+||||+++  ..++|||||+|.++++.+...++|+++|+|..  ++++.+.++||||+++++++++
T Consensus        40 ~~~~~~~~~~vviD~ETTGl~p--~~d~IieIg~v~v~~~~i~~~~~~~~li~P~~--~i~~~~~~IhGIt~e~l~~ap~  115 (239)
T PRK09146         40 PDTPLSEVPFVALDFETTGLDA--EQDAIVSIGLVPFTLQRIRCRQARHWVVKPRR--PLEEESVVIHGITHSELQDAPD  115 (239)
T ss_pred             CCCCcccCCEEEEEeECCCCCC--CCCcEEEEEEEEEECCeEeecceEEEEECCCC--CCChhhhhhcCCCHHHHhCCCC
Confidence            3446667899999999999998  67899999999999987665688999999998  8999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCCEEEEeCCchhHHHHHHHHHHHhCC-CCCCCCceeehHHHHHHHhCC------------CCCCCCH
Q 023805           86 FEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGK-PAPVPVGMIDSLGVLTEKFGR------------RAGNMKM  152 (277)
Q Consensus        86 f~ev~~~l~~~l~~~~lv~hn~~~fD~~~L~~~~~~~g~-~~p~~~~~iDt~~l~~~~~~~------------~~~~~~L  152 (277)
                      |.+++.+|.+++++.++||||+ .||+.||++++.+++. ..+.  .++||+.++.+.+..            ...+++|
T Consensus       116 ~~evl~~l~~~~~~~~lVaHna-~FD~~fL~~~l~~~~~~~~~~--~~iDTl~Lar~l~~~~~~~~~~~~~~~~~~~~~L  192 (239)
T PRK09146        116 LERILDELLEALAGKVVVVHYR-RIERDFLDQALRNRIGEGIEF--PVIDTMEIEARIQRKQAGGLWNRLKGKKPESIRL  192 (239)
T ss_pred             HHHHHHHHHHHhCCCEEEEECH-HHHHHHHHHHHHHhcCCCCCC--ceechHHHHHHHcccccccccchhccCCCCCCCH
Confidence            9999999999999999999999 9999999999987543 3333  489999988765421            1267899


Q ss_pred             HHHHHHhCCC-CCCCChHHHHHHHHHHHHHHHHhhhcc
Q 023805          153 ATLASYFGLG-QQKHRSLDDVRMNLEVLKHCATVLFLE  189 (277)
Q Consensus       153 ~~La~~~gi~-~~~H~Al~DA~~t~~l~~~l~~~l~~~  189 (277)
                      ++++++||++ ..+|+|++||.+|++|+.+++.+.+.+
T Consensus       193 ~~l~~~~gl~~~~~H~Al~DA~ata~l~~~~~~~~~~~  230 (239)
T PRK09146        193 ADSRLRYGLPAYSPHHALTDAIATAELLQAQIAHHFSP  230 (239)
T ss_pred             HHHHHHcCCCCCCCCCcHHHHHHHHHHHHHHHHHHcCC
Confidence            9999999999 689999999999999999999887653

