Citrus Sinensis ID: 024098

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MASTPSPFPQNYTFARPQAGSISRRKPPPTRQPLPSSPSSRCCGHALSLNYPFSPREIPTCGRKLTCKAAEVSVTEEESSASGGGGGGENWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVTATDVNIEEVRMVVDEDLEGFGFNVTSELINGKAAAIGFLLLLDFELLTGKGLLKGTGFLDFIYSVAGALNK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEEEEccEEEEEEEEccEEEEEEccccccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccccccEEEEEEEEccEEEEEcccccEEEEEEcccccEEEEEEEEEEcccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccc
cccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccccccccccccccccEEEEcHHHcccccEEEEEEcccEEEEEEEccEEEEEcccccccccccccccccEEccccEEEccccccEEEcccccccccccccccEccccccccccEEEEccccccccEEEEccccEEEEEEEccccccccccccEEccHHHHHHHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHcc
mastpspfpqnytfarpqagsisrrkppptrqplpsspssrccghalslnypfspreiptcgrkltckaaevsvteeessasggggggenwvpvvplsalpkgerrvIIQDGETILLLWYKDEvfaienrspaegayseglinakltqdgcivcpttestfdlrtgavrdwypnnpvmeggassdaSAEIVFsgkaqpgvtatdvniEEVRMVVDEdlegfgfnvtsELINGKAAAIGFLLLLDFELLtgkgllkgtgFLDFIYSVAGALNK
mastpspfpqnytfarpqagsisrrkppPTRQPLPSSPSSRCCGHALSLNYPFSPREIPTCGRKLTCKAAEVSVTEeessasggggggenwvPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNPVMEGGASSDASAEIVFSGkaqpgvtatdvnIEEVRMVVDEDLEGFGFNVTSELINGKAAAIGFLLLLDFELLTGKGLLKGTGFLDFIYSVAGALNK
MASTPSPFPQNYTFARPQAGSISrrkppptrqplpsspssrCCGHALSLNYPFSPREIPTCGRKLTCKaaevsvteeessasggggggeNWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVTATDVNIEEVRMVVDEDLEGFGFNVTSELINGKAAAIgflllldfelltgkgllkgtgFLDFIYSVAGALNK
*****************************************CCGHALSLNYPFSPREIPTCGRKLTCK**********************WVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNP*************IVFSGKAQPGVTATDVNIEEVRMVVDEDLEGFGFNVTSELINGKAAAIGFLLLLDFELLTGKGLLKGTGFLDFIYSVAG****
************TFARP**************************************************************************VPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVTATDVNIEEVRMVVDEDLEGFGFNVTSELINGKAAAIGFLLLLDFELLTGKGLLKGTGFLDFIYSVAGA***
MASTPSPFPQNYTFARPQA**********************CCGHALSLNYPFSPREIPTCGRKLTC*******************GGENWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVTATDVNIEEVRMVVDEDLEGFGFNVTSELINGKAAAIGFLLLLDFELLTGKGLLKGTGFLDFIYSVAGALNK
****************************PTRQPLP***SS*CCGHALSLNYPFSPRE**TCGRKLTCKAAEVSVT*************ENWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVTATDVNIEEVRMVVDEDLEGFGFNVTSELINGKAAAIGFLLLLDFELLTGKGLLKGTGFLDFIYSVAGALNK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTPSPFPQNYTFARPQAGSISRRKPPPTRQPLPSSPSSRCCGHALSLNYPFSPREIPTCGRKLTCKAAEVSVTEEESSASGGGGGGENWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVTATDVNIEEVRMVVDEDLEGFGFNVTSELINGKAAAIGFLLLLDFELLTGKGLLKGTGFLDFIYSVAGALNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query272
224100707289 predicted protein [Populus trichocarpa] 0.919 0.865 0.587 3e-88
359495241280 PREDICTED: uncharacterized protein LOC10 0.860 0.835 0.616 2e-84
255574251280 oxidoreductase, putative [Ricinus commun 0.893 0.867 0.616 9e-84
356497393270 PREDICTED: uncharacterized protein LOC10 0.819 0.825 0.660 4e-82
115484891277 Os11g0242400 [Oryza sativa Japonica Grou 0.764 0.750 0.651 7e-82
326489352276 predicted protein [Hordeum vulgare subsp 0.794 0.782 0.634 8e-81
414878920370 TPA: hypothetical protein ZEAMMB73_34256 0.801 0.589 0.657 2e-80
226495849276 rieske domain containing protein [Zea ma 0.801 0.789 0.657 2e-80
449447593277 PREDICTED: uncharacterized protein LOC10 0.830 0.815 0.661 3e-80
194696446276 unknown [Zea mays] 0.801 0.789 0.653 7e-80
>gi|224100707|ref|XP_002334345.1| predicted protein [Populus trichocarpa] gi|222871289|gb|EEF08420.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  330 bits (847), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 178/303 (58%), Positives = 211/303 (69%), Gaps = 53/303 (17%)

Query: 3   STPS---PFPQNYTFARPQAGSISRRKPPPTRQPLPSSPSSRCCGHALSLNYPFSPREIP 59
           +TPS   PF QN++F  P   +IS           P+ P S     AL +N  F     P
Sbjct: 6   TTPSHLTPFTQNHSFNSPPRTTISFWH-------RPTYPPS----FALPINCHFVA---P 51

Query: 60  TCGR-----KLTCKAAEVSVTEEESSASGGGGGGENWVPVVPLSALPKGERRVIIQDGET 114
           +C       ++ CKA EVS+TEE  S+     GGENWVPVVPL+ALPKGERRVIIQDGET
Sbjct: 52  SCKTLRSNCRIVCKATEVSLTEESPSS-----GGENWVPVVPLTALPKGERRVIIQDGET 106

Query: 115 ILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQDGCIVCPTTESTFDLRTGAVRDWYPN 174
           ILLLWYKD+V+AIENRSPAEGAY+EGL+NAKLTQDGCIVCP+T+STFDLRTGA+++WYPN
Sbjct: 107 ILLLWYKDQVYAIENRSPAEGAYTEGLLNAKLTQDGCIVCPSTDSTFDLRTGAIKEWYPN 166

Query: 175 NPVM--------------------------EGGASSDASAEIVFSGKAQPGVTATDVNIE 208
           NPV+                           GG  SD SAEIVFSGKAQPGVTA+DVN++
Sbjct: 167 NPVLRVLTPALRTLFVYPVKTDEENIYISIRGGVKSDVSAEIVFSGKAQPGVTASDVNVD 226

Query: 209 EVRMVVDEDLEGFGFNVTSELINGKAAAIGFLLLLDFELLTGKGLLKGTGFLDFIYSVAG 268
           EVRMV+DE  EGFGF   +ELING+AA IGFL L+DFELLTGKG+LKGTGFLDF+Y+ + 
Sbjct: 227 EVRMVIDEGQEGFGFTSKNELINGQAAIIGFLFLIDFELLTGKGVLKGTGFLDFLYAASN 286

Query: 269 ALN 271
             N
Sbjct: 287 GFN 289

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359495241|ref|XP_003634942.1| PREDICTED: uncharacterized protein LOC100248314 isoform 2 [Vitis vinifera] gi|297741042|emb|CBI31354.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574251|ref|XP_002528040.1| oxidoreductase, putative [Ricinus communis] gi|223532570|gb|EEF34358.1| oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356497393|ref|XP_003517545.1| PREDICTED: uncharacterized protein LOC100791021 [Glycine max] Back     alignment and taxonomy information
>gi|115484891|ref|NP_001067589.1| Os11g0242400 [Oryza sativa Japonica Group] gi|62733863|gb|AAX95972.1| Rieske [2Fe-2S] domain, putative [Oryza sativa Japonica Group] gi|62733864|gb|AAX95973.1| Rieske [2Fe-2S] domain, putative [Oryza sativa Japonica Group] gi|62733865|gb|AAX95974.1| Rieske [2Fe-2S] domain, putative [Oryza sativa Japonica Group] gi|77549535|gb|ABA92332.1| Rieske domain containing protein, expressed [Oryza sativa Japonica Group] gi|77549536|gb|ABA92333.1| Rieske domain containing protein, expressed [Oryza sativa Japonica Group] gi|77549537|gb|ABA92334.1| Rieske domain containing protein, expressed [Oryza sativa Japonica Group] gi|113644811|dbj|BAF27952.1| Os11g0242400 [Oryza sativa Japonica Group] gi|125533933|gb|EAY80481.1| hypothetical protein OsI_35659 [Oryza sativa Indica Group] gi|125576731|gb|EAZ17953.1| hypothetical protein OsJ_33497 [Oryza sativa Japonica Group] gi|215695042|dbj|BAG90233.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|326489352|dbj|BAK01659.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326500040|dbj|BAJ90855.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|414878920|tpg|DAA56051.1| TPA: hypothetical protein ZEAMMB73_342569 [Zea mays] Back     alignment and taxonomy information
>gi|226495849|ref|NP_001151666.1| rieske domain containing protein [Zea mays] gi|195648532|gb|ACG43734.1| rieske domain containing protein [Zea mays] Back     alignment and taxonomy information
>gi|449447593|ref|XP_004141552.1| PREDICTED: uncharacterized protein LOC101206141 [Cucumis sativus] gi|449506832|ref|XP_004162861.1| PREDICTED: uncharacterized protein LOC101230421 [Cucumis sativus] Back     alignment and taxonomy information
>gi|194696446|gb|ACF82307.1| unknown [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query272
TAIR|locus:2825369287 AT1G71500 [Arabidopsis thalian 0.327 0.310 0.853 2.1e-65
TAIR|locus:2825369 AT1G71500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 430 (156.4 bits), Expect = 2.1e-65, Sum P(3) = 2.1e-65
 Identities = 76/89 (85%), Positives = 86/89 (96%)

Query:    90 NWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGAYSEGLINAKLTQD 149
             NWVPVVPLSALPKGERRV+IQD ETILLLWYK++VFAIENRSPAEGAYSEGL+NA+LTQD
Sbjct:    80 NWVPVVPLSALPKGERRVVIQDDETILLLWYKNDVFAIENRSPAEGAYSEGLLNARLTQD 139

Query:   150 GCIVCPTTESTFDLRTGAVRDWYPNNPVM 178
             GCIVCP+T+STFDLRTG +R+WYP NPV+
Sbjct:   140 GCIVCPSTDSTFDLRTGEIREWYPKNPVL 168
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
pfam13806104 pfam13806, Rieske_2, Rieske-like [2Fe-2S] domain 5e-23
cd0346798 cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster 8e-16
COG2146106 COG2146, {NirD}, Ferredoxin subunits of nitrite re 2e-10
cd0352898 cd03528, Rieske_RO_ferredoxin, Rieske non-heme iro 7e-10
TIGR02378105 TIGR02378, nirD_assim_sml, nitrite reductase [NAD( 2e-07
cd03529103 cd03529, Rieske_NirD, Assimilatory nitrite reducta 2e-06
cd0353098 cd03530, Rieske_NirD_small_Bacillus, Small subunit 3e-06
pfam0035599 pfam00355, Rieske, Rieske [2Fe-2S] domain 1e-05
cd0347895 cd03478, Rieske_AIFL_N, AIFL (apoptosis-inducing f 3e-05
PRK09965106 PRK09965, PRK09965, 3-phenylpropionate dioxygenase 5e-05
>gnl|CDD|205979 pfam13806, Rieske_2, Rieske-like [2Fe-2S] domain Back     alignment and domain information 
 Score = 90.3 bits (225), Expect = 5e-23
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 4/82 (4%)

Query: 90  NWVPVVPLSALPKGERRVIIQDGETILLLWY-KDEVFAIENRSPAEGAY--SEGLINAKL 146
           +W PV  L  LP G     +  G+ + L     ++V+AI+N  P  GA   S G+I   L
Sbjct: 1   SWTPVCALDDLPPGTGVCALVGGQQVALFRLPDEQVYAIDNIDPFSGANVLSRGIIGD-L 59