>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK05711 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial Back     alignment and domain information
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>PRK07740 hypothetical protein; Provisional Back     alignment and domain information
>PRK09145 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07748 sporulation inhibitor KapD; Provisional Back     alignment and domain information
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family Back     alignment and domain information
>PRK06310 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07942 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins Back     alignment and domain information
>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III Back     alignment and domain information
>PRK08517 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK06807 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06309 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07247 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06722 exonuclease; Provisional Back     alignment and domain information
>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>PRK05168 ribonuclease T; Provisional Back     alignment and domain information
>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins Back     alignment and domain information
>TIGR01298 RNaseT ribonuclease T Back     alignment and domain information
>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T Back     alignment and domain information
>PRK05601 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PTZ00315 2'-phosphotransferase; Provisional Back     alignment and domain information
>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins Back     alignment and domain information
>PRK07983 exodeoxyribonuclease X; Provisional Back     alignment and domain information
>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins Back     alignment and domain information
>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PRK09182 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information
>cd06135 Orn DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins Back     alignment and domain information
>PRK05359 oligoribonuclease; Provisional Back     alignment and domain information
>PF00929 RNase_T: Exonuclease; InterPro: IPR013520 This entry includes a variety of exonuclease proteins, such as ribonuclease T [] and the epsilon subunit of DNA polymerase III Back     alignment and domain information
>PRK11779 sbcB exonuclease I; Provisional Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>KOG0542 consensus Predicted exonuclease [Replication, recombination and repair] Back     alignment and domain information
>COG5018 KapD Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only] Back     alignment and domain information
>KOG2249 consensus 3'-5' exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2 Back     alignment and domain information
>COG1949 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA processing and modification] Back     alignment and domain information
>KOG3242 consensus Oligoribonuclease (3'->5' exoribonuclease) [RNA processing and modification] Back     alignment and domain information
>COG2925 SbcB Exonuclease I [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2248 consensus 3'-5' exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily Back     alignment and domain information
>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A Back     alignment and domain information
>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases Back     alignment and domain information
>COG3359 Predicted exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>cd05781 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of Sulfurisphaera ohwakuensis DNA polymerase B3 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>KOG4793 consensus Three prime repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd05779 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon, a family-B DNA polymerase Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>cd05782 DNA_polB_like1_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>cd05777 DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase delta, a family-B DNA polymerase Back     alignment and domain information
>cd05783 DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of Sulfolobus solfataricus DNA polymerase B1 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides Back     alignment and domain information
>PF10108 DNA_pol_B_exo2: Predicted 3'-5' exonuclease related to the exonuclease domain of PolB; InterPro: IPR019288 This entry represents various prokaryotic 3'-5' exonucleases and hypothetical proteins Back     alignment and domain information
>cd05784 DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase II and similar bacterial family-B DNA polymerases Back     alignment and domain information
>PHA02570 dexA exonuclease; Provisional Back     alignment and domain information
>PF04857 CAF1: CAF1 family ribonuclease; InterPro: IPR006941 CAF1 is an RNase of the DEDD superfamily, and a subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA deadenylation Back     alignment and domain information
>cd00007 35EXOc 3'-5' exonuclease Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins Back     alignment and domain information
>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins Back     alignment and domain information
>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins Back     alignment and domain information
>TIGR01388 rnd ribonuclease D Back     alignment and domain information
>PRK10829 ribonuclease D; Provisional Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd06140 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases Back     alignment and domain information
>PRK05762 DNA polymerase II; Reviewed Back     alignment and domain information
>cd05778 DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase zeta, a family-B DNA polymerase Back     alignment and domain information
>PTZ00166 DNA polymerase delta catalytic subunit; Provisional Back     alignment and domain information
>smart00474 35EXOc 3'-5' exonuclease Back     alignment and domain information
>PHA02528 43 DNA polymerase; Provisional Back     alignment and domain information
>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0304 consensus mRNA deadenylase subunit [RNA processing and modification] Back     alignment and domain information
>smart00486 POLBc DNA polymerase type-B family Back     alignment and domain information
>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins Back     alignment and domain information
>TIGR03491 RecB family nuclease, putative, TM0106 family Back     alignment and domain information
>cd06142 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins Back     alignment and domain information
>cd05776 DNA_polB_alpha_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha, a family-B DNA polymerase Back     alignment and domain information
>PF03104 DNA_pol_B_exo1: DNA polymerase family B, exonuclease domain Several related DNA polymerases were too dissimilar to be included Back     alignment and domain information
>cd06147 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins Back     alignment and domain information
>cd09018 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins Back     alignment and domain information
>TIGR00593 pola DNA polymerase I Back     alignment and domain information
>PHA02524 43A DNA polymerase subunit A; Provisional Back     alignment and domain information
>KOG1798 consensus DNA polymerase epsilon, catalytic subunit A [Replication, recombination and repair] Back     alignment and domain information
>TIGR00592 pol2 DNA polymerase (pol2) Back     alignment and domain information
>COG0417 PolB DNA polymerase elongation subunit (family B) [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA03036 DNA polymerase; Provisional Back     alignment and domain information
>cd06128 DNA_polA_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases Back     alignment and domain information
>PRK05761 DNA polymerase I; Reviewed Back     alignment and domain information
>PHA02563 DNA polymerase; Provisional Back     alignment and domain information
>KOG4793 consensus Three prime repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>COG5228 POP2 mRNA deadenylase subunit [RNA processing and modification] Back     alignment and domain information
>PF00843 Arena_nucleocap: Arenavirus nucleocapsid protein; InterPro: IPR000229 Arenaviruses are single stranded RNA viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
2p1j_A186 Crystal Structure Of A Polc-Type Dna Polymerase Iii 3e-05
>pdb|2P1J|A Chain A, Crystal Structure Of A Polc-Type Dna Polymerase Iii Exonuclease Domain From Thermotoga Maritima Length = 186 Back     alignment and structure 
Iteration: 1

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 79/173 (45%), Gaps = 17/173 (9%)
Query: 11  GTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSS 70
           G A  V  D ETT      Q   ++E GA+ +   ++V+   + TLIKP     ++ KSS
Sbjct: 10  GDATFVVLDFETT--GLDPQVDEIIEIGAVKIQGGQIVD--EYHTLIKPS--REISRKSS 63
Query: 71  RCDGITREAVESAPEFEEVADKIFSILNGRVWAGHNIR---RFDCARIKEAFAEIGKPAP 127
              GIT+E +E+    EEV  +    L   +   HN     RF    IK+    +G    
Sbjct: 64  EITGITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNANFDYRFLRLWIKKV---MGLDWE 120
Query: 128 VPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLGQ-QKHRSLDDVRMNLEVL 179
            P   ID+L +       R+ ++   ++    GLG  + HR+LDD R+  +V 
Sbjct: 121 RP--YIDTLALAKSLLKLRSYSLD--SVVEKLGLGPFRHHRALDDARVTAQVF 169

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural g 7e-23
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase 2e-22
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; 1e-21
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 2e-20
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specif 9e-20
3cg7_A308 CRN-4, cell death-related nuclease 4; hydrolase, a 6e-18
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase 6e-18
3mxm_B242 Three prime repair exonuclease 1; RNAse H-like fol 6e-18
3u3y_B314 Three prime repair exonuclease 1; RNAse H fold, 3' 7e-16
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas 1e-12
3v9w_A235 Ribonuclease T; DEDD nucleases family, EXO-nucleas 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase 3e-06
2igi_A180 Oligoribonuclease; RNAse, exoribonuclease, exonucl 1e-05
3tr8_A186 Oligoribonuclease; transcription, hydrolase; 2.50A 2e-04
2gbz_A194 Oligoribonuclease; ORN, deddh, structural genomics 3e-04
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Length = 186 Back     alignment and structure
 Score = 91.8 bits (229), Expect = 7e-23
 Identities = 46/173 (26%), Positives = 76/173 (43%), Gaps = 21/173 (12%)

Query: 16  VFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKP-KDLSAVALKSSRCDG 74
           V  D ETT          ++E GA+ +   ++V+   + TLIKP +++S    KSS   G
Sbjct: 15  VVLDFETTGLDPQVDE--IIEIGAVKIQGGQIVD--EYHTLIKPSREISR---KSSEITG 67

Query: 75  ITREAVESAPEFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEI-GKPAPVPVGMI 133
           IT+E +E+    EEV  +    L   +   HN   FD   ++    ++ G     P   I
Sbjct: 68  ITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNA-NFDYRFLRLWIKKVMGLDWERPY--I 124