Query: 147 TQDGCIVCPTTESTFDLRTGAV 168
             +  +  P  +  FDLRTG  
Sbjct: 60  GGEPVVASPLYKQHFDLRTGEC 81

Length = 104
>gnl|CDD|239550 cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>gnl|CDD|225057 COG2146, {NirD}, Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|239604 cd03528, Rieske_RO_ferredoxin, Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO) Back     alignment and domain information
>gnl|CDD|131431 TIGR02378, nirD_assim_sml, nitrite reductase [NAD(P)H], small subunit Back     alignment and domain information
>gnl|CDD|239605 cd03529, Rieske_NirD, Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium Back     alignment and domain information
>gnl|CDD|239606 cd03530, Rieske_NirD_small_Bacillus, Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain Back     alignment and domain information
>gnl|CDD|215875 pfam00355, Rieske, Rieske [2Fe-2S] domain Back     alignment and domain information
>gnl|CDD|239560 cd03478, Rieske_AIFL_N, AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox) Back     alignment and domain information
>gnl|CDD|170182 PRK09965, PRK09965, 3-phenylpropionate dioxygenase ferredoxin subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 272
TIGR02377101 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE 99.91
cd0352898 Rieske_RO_ferredoxin Rieske non-heme iron oxygenas 99.91
PRK09965106 3-phenylpropionate dioxygenase ferredoxin subunit; 99.9
cd03531115 Rieske_RO_Alpha_KSH The alignment model represents 99.9
cd04338134 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-relate 99.9
cd03548136 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxy 99.9
cd03537123 Rieske_RO_Alpha_PrnD This alignment model represen 99.9
cd04337129 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) 99.9
PF13806104 Rieske_2: Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 99.89
cd0347895 Rieske_AIFL_N AIFL (apoptosis-inducing factor like 99.89
cd0353098 Rieske_NirD_small_Bacillus Small subunit of nitrit 99.89
cd03480138 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase 99.89
cd03529103 Rieske_NirD Assimilatory nitrite reductase (NirD) 99.89
PRK09511108 nirD nitrite reductase small subunit; Provisional 99.88
cd03474108 Rieske_T4moC Toluene-4-monooxygenase effector prot 99.88
TIGR02378105 nirD_assim_sml nitrite reductase [NAD(P)H], small 99.88
cd03479144 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxy 99.88
PF0035597 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR01794 99.88
cd03532116 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxy 99.87
cd03469118 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase ( 99.87
PLN00095 394 chlorophyllide a oxygenase; Provisional 99.86
COG2146106 {NirD} Ferredoxin subunits of nitrite reductase an 99.86
cd03472128 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxy 99.85
cd03535123 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase 99.85
cd03541118 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase 99.84
cd03545150 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron ox 99.84
cd03473107 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophospha 99.84
cd03539129 Rieske_RO_Alpha_S5H This alignment model represent 99.84
PLN02281 536 chlorophyllide a oxygenase 99.83
cd0346798 Rieske Rieske domain; a [2Fe-2S] cluster binding d 99.83
cd03536123 Rieske_RO_Alpha_DTDO This alignment model represen 99.83
cd03538146 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygena 99.82
PLN02518 539 pheophorbide a oxygenase 99.82
cd03542123 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenas 99.81
cd0347791 Rieske_YhfW_C YhfW family, C-terminal Rieske domai 99.81
cd03476126 Rieske_ArOX_small Small subunit of Arsenite oxidas 99.77
COG4638 367 HcaE Phenylpropionate dioxygenase and related ring 99.76
TIGR02694129 arsenite_ox_S arsenite oxidase, small subunit. Thi 99.73
TIGR03228 438 anthran_1_2_A anthranilate 1,2-dioxygenase, large 99.72
TIGR03229 433 benzo_1_2_benA benzoate 1,2-dioxygenase, large sub 99.69
cd03470126 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) co 99.65
cd03471126 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) co 99.59
PRK13474178 cytochrome b6-f complex iron-sulfur subunit; Provi 99.53
TIGR01416174 Rieske_proteo ubiquinol-cytochrome c reductase, ir 99.52
cd03475171 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske doma 99.22
PHA0233735 putative high light inducible protein 99.16
COG0723177 QcrA Rieske Fe-S protein [Energy production and co 98.79
PLN00014250 light-harvesting-like protein 3; Provisional 98.64
PLN00084214 photosystem II subunit S (PsbS); Provisional 98.55
KOG1671210 consensus Ubiquinol cytochrome c reductase, subuni 98.51
TIGR03171321 soxL2 Rieske iron-sulfur protein SoxL2. This iron- 98.44
KOG1336 478 consensus Monodehydroascorbate/ferredoxin reductas 96.85
PLN00089209 fucoxanthin-chlorophyll a/c binding protein; Provi 96.3
PLN00100246 light-harvesting complex chlorophyll-a/b protein o 96.29
PLN00147252 light-harvesting complex I chlorophyll-a/b binding 96.27
PF00504156 Chloroa_b-bind: Chlorophyll A-B binding protein; I 95.86
PLN00101250 Photosystem I light-harvesting complex type 4 prot 95.79
PLN00025262 photosystem II light harvesting chlorophyll a/b bi 95.72
PF00504156 Chloroa_b-bind: Chlorophyll A-B binding protein; I 95.7
PLN00099243 light-harvesting complex IChlorophyll A-B binding 95.65
PLN00048262 photosystem I light harvesting chlorophyll a/b bin 95.48
PLN00098267 light-harvesting complex I chlorophyll a/b-binding 95.43
PLN00171324 photosystem light-harvesting complex -chlorophyll 95.42
PLN00048 262 photosystem I light harvesting chlorophyll a/b bin 95.39
PLN00101 250 Photosystem I light-harvesting complex type 4 prot 95.24
PLN00097244 photosystem I light harvesting complex Lhca2/4, ch 95.22
PLN00187286 photosystem II light-harvesting complex II protein 95.19
PLN00120202 fucoxanthin-chlorophyll a-c binding protein; Provi 94.35
PLN00098 267 light-harvesting complex I chlorophyll a/b-binding 94.11
PLN00097 244 photosystem I light harvesting complex Lhca2/4, ch 92.9
PLN02449485 ferrochelatase 92.83
PLN00170 255 photosystem II light-harvesting-Chl-binding protei 92.82
PLN00025 262 photosystem II light harvesting chlorophyll a/b bi 92.65
PLN00147 252 light-harvesting complex I chlorophyll-a/b binding 92.17
PLN00170255 photosystem II light-harvesting-Chl-binding protei 91.99
PLN00171 324 photosystem light-harvesting complex -chlorophyll 91.86
PLN00187 286 photosystem II light-harvesting complex II protein 91.69
PLN00100 246 light-harvesting complex chlorophyll-a/b protein o 87.69
PLN00099 243 light-harvesting complex IChlorophyll A-B binding 86.93
PLN00089209 fucoxanthin-chlorophyll a/c binding protein; Provi 86.71
PF07009113 DUF1312: Protein of unknown function (DUF1312); In 81.61
>TIGR02377 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE subfamily Back     alignment and domain information 
Probab=99.91  E-value=2.9e-24  Score=168.07  Aligned_cols=95  Identities=21%  Similarity=0.350  Sum_probs=84.8

Q ss_pred             ccEEeeeCCCCCCCCeEEEEECCeEEEEEEe-CCEEEEEcCCCcCCc-ccccCcccccccCCCEEEeCCccceEeCCCCc
Q 024098           90 NWVPVVPLSALPKGERRVIIQDGETILLLWY-KDEVFAIENRSPAEG-AYSEGLINAKLTQDGCIVCPTTESTFDLRTGA  167 (272)
Q Consensus        90 ~W~~v~~~~el~~g~~~~v~~~g~~vvl~r~-~g~v~A~~n~CpH~g-~L~~G~v~~~~~~~~~i~CP~Hg~~Fdl~tG~  167 (272)
                      +|+.++.++||++|+.+.+.++|++++|+|. +|+++|++|.|||+| +|++|.+     +++.|+||||||+||++||+
T Consensus         1 ~w~~v~~~~dl~~g~~~~~~~~g~~i~l~r~~~g~~~A~~~~CpH~g~~L~~G~~-----~~~~i~CP~Hg~~Fdl~tG~   75 (101)
T TIGR02377         1 NWVKACDADDIGREDVARFDHGGRTFAIYRTPDDQYYATDGLCTHEYAHLADGLV-----MDTTVECPKHAGCFDYRTGE   75 (101)
T ss_pred             CcEEEEEHHHcCCCCEEEEEECCeEEEEEEeCCCEEEEEcCcCCCCCCCCCCCEE-----cCCEEECCccCCEEECCCCc
Confidence            4999999999999999999999999999998 899999999999999 5999998     67899999999999999999


Q ss_pred             cccCCCCCCcccCCcCCCCcceEEeecccCCCcc
Q 024098          168 VRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVT  201 (272)
Q Consensus       168 ~~~~P~~~pl~~~g~~~~~~~v~vFp~k~~~G~i  201 (272)
                      |+..|+..++            ..|+++.++|.+
T Consensus        76 ~~~~p~~~~l------------~~y~v~v~~g~v   97 (101)
T TIGR02377        76 ALNPPVCVNL------------KTYPVKVVDGAV   97 (101)
T ss_pred             ccCCCccCCc------------ceEeEEEECCEE
Confidence            9988865444            467777777655

This model describes a subfamily of the Rieske-like [2Fe-2S] family of ferredoxins that includes MocE, part of the rhizopine (3-O-methyl-scyllo-inosamine) catabolic cluster in Rhizobium. Members of this family are related to, yet distinct from, the small subunit of nitrite reductase [NAD(P)H].
>cd03528 Rieske_RO_ferredoxin Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO) Back     alignment and domain information
>PRK09965 3-phenylpropionate dioxygenase ferredoxin subunit; Provisional Back     alignment and domain information
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH) Back     alignment and domain information
>cd04338 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-related non-heme iron oxygenase associated with protein transport through the plant inner chloroplast membrane Back     alignment and domain information
>cd03548 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxygenase (RO) family, 2-Oxoquinoline 8-monooxygenase (OMO) and Carbazole 1,9a-dioxygenase (CARDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03537 Rieske_RO_Alpha_PrnD This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit of aminopyrrolnitrin oxygenase (PrnD) Back     alignment and domain information
>cd04337 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) is a rieske non-heme iron-sulfur protein located within the plastid-envelope inner and thylakoid membranes, that catalyzes the conversion of chlorophyllide a to chlorophyllide b Back     alignment and domain information
>PF13806 Rieske_2: Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 3C0D_A 3D89_A 2JZA_A Back     alignment and domain information
>cd03478 Rieske_AIFL_N AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox) Back     alignment and domain information
>cd03530 Rieske_NirD_small_Bacillus Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain Back     alignment and domain information
>cd03480 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase (RO) family, Pheophorbide a oxygenase (PaO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of a small subfamily of enzymes found in plants as well as oxygenic cyanobacterial photosynthesizers including LLS1 (lethal leaf spot 1, also known as PaO) and ACD1 (accelerated cell death 1) Back     alignment and domain information
>cd03529 Rieske_NirD Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium Back     alignment and domain information
>PRK09511 nirD nitrite reductase small subunit; Provisional Back     alignment and domain information
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit Back     alignment and domain information
>cd03479 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxygenase (RO) family, Phthalate 4,5-dioxygenase (PhDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of PhDO and similar proteins including 3-chlorobenzoate 3,4-dioxygenase (CBDO), phenoxybenzoate dioxygenase (POB-dioxygenase) and 3-nitrobenzoate oxygenase (MnbA) Back     alignment and domain information
>PF00355 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR017941 There are multiple types of iron-sulphur clusters which are grouped into three main categories based on their atomic content: [2Fe-2S], [3Fe-4S], [4Fe-4S] (see PDOC00176 from PROSITEDOC), and other hybrid or mixed metal types Back     alignment and domain information
>cd03532 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms Back     alignment and domain information
>PLN00095 chlorophyllide a oxygenase; Provisional Back     alignment and domain information
>COG2146 {NirD} Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>cd03472 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxygenase (RO) family, Biphenyl dioxygenase (BPDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of BPDO and similar proteins including cumene dioxygenase (CumDO), nitrobenzene dioxygenase (NBDO), alkylbenzene dioxygenase (AkbDO) and dibenzofuran 4,4a-dioxygenase (DFDO) Back     alignment and domain information
>cd03535 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase (RO) family, Nathphalene 1,2-dioxygenase (NDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03541 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase (RO) family, Choline monooxygenase (CMO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03545 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron oxygenase (RO) family, Ortho-halobenzoate-1,2-dioxygenase (OHBDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of OHBDO, salicylate 5-hydroxylase (S5H), terephthalate 1,2-dioxygenase system (TERDOS) and similar proteins Back     alignment and domain information
>cd03473 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophosphate-N-acetylneuraminic acid (CMP Neu5Ac) hydroxylase family, N-terminal Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03539 Rieske_RO_Alpha_S5H This alignment model represents the N-terminal rieske iron-sulfur domain of the oxygenase alpha subunit (NagG) of salicylate 5-hydroxylase (S5H) Back     alignment and domain information
>PLN02281 chlorophyllide a oxygenase Back     alignment and domain information
>cd03467 Rieske Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>cd03536 Rieske_RO_Alpha_DTDO This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit (DitA) of diterpenoid dioxygenase (DTDO) Back     alignment and domain information
>cd03538 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygenase (RO) family, Anthranilate 1,2-dioxygenase (AntDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>PLN02518 pheophorbide a oxygenase Back     alignment and domain information
>cd03542 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenase (RO) family, 2-Halobenzoate 1,2-dioxygenase (HBDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03477 Rieske_YhfW_C YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain Back     alignment and domain information
>cd03476 Rieske_ArOX_small Small subunit of Arsenite oxidase (ArOX) family, Rieske domain; ArOX is a molybdenum/iron protein involved in the detoxification of arsenic, oxidizing it to arsenate Back     alignment and domain information
>COG4638 HcaE Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02694 arsenite_ox_S arsenite oxidase, small subunit Back     alignment and domain information
>TIGR03228 anthran_1_2_A anthranilate 1,2-dioxygenase, large subunit Back     alignment and domain information
>TIGR03229 benzo_1_2_benA benzoate 1,2-dioxygenase, large subunit Back     alignment and domain information
>cd03470 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03471 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) component of the b6f complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>PRK13474 cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR01416 Rieske_proteo ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>cd03475 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>PHA02337 putative high light inducible protein Back     alignment and domain information
>COG0723 QcrA Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>PLN00014 light-harvesting-like protein 3; Provisional Back     alignment and domain information
>PLN00084 photosystem II subunit S (PsbS); Provisional Back     alignment and domain information
>KOG1671 consensus Ubiquinol cytochrome c reductase, subunit RIP1 [Energy production and conversion] Back     alignment and domain information
>TIGR03171 soxL2 Rieske iron-sulfur protein SoxL2 Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PLN00089 fucoxanthin-chlorophyll a/c binding protein; Provisional Back     alignment and domain information
>PLN00100 light-harvesting complex chlorophyll-a/b protein of photosystem I (Lhca); Provisional Back     alignment and domain information
>PLN00147 light-harvesting complex I chlorophyll-a/b binding protein Lhca5; Provisional Back     alignment and domain information
>PF00504 Chloroa_b-bind: Chlorophyll A-B binding protein; InterPro: IPR022796 The light-harvesting complex (LHC) consists of chlorophylls A and B and the chlorophyll A-B binding protein Back     alignment and domain information
>PLN00101 Photosystem I light-harvesting complex type 4 protein; Provisional Back     alignment and domain information
>PLN00025 photosystem II light harvesting chlorophyll a/b binding protein; Provisional Back     alignment and domain information
>PF00504 Chloroa_b-bind: Chlorophyll A-B binding protein; InterPro: IPR022796 The light-harvesting complex (LHC) consists of chlorophylls A and B and the chlorophyll A-B binding protein Back     alignment and domain information
>PLN00099 light-harvesting complex IChlorophyll A-B binding protein Lhca1; Provisional Back     alignment and domain information
>PLN00048 photosystem I light harvesting chlorophyll a/b binding protein 3; Provisional Back     alignment and domain information
>PLN00098 light-harvesting complex I chlorophyll a/b-binding protein (Lhac); Provisional Back     alignment and domain information
>PLN00171 photosystem light-harvesting complex -chlorophyll a/b binding protein Lhcb7; Provisional Back     alignment and domain information
>PLN00048 photosystem I light harvesting chlorophyll a/b binding protein 3; Provisional Back     alignment and domain information
>PLN00101 Photosystem I light-harvesting complex type 4 protein; Provisional Back     alignment and domain information
>PLN00097 photosystem I light harvesting complex Lhca2/4, chlorophyll a/b binding; Provisional Back     alignment and domain information
>PLN00187 photosystem II light-harvesting complex II protein Lhcb4; Provisional Back     alignment and domain information
>PLN00120 fucoxanthin-chlorophyll a-c binding protein; Provisional Back     alignment and domain information
>PLN00098 light-harvesting complex I chlorophyll a/b-binding protein (Lhac); Provisional Back     alignment and domain information
>PLN00097 photosystem I light harvesting complex Lhca2/4, chlorophyll a/b binding; Provisional Back     alignment and domain information
>PLN02449 ferrochelatase Back     alignment and domain information
>PLN00170 photosystem II light-harvesting-Chl-binding protein Lhcb6 (CP24); Provisional Back     alignment and domain information
>PLN00025 photosystem II light harvesting chlorophyll a/b binding protein; Provisional Back     alignment and domain information
>PLN00147 light-harvesting complex I chlorophyll-a/b binding protein Lhca5; Provisional Back     alignment and domain information
>PLN00170 photosystem II light-harvesting-Chl-binding protein Lhcb6 (CP24); Provisional Back     alignment and domain information
>PLN00171 photosystem light-harvesting complex -chlorophyll a/b binding protein Lhcb7; Provisional Back     alignment and domain information
>PLN00187 photosystem II light-harvesting complex II protein Lhcb4; Provisional Back     alignment and domain information
>PLN00100 light-harvesting complex chlorophyll-a/b protein of photosystem I (Lhca); Provisional Back     alignment and domain information
>PLN00099 light-harvesting complex IChlorophyll A-B binding protein Lhca1; Provisional Back     alignment and domain information
>PLN00089 fucoxanthin-chlorophyll a/c binding protein; Provisional Back     alignment and domain information
>PF07009 DUF1312: Protein of unknown function (DUF1312); InterPro: IPR010739 This family consists of several bacterial proteins of around 120 residues in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
1fqt_A112 Rieske-type ferredoxin of biphenyl dioxygenase; 2F 4e-20
2qpz_A103 Naphthalene 1,2-dioxygenase system ferredoxin subu 3e-15
3gce_A121 Ferredoxin component of carbazole 1,9A- dioxygenas 5e-15
1vm9_A111 Toluene-4-monooxygenase system protein C; structur 6e-15
3d89_A157 Rieske domain-containing protein; CAsp target, rie 2e-14
3dqy_A106 Toluene 1,2-dioxygenase system ferredoxin subunit; 2e-14
2de6_D115 Ferredoxin component of carbazole; electron transf 2e-13
2i7f_A108 Ferredoxin component of dioxygenase; rieske ferred 5e-13
3c0d_A119 Putative nitrite reductase NADPH (small subunit) o 9e-13
2jza_A130 Nitrite reductase [NAD(P)H] small subunit; ISP dom 3e-12
2jo6_A113 Nitrite reductase [NAD(P)H] small subunit; all bet 6e-12
>1fqt_A Rieske-type ferredoxin of biphenyl dioxygenase; 2Fe-2S cluster, beta sandwich, oxido; 1.60A {Burkholderia xenovorans} SCOP: b.33.1.1 PDB: 2e4q_A 2e4p_A 2yvj_B* Length = 112 Back     alignment and structure
 Score = 82.3 bits (204), Expect = 4e-20
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 15/94 (15%)