Query: 134 DSLGVLTEKFGRR---AGNMKMATLASYFGLG-QQKHRSLDDVRMNLEVLKHC 182
           D+L        +      +  + ++    GLG  + HR+LDD R+  +V    
Sbjct: 125 DTL-----ALAKSLLKLRSYSLDSVVEKLGLGPFRHHRALDDARVTAQVFLRF 172
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Length = 204 Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Length = 349 Back     alignment and structure
>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Length = 224 Back     alignment and structure
>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Length = 299 Back     alignment and structure
>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Length = 308 Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Length = 238 Back     alignment and structure
>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Length = 242 Back     alignment and structure
>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Length = 314 Back     alignment and structure
>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5 Length = 224 Back     alignment and structure
>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A Length = 235 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A* Length = 194 Back     alignment and structure
>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A Length = 180 Back     alignment and structure
>3tr8_A Oligoribonuclease; transcription, hydrolase; 2.50A {Coxiella burnetii} Length = 186 Back     alignment and structure
>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, hydrolase; 2.30A {Xanthomonas campestris PV} Length = 194 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural g 100.0
3mxm_B242 Three prime repair exonuclease 1; RNAse H-like fol 99.98
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase 99.98
3u3y_B314 Three prime repair exonuclease 1; RNAse H fold, 3' 99.97
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase 99.97
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase 99.97
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specif 99.97
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas 99.97
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 99.97
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; 99.97
3v9w_A235 Ribonuclease T; DEDD nucleases family, EXO-nucleas 99.96
3cg7_A308 CRN-4, cell death-related nuclease 4; hydrolase, a 99.96
2igi_A180 Oligoribonuclease; RNAse, exoribonuclease, exonucl 99.95
1wlj_A189 Interferon stimulated gene 20KDA; exoribonuclease, 99.95
2gbz_A194 Oligoribonuclease; ORN, deddh, structural genomics 99.94
3tr8_A186 Oligoribonuclease; transcription, hydrolase; 2.50A 99.94
2qxf_A 482 Exodeoxyribonuclease I; alpha-beta domain, DNAQ su 99.94
2kfn_A 605 Klenow fragment of DNA polymerase I; complex (poly 99.23
4hec_A190 Putative uncharacterized protein; ssgcid, structur 99.03
1x9m_A 698 DNA polymerase; DNA ploymerase, N-2-acetylaminoflu 98.92
4gmj_B285 CCR4-NOT transcription complex subunit 7; mRNA dec 98.73
4dfk_A 540 DNA polymerase I, thermostable; DNA polymerase, tr 98.52
1qht_A 775 Protein (DNA polymerase); archaea, hyperthermostab 98.37
2p51_A333 SPCC18.06C protein; DEDD nuclease fold, hydrolase, 98.26
1noy_A388 Protein (DNA polymerase (E.C.2.7.7.7)); exonucleas 98.25
2d5r_A252 CCR4-NOT transcription complex subunit 7; poly(A) 98.23
3pv8_A 592 DNA polymerase I; DNA polymerase I, protein-DNA co 98.22
3iay_A 919 DNA polymerase delta catalytic subunit; protein-DN 98.15
1s5j_A 847 DNA polymerase I; replication, disulfide bonds, tr 98.09
1uoc_A289 POP2; hydrolase, DEDD nuclease, mRNA degradation, 98.04
3saf_A428 Exosome component 10; exoribonuclease, RNA exosome 98.01
1yt3_A 375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 97.83
2gv9_A 1193 DNA polymerase; polymerase alpha fold, transferase 97.64
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, 97.63
3qex_A 903 DNA polymerase, GP43; difluorotoluene nucleoside; 97.63
2e6m_A208 Werner syndrome ATP-dependent helicase homolog; AP 97.62
3k59_A 786 POL II, DNA polymerase II; protein-DNA complex, DN 97.62
3cym_A 440 Uncharacterized protein BAD_0989; structural genom 97.38
1vk0_A206 Hypothetical protein; homohexamer, AT5G06450, stru 97.12
2a1r_A430 Poly(A)-specific ribonuclease PARN; DEDD, nuclease 96.78
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 96.57
2py5_A 575 DNA polymerase; protein-DNA complex, replication, 96.22
1bgx_T 832 TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi 95.99
3q7c_A243 Nucleoprotein; deddh exonuclease, 3' exonuclease, 89.81
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=100.00  E-value=8.2e-33  Score=232.66  Aligned_cols=175  Identities=26%  Similarity=0.382  Sum_probs=148.3

Q ss_pred             CCCCCCCCCcEEEEEeccCCCCCCCCCCceEEEEEEEEECCeeeeeceEEEeecCCCCCCCCchhhhhcCCCHHHHhCCC
Q 023805            5 IPSQAAGTAEIVFFDLETTVPRRAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAP   84 (277)
Q Consensus         5 ~~~~~~~~~~~v~~D~ETTg~~~~~~~~~IieIg~v~v~~~~~~~~~sf~~~v~P~~~~~i~~~~~~~~GIt~e~l~~a~   84 (277)
                      +...+....++++||+||||+++  ..++|||||++.++++.+  ++.|+.+|+|..  .++++++++||||++++++++
T Consensus         4 ~~~~~l~~~~~v~iD~ETTGl~~--~~~~IieIg~v~~~~g~i--~~~f~~lv~P~~--~i~~~~~~i~GIt~~~l~~~~   77 (186)
T 2p1j_A            4 SDDSTFGDATFVVLDFETTGLDP--QVDEIIEIGAVKIQGGQI--VDEYHTLIKPSR--EISRKSSEITGITQEMLENKR   77 (186)
T ss_dssp             ---------CEEEEEEEESCSCT--TTCCEEEEEEEEEETTEE--EEEEEEECBCSS--CCCHHHHHHHCCCHHHHTTCC
T ss_pred             CcCCcCcCCCEEEEEEECCCCCC--CCCeEEEEEEEEEECCEE--EEEEEEEECcCC--CCCHHHhhhcCCCHHHHhcCC
Confidence            34455667899999999999987  567999999999987654  478999999998  799999999999999999999


Q ss_pred             CHHHHHHHHHHHhCCCEEEEeCCchhHHHHHHHHHHHhCCCCCCCCceeehHHHHHHHhCCCCCCCCHHHHHHHhCCC-C
Q 023805           85 EFEEVADKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVPVGMIDSLGVLTEKFGRRAGNMKMATLASYFGLG-Q  163 (277)
Q Consensus        85 ~f~ev~~~l~~~l~~~~lv~hn~~~fD~~~L~~~~~~~g~~~p~~~~~iDt~~l~~~~~~~~~~~~~L~~La~~~gi~-~  163 (277)
                      +|.+++.+|.+|+++.++||||+ .||+.+|+.++.++|++.+. ..++|++.++...+  ..++++|+.|+++||++ .
T Consensus        78 ~~~~v~~~~~~~l~~~~lv~hn~-~fD~~~L~~~~~~~g~~~~~-~~~iDt~~l~~~~~--~~~~~~L~~l~~~~gi~~~  153 (186)
T 2p1j_A           78 SIEEVLPEFLGFLEDSIIVAHNA-NFDYRFLRLWIKKVMGLDWE-RPYIDTLALAKSLL--KLRSYSLDSVVEKLGLGPF  153 (186)
T ss_dssp             BHHHHHHHHHHHSSSCEEEETTH-HHHHHHHHHHHHHHHCCCCC-CCEEEHHHHHHHHT--CCSCCSHHHHHHHTTCCST
T ss_pred             CHHHHHHHHHHHHCCCEEEEECc-HHHHHHHHHHHHHcCCCCCC-CCEEeHHHHHHHHh--hcCCCCHHHHHHHcCCCCC
Confidence            99999999999999999999999 99999999999999998643 35999998876655  55689999999999998 6