Query: 90  NWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENR------SPAEGAYSEGLIN 143
            +  V     +P+GE   +   G ++ +     E+FA ++R      S ++G Y EG   
Sbjct: 5   KFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEG--- 61

Query: 144 AKLTQDGCIVCPTTESTFDLRTGAVRDWYPNNPV 177
                   + C      F +RTG V+   P   +
Sbjct: 62  ------DVVECSLHMGKFCVRTGKVKSPPPCEAL 89
>2qpz_A Naphthalene 1,2-dioxygenase system ferredoxin subunit; rieske ferredoxin, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport, iron; 1.85A {Pseudomonas putida} Length = 103 Back     alignment and structure
>3gce_A Ferredoxin component of carbazole 1,9A- dioxygenase; rieske ferredoxin, 2Fe-2S, electron transfer, oxidoreductase; 2.00A {Nocardioides aromaticivorans} Length = 121 Back     alignment and structure
>1vm9_A Toluene-4-monooxygenase system protein C; structural genomics, CESG, protein structure initiative, PSI, ferredoxin, FES, [2Fe-2S] cluster; 1.48A {Pseudomonas mendocina} SCOP: b.33.1.1 PDB: 2q3w_A 1sjg_A Length = 111 Back     alignment and structure
>3d89_A Rieske domain-containing protein; CAsp target, rieske ferredoxin, [2Fe-2S] cluster, protein ST initiative, PSI; 2.07A {Mus musculus} Length = 157 Back     alignment and structure
>3dqy_A Toluene 1,2-dioxygenase system ferredoxin subunit; rieske, iron-sulfur cluster, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport; 1.20A {Pseudomonas putida} Length = 106 Back     alignment and structure
>2de6_D Ferredoxin component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Pseudomonas resinovorans} PDB: 2de5_D 1vck_A 2de7_D* Length = 115 Back     alignment and structure
>2i7f_A Ferredoxin component of dioxygenase; rieske ferredoxin, oxidoreductase; HET: CIT; 1.90A {Sphingobium yanoikuyae} Length = 108 Back     alignment and structure
>3c0d_A Putative nitrite reductase NADPH (small subunit) oxidoreductase protein; NESG, VPR162, Q87HB1, XRAY, structure; 2.40A {Vibrio parahaemolyticus rimd 2210633} SCOP: b.33.1.3 Length = 119 Back     alignment and structure
>2jza_A Nitrite reductase [NAD(P)H] small subunit; ISP domain, rieske iron-sulfur protein, 3-layer beta- sandwich; NMR {Pectobacterium atrosepticum SCRI1043} SCOP: b.33.1.3 Length = 130 Back     alignment and structure
>2jo6_A Nitrite reductase [NAD(P)H] small subunit; all beta, ISP domain, rieske iron-sulfur protein, 3-layer sandwich, structural genomics, PSI-2; NMR {Escherichia coli} SCOP: b.33.1.3 Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query272
2qpz_A103 Naphthalene 1,2-dioxygenase system ferredoxin subu 99.92
3dqy_A106 Toluene 1,2-dioxygenase system ferredoxin subunit; 99.92
1fqt_A112 Rieske-type ferredoxin of biphenyl dioxygenase; 2F 99.92
3gce_A121 Ferredoxin component of carbazole 1,9A- dioxygenas 99.92
2i7f_A108 Ferredoxin component of dioxygenase; rieske ferred 99.91
2de6_D115 Ferredoxin component of carbazole; electron transf 99.91
1vm9_A111 Toluene-4-monooxygenase system protein C; structur 99.91
3c0d_A119 Putative nitrite reductase NADPH (small subunit) o 99.9
4aiv_A119 Probable nitrite reductase [NAD(P)H] small subuni; 99.9
2jo6_A113 Nitrite reductase [NAD(P)H] small subunit; all bet 99.89
2jza_A130 Nitrite reductase [NAD(P)H] small subunit; ISP dom 99.88
3d89_A157 Rieske domain-containing protein; CAsp target, rie 99.86
3gcf_A 394 Terminal oxygenase component of carbazole 1,9A- di 99.82
3gkq_A 389 Terminal oxygenase component of carbazole 1,9A- di 99.82
2de6_A 392 Terminal oxygenase component of carbazole; electro 99.82
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 99.82
3gke_A 349 DDMC; rieske cluster, non-heme mononuclear iron, o 99.81
2zyl_A 386 Possible oxidoreductase; KSHA, cholesterol, rieske 99.81
1z01_A 446 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygen 99.8
2gbw_A 454 Biphenyl 2,3-dioxygenase alpha subunit; rieske oxy 99.8
1g8k_B133 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 99.8
3vca_A 412 Ring-hydroxylating dioxygenase; rieske-type, monon 99.79
3n0q_A 409 Putative aromatic-ring hydroxylating dioxygenase; 99.79
2bmo_A 447 Oxygenase-alpha NBDO; nitrobenzene dioxygenase, ni 99.78
4aay_B175 AROB; oxidoreductase, rieske, iron sulfur, molybdo 99.78
3gzx_A 457 Biphenyl dioxygenase subunit alpha; rieskie, non-h 99.77
1uli_A 460 Biphenyl dioxygenase large subunit; alpha3 BETA3 h 99.77
2b1x_A 470 Naphthalene dioxygenase large subunit; rieske non- 99.76
1rfs_A139 Rieske protein; iron-sulfur protein, electron tran 99.74
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 99.7
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 99.69
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 99.69
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 99.67
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 99.48
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 99.63
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 99.58
1jm1_A204 Rieske iron-sulfur protein SOXF; electron transpor 99.42
2bhw_A232 Chlorophyll A-B binding protein AB80; LHC-II, phot 97.13
3pl9_A243 Chlorophyll A-B binding protein; CP29, light-harve 97.01
2wsc_2269 LHCA2, type II chlorophyll A/B binding protein fro 96.94
2wsc_3276 LHCA3, type II chlorophyll A/B binding protein fro 96.93
2wsc_1241 AT3G54890, LHCA1; photosynthesis, electron transfe 96.46
2wsc_4 251 Chlorophyll A-B binding protein P4, chloroplastic; 95.67
2wsc_4251 Chlorophyll A-B binding protein P4, chloroplastic; 95.59
2wsc_3 276 LHCA3, type II chlorophyll A/B binding protein fro 94.14
2wsc_2 269 LHCA2, type II chlorophyll A/B binding protein fro 93.36
3pl9_A 243 Chlorophyll A-B binding protein; CP29, light-harve 92.74
2bhw_A 232 Chlorophyll A-B binding protein AB80; LHC-II, phot 89.69
>2qpz_A Naphthalene 1,2-dioxygenase system ferredoxin subunit; rieske ferredoxin, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport, iron; 1.85A {Pseudomonas putida} Back     alignment and structure
Probab=99.92  E-value=3.4e-25  Score=172.12  Aligned_cols=97  Identities=21%  Similarity=0.336  Sum_probs=86.2

Q ss_pred             CccEEeeeCCCCCCCCeEEEEECCeEEEEEEeCCEEEEEcCCCcCCc-ccccCcccccccCCCEEEeCCccceEeCCCCc
Q 024098           89 ENWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEG-AYSEGLINAKLTQDGCIVCPTTESTFDLRTGA  167 (272)
Q Consensus        89 ~~W~~v~~~~el~~g~~~~v~~~g~~vvl~r~~g~v~A~~n~CpH~g-~L~~G~v~~~~~~~~~i~CP~Hg~~Fdl~tG~  167 (272)
                      +.|+.|+.++||++|+.+.+.++|++++|+|.+|+++|++|.|||+| +|++|.+     +++.|+||||||+||++||+
T Consensus         2 ~~w~~v~~~~~l~~g~~~~~~~~g~~i~v~r~~g~~~A~~~~CpH~g~~L~~g~~-----~~~~i~Cp~Hg~~Fd~~~G~   76 (103)
T 2qpz_A            2 VKWIEAVALSDILEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGSARMSDGYL-----EGREIECPLHQGRFDVCTGK   76 (103)
T ss_dssp             CCEEEEEETTSCCTTCEEEEEETTEEEEEEEETTEEEEEESBCSSSSCBGGGSEE-----ETTEEECTTTTCEEETTTCC
T ss_pred             CccEEEEEHHHcCCCCEEEEEECCEEEEEEEECCEEEEECCcCCCCCCCCCCCeE-----eCCEEECCCCCCEEeCCCCC
Confidence            57999999999999999999999999999999999999999999999 5999988     57899999999999999999