Q ss_pred             CCCChHHHHHHHHHHHHHHHHhhhcc
Q 023805          164 QKHRSLDDVRMNLEVLKHCATVLFLE  189 (277)
Q Consensus       164 ~~H~Al~DA~~t~~l~~~l~~~l~~~  189 (277)
                      .+|+|++||+++++|+.++++...++
T Consensus       154 ~~H~Al~Da~~t~~l~~~l~~~~~~~  179 (186)
T 2p1j_A          154 RHHRALDDARVTAQVFLRFVEMMKKE  179 (186)
T ss_dssp             TCCHHHHHHHHHHHHHHHHTTCC---
T ss_pred             CCcCHHHHHHHHHHHHHHHHHHHHhh
Confidence            78999999999999999998766554
>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Back     alignment and structure
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A* Back     alignment and structure
>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5 Back     alignment and structure
>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A Back     alignment and structure
>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Back     alignment and structure
>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A Back     alignment and structure
>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, hydrolase; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3tr8_A Oligoribonuclease; transcription, hydrolase; 2.50A {Coxiella burnetii} Back     alignment and structure
>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A* Back     alignment and structure
>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A* Back     alignment and structure
>4hec_A Putative uncharacterized protein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, unknown; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A* Back     alignment and structure
>4gmj_B CCR4-NOT transcription complex subunit 7; mRNA decay, deadenylase, RNA bindin; HET: GOL; 2.70A {Homo sapiens} Back     alignment and structure
>4dfk_A DNA polymerase I, thermostable; DNA polymerase, transferase-DNA complex; HET: DNA DOC 0L5; 1.65A {Thermus aquaticus} PDB: 1jxe_A* 3ktq_A* 3lwl_A* 3lwm_A* 3m8s_A* 3m8r_A* 3oju_A* 3rr7_A* 3rr8_A* 3rrg_A* 3ojs_A* 3rtv_A* 3sv3_A* 3sv4_A* 3syz_A* 3sz2_A* 3t3f_A* 4df4_A* 4df8_A* 4dfj_A* ... Back     alignment and structure
>1qht_A Protein (DNA polymerase); archaea, hyperthermostable, family B polymer alpha family polymerase, transferase; 2.10A {Thermococcus SP} SCOP: c.55.3.5 e.8.1.1 PDB: 1tgo_A 2xhb_A* 2vwj_A* 2vwk_A* 1wns_A* 1wn7_A 1qqc_A* 4ahc_A* 4ail_C* 3a2f_A* 2jgu_A* 1d5a_A Back     alignment and structure
>2p51_A SPCC18.06C protein; DEDD nuclease fold, hydrolase, gene regulation; 1.40A {Schizosaccharomyces pombe} PDB: 3g0z_A 3g10_A Back     alignment and structure
>1noy_A Protein (DNA polymerase (E.C.2.7.7.7)); exonuclease, DNA-binding, complex (nucleotidyltransferase/DNA); HET: DNA; 2.20A {Enterobacteria phage T4} SCOP: c.55.3.5 PDB: 1noz_A* Back     alignment and structure
>2d5r_A CCR4-NOT transcription complex subunit 7; poly(A) deadenylase, antiproliferative protein, transcription; 2.50A {Homo sapiens} SCOP: c.55.3.9 Back     alignment and structure
>3pv8_A DNA polymerase I; DNA polymerase I, protein-DNA complex, thymine-adenine, CLOS conformation; HET: DNA 2DT D3T; 1.52A {Geobacillus kaustophilus} PDB: 3px0_A* 3px4_A* 3px6_A* 3thv_A* 3ti0_A* 4dse_A* 4dsf_A* 4ds4_A* 4dqp_A* 4dqi_A* 4ds5_A* 4e0d_A* 4dqr_A* 4dqq_A* 3tan_A* 3tap_A* 3taq_A* 3tar_A* 4dqs_A* 3hp6_A* ... Back     alignment and structure
>3iay_A DNA polymerase delta catalytic subunit; protein-DNA complex, DNA replication, DNA-BI DNA-directed DNA polymerase, exonuclease, hydrolase; HET: DNA DOC DCP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1s5j_A DNA polymerase I; replication, disulfide bonds, transferase; HET: DNA; 2.40A {Sulfolobus solfataricus} SCOP: c.55.3.5 e.8.1.1 Back     alignment and structure
>1uoc_A POP2; hydrolase, DEDD nuclease, mRNA degradation, poly(A) tail, transcription regulation, repressor, phosphorylation.; 2.3A {Saccharomyces cerevisiae} SCOP: c.55.3.9 Back     alignment and structure
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Back     alignment and structure
>2gv9_A DNA polymerase; polymerase alpha fold, transferase; HET: DNA; 2.68A {Human herpesvirus 1} PDB: 1dml_B* Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Back     alignment and structure
>3qex_A DNA polymerase, GP43; difluorotoluene nucleoside; HET: DNA DOC DGT; 1.73A {Enterobacteria phage RB69} PDB: 3qei_A* 3qer_A* 3qes_A* 3qet_A* 3qep_A* 3qew_A* 3qev_A* 3s9h_A* 3sq0_A* 4dtn_A* 4dto_A* 4dtp_A* 4dtr_A* 4dts_A* 4dtu_A* 4dtx_A* 4e3s_A* 4fjm_A* 4fjl_A* 3spz_A* ... Back     alignment and structure
>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Back     alignment and structure
>3k59_A POL II, DNA polymerase II; protein-DNA complex, DNA damage, DNA repair, DNA-binding; HET: DNA DOC DCP; 1.92A {Escherichia coli} PDB: 3k57_A* 3k58_A* 3k5l_A* 3k5m_A* 3k5n_A* 3k5o_A* 3maq_A* 1q8i_A* Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A Back     alignment and structure
>2a1r_A Poly(A)-specific ribonuclease PARN; DEDD, nuclease domain, hydrolase-RNA complex; 2.60A {Homo sapiens} PDB: 2a1s_A Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2py5_A DNA polymerase; protein-DNA complex, replication, transferase/DNA complex; HET: DNA; 1.60A {Bacillus phage PHI29} SCOP: c.55.3.5 e.8.1.1 PDB: 1xhz_A* 1xhx_A* 2ex3_A* 1xi1_A* 2pyj_A* 2pyl_A* 2pzs_A* Back     alignment and structure
>1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* Back     alignment and structure
>3q7c_A Nucleoprotein; deddh exonuclease, 3' exonuclease, hydrolase; 1.50A {Lassa virus} PDB: 3q7b_A 4fvu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 277
d1w0ha_200 c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapien 9e-18
d1y97a1228 c.55.3.5 (A:1-228) Three prime repair exonuclease 1e-17
d3b6oa1226 c.55.3.5 (A:9-234) Three prime repair exonuclease 1e-12
d2guia1174 c.55.3.5 (A:7-180) N-terminal exonuclease domain o 2e-11
d2f96a1202 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas ae 1e-10
d2qxfa1 467 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli 5e-09
d2igia1180 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia 1e-07
d1wlja_173 c.55.3.5 (A:) Interferon-stimulated gene 20 kDa pr 8e-04
>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 200 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Exonuclease ERI1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 77.3 bits (189), Expect = 9e-18
 Identities = 25/179 (13%), Positives = 55/179 (30%), Gaps = 12/179 (6%)