Q ss_pred             cccCCCCCCcccCCcCCCCcceEEeecccCCCccc
Q 024098          168 VRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVTA  202 (272)
Q Consensus       168 ~~~~P~~~pl~~~g~~~~~~~v~vFp~k~~~G~i~  202 (272)
                      |+.+|+..++            ..|+++...|.++
T Consensus        77 ~~~~P~~~~L------------~~~~v~~~~g~v~   99 (103)
T 2qpz_A           77 ALCAPVTQNI------------KTYPVKIENLRVM   99 (103)
T ss_dssp             EEETTCCSCC------------CEECEEEETTEEE
T ss_pred             EeCCCCCCCC------------CEEeEEEECCEEE
Confidence            9998865443            4667777777654
>3dqy_A Toluene 1,2-dioxygenase system ferredoxin subunit; rieske, iron-sulfur cluster, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport; 1.20A {Pseudomonas putida} SCOP: b.33.1.0 PDB: 4emj_B* Back     alignment and structure
>1fqt_A Rieske-type ferredoxin of biphenyl dioxygenase; 2Fe-2S cluster, beta sandwich, oxido; 1.60A {Burkholderia xenovorans} SCOP: b.33.1.1 PDB: 2e4q_A 2e4p_A 2yvj_B* Back     alignment and structure
>3gce_A Ferredoxin component of carbazole 1,9A- dioxygenase; rieske ferredoxin, 2Fe-2S, electron transfer, oxidoreductase; 2.00A {Nocardioides aromaticivorans} Back     alignment and structure
>2i7f_A Ferredoxin component of dioxygenase; rieske ferredoxin, oxidoreductase; HET: CIT; 1.90A {Sphingobium yanoikuyae} Back     alignment and structure
>2de6_D Ferredoxin component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Pseudomonas resinovorans} PDB: 2de5_D 1vck_A 2de7_D* Back     alignment and structure
>1vm9_A Toluene-4-monooxygenase system protein C; structural genomics, CESG, protein structure initiative, PSI, ferredoxin, FES, [2Fe-2S] cluster; 1.48A {Pseudomonas mendocina} SCOP: b.33.1.1 PDB: 2q3w_A 1sjg_A Back     alignment and structure
>3c0d_A Putative nitrite reductase NADPH (small subunit) oxidoreductase protein; NESG, VPR162, Q87HB1, XRAY, structure; 2.40A {Vibrio parahaemolyticus rimd 2210633} SCOP: b.33.1.3 Back     alignment and structure
>4aiv_A Probable nitrite reductase [NAD(P)H] small subuni; oxidoreductase, nitrite metabolism; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2jo6_A Nitrite reductase [NAD(P)H] small subunit; all beta, ISP domain, rieske iron-sulfur protein, 3-layer sandwich, structural genomics, PSI-2; NMR {Escherichia coli} SCOP: b.33.1.3 Back     alignment and structure
>2jza_A Nitrite reductase [NAD(P)H] small subunit; ISP domain, rieske iron-sulfur protein, 3-layer beta- sandwich; NMR {Pectobacterium atrosepticum SCRI1043} SCOP: b.33.1.3 Back     alignment and structure
>3d89_A Rieske domain-containing protein; CAsp target, rieske ferredoxin, [2Fe-2S] cluster, protein ST initiative, PSI; 2.07A {Mus musculus} Back     alignment and structure
>3gcf_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske oxygenase, 2Fe-2S, electron transfer, oxidoreductase; 2.30A {Nocardioides aromaticivorans} Back     alignment and structure
>3gkq_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske nonheme iron oxygenase, electron transfer, putidaredoxin-type ferredoxin; 2.10A {Sphingomonas} Back     alignment and structure
>2de6_A Terminal oxygenase component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Janthinobacterium} SCOP: b.33.1.2 d.129.3.3 PDB: 1ww9_A 2de5_A 2de7_A* Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Back     alignment and structure
>3gke_A DDMC; rieske cluster, non-heme mononuclear iron, oxygenase, oxidoreductase; 1.75A {Stenotrophomonas maltophilia} PDB: 3gb4_A 3gl0_A* 3gl2_A* 3gob_A* 3gte_A 3gts_A* Back     alignment and structure
>2zyl_A Possible oxidoreductase; KSHA, cholesterol, rieske; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1z01_A 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygenase component; rieske center, oxygen binding/activation, substrate bound complex; 1.80A {Pseudomonas putida} SCOP: b.33.1.2 d.129.3.3 PDB: 1z02_A 1z03_A* Back     alignment and structure
>2gbw_A Biphenyl 2,3-dioxygenase alpha subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_A* 2ckf_A Back     alignment and structure
>1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.33.1.1 PDB: 1g8j_B* Back     alignment and structure
>3vca_A Ring-hydroxylating dioxygenase; rieske-type, mononuclear non-heme iron, N-demethylase, oxido; 1.59A {Sinorhizobium meliloti} PDB: 3vcp_A Back     alignment and structure
>3n0q_A Putative aromatic-ring hydroxylating dioxygenase; rieske [2Fe-2S] domain, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Back     alignment and structure
>2bmo_A Oxygenase-alpha NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2bmq_A 2bmr_A* 2hmj_A 2hml_A* 2hmn_A* 1o7n_A 1ndo_A 1o7g_A* 1o7h_A 1o7m_A 1eg9_A 1o7p_A* 1o7w_A 1uuv_A 1uuw_A 2hmk_A* 2hmm_A* 2hmo_A* Back     alignment and structure
>4aay_B AROB; oxidoreductase, rieske, iron sulfur, molybdopterin; HET: MGD; 2.70A {Rhizobium species} Back     alignment and structure
>3gzx_A Biphenyl dioxygenase subunit alpha; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} PDB: 3gzy_A* 1wql_A 2xso_A 2xsh_A 2xrx_A* 2xr8_A* 2yfi_A 2yfj_A* 2yfl_A* Back     alignment and structure
>1uli_A Biphenyl dioxygenase large subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 1ulj_A* 3en1_A* 3eqq_A Back     alignment and structure
>2b1x_A Naphthalene dioxygenase large subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2b24_A Back     alignment and structure
>1rfs_A Rieske protein; iron-sulfur protein, electron transport; 1.83A {Spinacia oleracea} SCOP: b.33.1.1 PDB: 1q90_C* Back     alignment and structure
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Back     alignment and structure
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Back     alignment and structure
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Back     alignment and structure
>1jm1_A Rieske iron-sulfur protein SOXF; electron transport, respiratory chain, oxidoreductase; 1.11A {Sulfolobus acidocaldarius} SCOP: b.33.1.1 Back     alignment and structure
>2bhw_A Chlorophyll A-B binding protein AB80; LHC-II, photosynthesis, light-harvesting, membrane protein, chloroplast, chromophore, membrane; HET: LUX NEX XAT CLA CHL LHG DGD; 2.50A {Pisum sativum} PDB: 1vcr_A* 1rwt_A* Back     alignment and structure
>3pl9_A Chlorophyll A-B binding protein; CP29, light-harvesting COMP membrane protein, plant, photosynthesis, chloroplast, thyla photosystem II; HET: CLA CHL LUT XAT NEX G3P HTG; 2.80A {Spinacia oleracea} Back     alignment and structure
>2wsc_2 LHCA2, type II chlorophyll A/B binding protein from photosystem I; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Pisum sativum} PDB: 2wse_2* 2wsf_2* 2o01_2* 3lw5_2* Back     alignment and structure
>2wsc_3 LHCA3, type II chlorophyll A/B binding protein from photosystem I; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Glycine max} PDB: 2wse_3* 2wsf_3* 3lw5_3* 2o01_3* Back     alignment and structure
>2wsc_1 AT3G54890, LHCA1; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Arabidopsis thaliana} PDB: 2wse_1* 2wsf_1* 2o01_1* 3lw5_1* Back     alignment and structure
>2wsc_4 Chlorophyll A-B binding protein P4, chloroplastic; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Pisum sativum} PDB: 2wse_4* 2wsf_4* 3lw5_4* 2o01_4* Back     alignment and structure
>2wsc_4 Chlorophyll A-B binding protein P4, chloroplastic; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Pisum sativum} PDB: 2wse_4* 2wsf_4* 3lw5_4* 2o01_4* Back     alignment and structure
>2wsc_3 LHCA3, type II chlorophyll A/B binding protein from photosystem I; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Glycine max} PDB: 2wse_3* 2wsf_3* 3lw5_3* 2o01_3* Back     alignment and structure
>2wsc_2 LHCA2, type II chlorophyll A/B binding protein from photosystem I; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Pisum sativum} PDB: 2wse_2* 2wsf_2* 2o01_2* 3lw5_2* Back     alignment and structure
>3pl9_A Chlorophyll A-B binding protein; CP29, light-harvesting COMP membrane protein, plant, photosynthesis, chloroplast, thyla photosystem II; HET: CLA CHL LUT XAT NEX G3P HTG; 2.80A {Spinacia oleracea} Back     alignment and structure
>2bhw_A Chlorophyll A-B binding protein AB80; LHC-II, photosynthesis, light-harvesting, membrane protein, chloroplast, chromophore, membrane; HET: LUX NEX XAT CLA CHL LHG DGD; 2.50A {Pisum sativum} PDB: 1vcr_A* 1rwt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 272
d2jo6a1108 b.33.1.3 (A:1-108) NADH-nitrite reductase small su 6e-12
d1z01a1148 b.33.1.2 (A:16-163) 2-oxo-1,2-dihydroquinoline 8-m 3e-09
d1fqta_109 b.33.1.1 (A:) Rieske-type ferredoxin associated wi 5e-09
d1vm9a_109 b.33.1.1 (A:) Toluene-4-monooxygenase system prote 5e-08
d3c0da1108 b.33.1.3 (A:4-111) NADH-nitrite reductase small su 4e-07
d2jzaa1122 b.33.1.3 (A:1-122) NADH-nitrite reductase small su 2e-06
d2de6a1142 b.33.1.2 (A:1-142) Terminal oxygenase component of 1e-04
>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure

class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: NirD-like
domain: NADH-nitrite reductase small subunit NirD
species: Escherichia coli [TaxId: 562]