Query: 15  IVFFDLETTVPR--RAGQRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRC 72
           I   D E T            ++EF  +++    L   ++F   ++P+  + ++      
Sbjct: 8   ICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISL 67

Query: 73  DGITREAVESAPEFEEVADKIFSILNGRVWAGH-------NIRRFDCARIKEAFAEIGKP 125
            GIT++ V+ A  F +V  K+   +  +            +        +          
Sbjct: 68  TGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLK 127

Query: 126 APV-PVGMIDSLGVLTEKFGRRAGNMKMATLASYFGL--GQQKHRSLDDVRMNLEVLKH 181
            P      I+        +       K+  +    G+    + H  LDD +    +   
Sbjct: 128 YPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVR 186
>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 226 Back     information, alignment and structure
>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Length = 174 Back     information, alignment and structure
>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]} Length = 202 Back     information, alignment and structure
>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} Length = 467 Back     information, alignment and structure
>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
d2guia1174 N-terminal exonuclease domain of the epsilon subun 99.96
d1w0ha_200 Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 960 99.95
d3b6oa1226 Three prime repair exonuclease 1, TREX1 {Mouse (Mu 99.95
d1y97a1228 Three prime repair exonuclease 2, TREX2 {Human (Ho 99.95
d1wlja_173 Interferon-stimulated gene 20 kDa protein, ISG20 { 99.94
d2qxfa1 467 Exonuclease I {Escherichia coli K12 (Escherichia c 99.86
d2f96a1202 Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287 99.84
d2igia1180 Oligoribonuclease {Escherichia coli [TaxId: 562]} 99.76
d2hhva1171 Exonuclease domain of prokaryotic DNA polymerase { 98.86
d1kfsa1195 Exonuclease domain of prokaryotic DNA polymerase { 98.84
d2d5ra1252 CCR4-NOT transcription complex subunit 7, CAF1 {Hu 98.82
d1x9ma1204 Exonuclease domain of T7 DNA polymerase {Bacteriop 98.68
d1yt3a3193 Ribonuclease D, catalytic domain {Escherichia coli 98.46
d1uoca_286 Pop2 RNase D domain {Baker's yeast (Saccharomyces 98.28
d1tgoa1347 Exonuclease domain of family B DNA polymerases {Ar 98.26
d2hbka2292 Exosome complex exonuclease RRP6 {Baker's yeast (S 98.25
d1vk0a_206 Hypothetical protein AT5G06450 {Thale-cress (Arabi 97.83
d1s5ja1410 Exonuclease domain of family B DNA polymerases {Su 97.69
d1q8ia1388 Exonuclease domain of family B DNA polymerases {Es 97.64
d1noya_372 Exonuclease domain of family B DNA polymerases {Ba 96.59
d1ih7a1375 Exonuclease domain of family B DNA polymerases {Ba 96.55
d2py5a1183 Exonuclease domain of phi29 DNA polymerase {Bacter 92.13
>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III
species: Escherichia coli [TaxId: 562]

Probab=99.96  E-value=2.9e-28  Score=198.56  Aligned_cols=164  Identities=26%  Similarity=0.377  Sum_probs=142.1

Q ss_pred             cEEEEEeccCCCCCCC---CCCceEEEEEEEEECCeeeeeceEEEeecCCCCCCCCchhhhhcCCCHHHHhCCCCHHHHH
Q 023805           14 EIVFFDLETTVPRRAG---QRFWVLEFGAIIVCPRKLVELESFSTLIKPKDLSAVALKSSRCDGITREAVESAPEFEEVA   90 (277)
Q Consensus        14 ~~v~~D~ETTg~~~~~---~~~~IieIg~v~v~~~~~~~~~sf~~~v~P~~~~~i~~~~~~~~GIt~e~l~~a~~f~ev~   90 (277)
                      ++|+||+||||+++.+   ..++|||||+|.++++... .++|+.+|+|..  .+++.+.++|||+++++.+++++.+++
T Consensus         1 r~vv~D~ETTGl~~~~~~~~~d~IIeIg~v~~~~~~~~-~~~~~~~v~P~~--~i~~~~~~i~gIt~e~~~~~~~~~~~~   77 (174)
T d2guia1           1 RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLT-GNNFHVYLKPDR--LVDPEAFGVHGIADEFLLDKPTFAEVA   77 (174)
T ss_dssp             EEEEEEEEESCCCSSSSTTTTCCEEEEEEEEEETTEEC-SCCEEEECCCSS--CCCHHHHHHHCCCHHHHTTSCCHHHHH
T ss_pred             CEEEEEeeCCCCCcccccCCCCEEEEEEEEEEECCEEe-eeEEEEEeccCc--cchhhhhhccccchhhhhcchhHHHHH
Confidence            4799999999998742   2468999999999987653 478999999987  899999999999999999999999999


Q ss_pred             HHHHHHhCCCEEEEeCCchhHHHHHHHHHHHhCCCCCCC---CceeehHHHHHHHhCCCCCCCCHHHHHHHhCCC---CC
Q 023805           91 DKIFSILNGRVWAGHNIRRFDCARIKEAFAEIGKPAPVP---VGMIDSLGVLTEKFGRRAGNMKMATLASYFGLG---QQ  164 (277)
Q Consensus        91 ~~l~~~l~~~~lv~hn~~~fD~~~L~~~~~~~g~~~p~~---~~~iDt~~l~~~~~~~~~~~~~L~~La~~~gi~---~~  164 (277)
                      .+|.+|+++..+|+||. .||..++...+.+++...+..   ..++|++.++...+ +. ...+|..++++||++   ..
T Consensus        78 ~~~~~~~~~~~~v~~~~-~~d~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~-~~-~~~~L~~l~~~~~~~~~~~~  154 (174)
T d2guia1          78 DEFMDYIRGAELVIHNA-AFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMF-PG-KRNSLDALCARYEIDNSKRT  154 (174)
T ss_dssp             HHHHHHHTTSEEEETTH-HHHHHHHHHHHHHTCSCCCCGGGTSEEEEHHHHHHHHS-TT-SCCSHHHHHHHTTCCCTTCS
T ss_pred             HHHHHhcCCCeEEEeec-chhhHHHHHHHHHhCCCCCCcccccchhhHHHHHHHHc-CC-CCCCHHHHHHHcCCCCCCCC
Confidence            99999999999999999 999999999999998776542   25689998775543 43 357999999999997   34


Q ss_pred             CCChHHHHHHHHHHHHHHH
Q 023805          165 KHRSLDDVRMNLEVLKHCA  183 (277)
Q Consensus       165 ~H~Al~DA~~t~~l~~~l~  183 (277)
                      +|+|++||.+|++||.+|.
T Consensus       155 ~H~Al~Da~~ta~v~~~l~  173 (174)
T d2guia1         155 LHGALLDAQILAEVYLAMT  173 (174)
T ss_dssp             SCCHHHHHHHHHHHHHHHT
T ss_pred             CcCHHHHHHHHHHHHHHHc
Confidence            7999999999999999874
>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} Back     information, alignment and structure
>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d5ra1 c.55.3.9 (A:11-262) CCR4-NOT transcription complex subunit 7, CAF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uoca_ c.55.3.9 (A:) Pop2 RNase D domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius [TaxId: 71997]} Back     information, alignment and structure
>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]} Back     information, alignment and structure
>d2py5a1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} Back     information, alignment and structure