 Score = 59.0 bits (142), Expect = 6e-12
 Identities = 14/84 (16%), Positives = 29/84 (34%), Gaps = 3/84 (3%)

Query: 90  NWVPVVPLSALPKGERRVIIQDGETILLLW--YKDEVFAIENRSPAEGAYS-EGLINAKL 146
            W  +  +  +        +   E + +    + D+VFAI N  P   +      + A+ 
Sbjct: 3   QWKDICKIDDILPETGVCALLGDEQVAIFRPYHSDQVFAISNIDPFFESSVLSRGLIAEH 62

Query: 147 TQDGCIVCPTTESTFDLRTGAVRD 170
             +  +  P  +  F L  G   +
Sbjct: 63  QGELWVASPLKKQRFRLSDGLCME 86
>d1z01a1 b.33.1.2 (A:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]} Length = 148 Back     information, alignment and structure
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]} Length = 109 Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Length = 109 Back     information, alignment and structure
>d3c0da1 b.33.1.3 (A:4-111) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]} Length = 108 Back     information, alignment and structure
>d2jzaa1 b.33.1.3 (A:1-122) NADH-nitrite reductase small subunit NirD {Erwinia carotovora [TaxId: 554]} Length = 122 Back     information, alignment and structure
>d2de6a1 b.33.1.2 (A:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. j3 [TaxId: 213804]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query272
d2de6a1142 Terminal oxygenase component of carbazole CarAa {J 99.92
d1fqta_109 Rieske-type ferredoxin associated with biphenyl di 99.91
d1z01a1148 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygen 99.91
d2jo6a1108 NADH-nitrite reductase small subunit NirD {Escheri 99.9
d2jzaa1122 NADH-nitrite reductase small subunit NirD {Erwinia 99.9
d3c0da1108 NADH-nitrite reductase small subunit NirD {Vibrio 99.9
d1vm9a_109 Toluene-4-monooxygenase system protein C, TmoC {Ps 99.9
d2b1xa1162 Naphthalene 1,2-dioxygenase alpha subunit, N-domai 99.83
d1ulia1154 Biphenyl dioxygenase large subunit BphA1, N-termin 99.83
d2bmoa1150 Nitrobenzene dioxygenase alpha subunit, NBDO-alpha 99.82
d1g8kb_133 Arsenite oxidase Rieske subunit {Alcaligenes faeca 99.69
d1rfsa_127 ISP subunit from chloroplast cytochrome bf complex 99.58
d2e74d1134 ISP subunit from the cytochrome b6f complex, solub 99.54
d1nyka_156 Soluble Rieske protein {Thermus thermophilus [TaxI 99.45
d3cx5e1129 ISP subunit of the mitochondrial cytochrome bc1-co 99.33
d1riea_127 ISP subunit of the mitochondrial cytochrome bc1-co 99.32
d1jm1a_202 Rieske protein II (SoxF) {Archaeon Sulfolobus acid 99.06
d1rwta_218 Chlorophyll a-b binding protein {Spinach (Spinacia 97.15
d1rwta_ 218 Chlorophyll a-b binding protein {Spinach (Spinacia 89.44
>d2de6a1 b.33.1.2 (A:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. j3 [TaxId: 213804]} Back     information, alignment and structure
class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Ring hydroxylating alpha subunit ISP domain
domain: Terminal oxygenase component of carbazole CarAa
species: Janthinobacterium sp. j3 [TaxId: 213804]

Probab=99.92  E-value=2.2e-25  Score=181.27  Aligned_cols=114  Identities=17%  Similarity=0.258  Sum_probs=94.1

Q ss_pred             CCCCccEEeeeCCCCCCCCeEEEEECCeEEEEEEeCCEEEEEcCCCcCCcc-cccCcccccccCCCEEEeCCccceEeCC
Q 024098           86 GGGENWVPVVPLSALPKGERRVIIQDGETILLLWYKDEVFAIENRSPAEGA-YSEGLINAKLTQDGCIVCPTTESTFDLR  164 (272)
Q Consensus        86 ~~~~~W~~v~~~~el~~g~~~~v~~~g~~vvl~r~~g~v~A~~n~CpH~g~-L~~G~v~~~~~~~~~i~CP~Hg~~Fdl~  164 (272)
                      ...+.|+.||.++||++|+.+.+++.|++|+|+|.+|+++|++|.|||+|+ |+.|....   .++.|+||||||+||++
T Consensus        24 ~f~~~W~~v~~~~el~~g~~~~~~i~g~~ivv~r~~g~v~a~~n~CpHrga~L~~g~~~~---~~~~i~Cp~Hgw~fdl~  100 (142)
T d2de6a1          24 GFRNHWYPVMFSKEINEGEPKTLKLLGENLLVNRIDGKLYCLKDRCLHRGVQLSVKVECK---TKSTITCWYHAWTYRWE  100 (142)
T ss_dssp             CBSSEEEEEEEGGGSCBTCCEEEEETTEEEEEEEETTEEEEEESSCTTTCCCGGGGCCCC---STTEEECTTTCEEEETT
T ss_pred             CCcccCEEEEEHHHCCCCCeEEEEECCEEEEEEEcCCEEEEEeCccCCCCccCCcccccc---ccCEEeccceeeEEecc
Confidence            356799999999999999999999999999999999999999999999995 98876421   46789999999999999


Q ss_pred             CCccccCCCCCCcccCCcCCCCcceEEeecccCCCccccccc
Q 024098          165 TGAVRDWYPNNPVMEGGASSDASAEIVFSGKAQPGVTATDVN  206 (272)
Q Consensus       165 tG~~~~~P~~~pl~~~g~~~~~~~v~vFp~k~~~G~i~sdv~  206 (272)
                      ||+|+..|..++....    ....+..|++++..|+++....
T Consensus       101 ~G~~~~~p~~~~~~~~----~~~~l~~y~v~e~~G~I~v~l~  138 (142)
T d2de6a1         101 DGVLCDILTNPTSAQI----GRQKLKTYPVQEAKGCVFIYLG  138 (142)
T ss_dssp             TCBEEEETTCTTCTTT----TSCBCCBCCEEEETTEEEEEES
T ss_pred             CCceEecCCCcccCCc----cccCCCEEeEEEECCEEEEEeC
Confidence            9999998865443211    1224667888888998865543
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]} Back     information, alignment and structure
>d1z01a1 b.33.1.2 (A:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jzaa1 b.33.1.3 (A:1-122) NADH-nitrite reductase small subunit NirD {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d3c0da1 b.33.1.3 (A:4-111) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Back     information, alignment and structure
>d2b1xa1 b.33.1.2 (A:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} Back     information, alignment and structure
>d1ulia1 b.33.1.2 (A:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} Back     information, alignment and structure
>d2bmoa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]} Back     information, alignment and structure
>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rwta_ f.43.1.1 (A:) Chlorophyll a-b binding protein {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1rwta_ f.43.1.1 (A:) Chlorophyll a-b binding protein {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure