Citrus Sinensis ID: 024173

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-

MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSSWWIRYFVQTSLEENEPAVKKFEQAASKKSYKPNCQVFHLKPLR

ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEEccccc

ccccccccccccccccccccHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHEEEccccEEEEEEEccccccHHHHHHHHHHHHHHcccHHHEEcccccccHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccEEEEccccccccccccccEEEEccHHHHccHHHHHHHHHHHHHHHcccEEEEEcccccccEEEccHHHccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccccccEEEEccccc

msrrpvsstrrlvdtgsfpftgalqsksrsspllsVGLVLVGAFLLIGYafsgsgifggdkaAVSRIEGELCLHLvhcdfsctSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKeeeteawgvepydiedaDARCKSLVHKGivrvadikfplpyraksfplVIVSDAldylspkylnktlpdlarvASDGVlifagypgqqRAKVAELskfgrpakmrsssWWIRYFVQTSLEENEPAVKKFEQAAskksykpncqvfhlkplr

msrrpvsstrrlvdtgsfpftgalqsksrsspLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEeeteawgvepydiEDADARCKSLVHKGIVrvadikfplpyraKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELskfgrpakmrsssWWIRYFVQTSLEENEPAVKKFEqaaskksykpncqvfhlkplr

MSRRPVSSTRRLVDTGSFPFTGALQSKSRsspllsvglvlvgaflligYAFSGSGIFGGDKAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSSWWIRYFVQTSLEENEPAVKKFEQAASKKSYKPNCQVFHLKPLR

********************************LLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFG****MRSSSWWIRYFVQTS*********************************

********************************LLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAG********************MRSSSWWIRYFVQTSLEENEPAV****Q*****SYKPNCQVFHLKP**

**********RLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSSWWIRYFVQTSLEENEPAVKKFEQAASKKSYKPNCQVFHLKPLR

*****************************SSPLLSVGLVLVGAFLLIGYAFSGSGIFGGDKAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSSWWIRYFVQTSLEENEPAVKKFEQAASKKSYKPNCQVFHLKP**

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		271	2.2.26 [Sep-21-2011]
Q9M2Y6		261	Uncharacterized protein A	yes	no	0.959	0.996	0.777	1e-117

>sp\|Q9M2Y6\|Y3972_ARATH Uncharacterized protein At3g49720 OS=Arabidopsis thaliana GN=At3g49720 PE=1 SV=1	Back alignment and function desciption

 Score =  420 bits (1079), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/270 (77%), Positives = 231/270 (85%), Gaps = 10/270 (3%)

Query: 1   MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGD 60
           M+RR V STRR+ D GSFPF GAL SKSRSSPLLS+ LVLVGA LLIGYA+SG GIF   
Sbjct: 1   MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60

Query: 61  KAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLK 120
           K  VS++ G         D+SCT+E+QRAIP+LKKAYGD M KVLHVGPDTCSVVS+LLK
Sbjct: 61  KE-VSKVTG---------DYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLK 110

Query: 121 EEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSP 180
           EEETEAWGVEPYDIEDAD+ CKS V KG+VRVADIKFPLPYRAKSF LVIVSDALDYLSP
Sbjct: 111 EEETEAWGVEPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSP 170

Query: 181 KYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSSWWIRYFVQTSLE 240
           KYLNKT+P+LARVASDGV++FAG PGQQRAKVAELSKFGRPAKMRS+SWW R+FVQT+LE
Sbjct: 171 KYLNKTVPELARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSASWWNRFFVQTNLE 230

Query: 241 ENEPAVKKFEQAASKKSYKPNCQVFHLKPL 270
           EN+   KKFEQA SK  YKP CQVFHLKPL
Sbjct: 231 ENDAPSKKFEQAVSKGLYKPACQVFHLKPL 260

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		271
147801370		256	hypothetical protein VITISV_037838 [Viti	0.933	0.988	0.776	1e-116
297819624		261	hypothetical protein ARALYDRAFT_485334 [	0.959	0.996	0.777	1e-115
18408931		261	uncharacterized protein [Arabidopsis tha	0.959	0.996	0.777	1e-115
297797611		258	hypothetical protein ARALYDRAFT_332797 [	0.948	0.996	0.766	1e-114
21593192		258	unknown [Arabidopsis thaliana]	0.948	0.996	0.770	1e-114
18424995		258	uncharacterized protein [Arabidopsis tha	0.948	0.996	0.766	1e-113
449449222		258	PREDICTED: uncharacterized protein At3g4	0.940	0.988	0.761	1e-111
255579521		248	conserved hypothetical protein [Ricinus	0.907	0.991	0.765	1e-110
359493009		263	PREDICTED: uncharacterized protein At3g4	0.955	0.984	0.754	1e-110
224060959		262	predicted protein [Populus trichocarpa]	0.955	0.988	0.727	1e-110

>gi\|147801370\|emb\|CAN74732.1\| hypothetical protein VITISV_037838 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/268 (77%), Positives = 229/268 (85%), Gaps = 15/268 (5%)

Query: 1   MSRRPVSSTRRLVDTGSFPFTGALQSKSRSSPLLSVGLVLVGAFLLIGYAFSGSGIFGGD 60
           MSRR V+ +RR VD+GS PF GAL SKSRSSPLLS+GLVL+GAFLL+ Y++SGS      
Sbjct: 1   MSRRQVNPSRRFVDSGSIPFAGALHSKSRSSPLLSIGLVLLGAFLLVAYSYSGS------ 54

Query: 61  KAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLK 120
                  +  + +H+   DFSCT E+QRAIPILKKAYGDSM KVLHVGPDTCSVVS LLK
Sbjct: 55  -------DSNMSMHV--GDFSCTLEVQRAIPILKKAYGDSMRKVLHVGPDTCSVVSKLLK 105

Query: 121 EEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSP 180
           EEETEAWGVEPYDIEDAD  CKSLV K IVRVADIKFP+PYR KSF LVIVSDALDYLSP
Sbjct: 106 EEETEAWGVEPYDIEDADGSCKSLVRKSIVRVADIKFPMPYRPKSFSLVIVSDALDYLSP 165

Query: 181 KYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSSWWIRYFVQTSLE 240
           KYLNKTLPDLARV+SDG++IFAG PGQQ+AKVAELSKFGRPAKMRSSSWWIRYFVQTSLE
Sbjct: 166 KYLNKTLPDLARVSSDGLVIFAGLPGQQKAKVAELSKFGRPAKMRSSSWWIRYFVQTSLE 225

Query: 241 ENEPAVKKFEQAASKKSYKPNCQVFHLK 268
           ENE A+KKF+QAA+KKSYKP CQVFHL 
Sbjct: 226 ENEAAIKKFDQAAAKKSYKPACQVFHLN 253

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297819624\|ref\|XP_002877695.1\| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] gi\|297323533\|gb\|EFH53954.1\| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|18408931|ref|NP_566924.1| uncharacterized protein [Arabidopsis thaliana] gi|145332799|ref|NP_001078265.1| uncharacterized protein [Arabidopsis thaliana] gi|75183398|sp|Q9M2Y6.1|Y3972_ARATH RecName: Full=Uncharacterized protein At3g49720 gi|6723417|emb|CAB66910.1| hypothetical protein [Arabidopsis thaliana] gi|21593048|gb|AAM64997.1| unknown [Arabidopsis thaliana] gi|222424727|dbj|BAH20317.1| AT3G49720 [Arabidopsis thaliana] gi|332645059|gb|AEE78580.1| uncharacterized protein [Arabidopsis thaliana] gi|332645060|gb|AEE78581.1| uncharacterized protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297797611\|ref\|XP_002866690.1\| hypothetical protein ARALYDRAFT_332797 [Arabidopsis lyrata subsp. lyrata] gi\|297312525\|gb\|EFH42949.1\| hypothetical protein ARALYDRAFT_332797 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|21593192\|gb\|AAM65141.1\| unknown [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|18424995\|ref\|NP_569020.1\| uncharacterized protein [Arabidopsis thaliana] gi\|110737950\|dbj\|BAF00912.1\| hypothetical protein [Arabidopsis thaliana] gi\|194579019\|gb\|ACF75543.1\| At5g65810 [Arabidopsis thaliana] gi\|332010727\|gb\|AED98110.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|449449222|ref|XP_004142364.1| PREDICTED: uncharacterized protein At3g49720-like isoform 1 [Cucumis sativus] gi|449449224|ref|XP_004142365.1| PREDICTED: uncharacterized protein At3g49720-like isoform 2 [Cucumis sativus] gi|449492714|ref|XP_004159079.1| PREDICTED: uncharacterized protein At3g49720-like isoform 1 [Cucumis sativus] gi|449492718|ref|XP_004159080.1| PREDICTED: uncharacterized protein At3g49720-like isoform 2 [Cucumis sativus]

Back alignment and taxonomy information

>gi\|255579521\|ref\|XP_002530603.1\| conserved hypothetical protein [Ricinus communis] gi\|223529851\|gb\|EEF31783.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|359493009\|ref\|XP_002285500.2\| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] gi\|302142150\|emb\|CBI19353.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224060959\|ref\|XP_002300295.1\| predicted protein [Populus trichocarpa] gi\|118484269\|gb\|ABK94014.1\| unknown [Populus trichocarpa] gi\|222847553\|gb\|EEE85100.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		271
TAIR\|locus:2097380		261	AT3G49720 "AT3G49720" [Arabido	0.959	0.996	0.718	2e-97
TAIR\|locus:2156208		258	CGR3 "AT5G65810" [Arabidopsis	0.948	0.996	0.703	6.8e-95

TAIR\|locus:2097380 AT3G49720 "AT3G49720" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 968 (345.8 bits), Expect = 2.0e-97, P = 2.0e-97
 Identities = 194/270 (71%), Positives = 214/270 (79%)

Query:     1 MSRRPVSSTRRLVDTGSFPFTGALQSKSRXXXXXXXXXXXXXXXXXXXYAFSGSGIFGGD 60
             M+RR V STRR+ D GSFPF GAL SKSR                   YA+SG GIF   
Sbjct:     1 MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60

Query:    61 KAAVSRIEGELCLHLVHCDFSCTSEIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLK 120
             K  VS++ G         D+SCT+E+QRAIP+LKKAYGD M KVLHVGPDTCSVVS+LLK
Sbjct:    61 KE-VSKVTG---------DYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLK 110

Query:   121 EEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSP 180
             EEETEAWGVEPYDIEDAD+ CKS V KG+VRVADIKFPLPYRAKSF LVIVSDALDYLSP
Sbjct:   111 EEETEAWGVEPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSP 170

Query:   181 KYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSSWWIRYFVQTSLE 240
             KYLNKT+P+LARVASDGV++FAG PGQQRAKVAELSKFGRPAKMRS+SWW R+FVQT+LE
Sbjct:   171 KYLNKTVPELARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSASWWNRFFVQTNLE 230

Query:   241 ENEPAVKKFEQAASKKSYKPNCQVFHLKPL 270
             EN+   KKFEQA SK  YKP CQVFHLKPL
Sbjct:   231 ENDAPSKKFEQAVSKGLYKPACQVFHLKPL 260

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

GO:0009535 "chloroplast thylakoid membrane" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=IDA

GO:0005774 "vacuolar membrane" evidence=IDA

GO:0016020 "membrane" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005768 "endosome" evidence=IDA

GO:0005802 "trans-Golgi network" evidence=IDA

TAIR\|locus:2156208 CGR3 "AT5G65810" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9M2Y6	Y3972_ARATH	No assigned EC number	0.7777	0.9594	0.9961	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh2_kg.5__1326__AT3G49720.1	annotation not avaliable (261 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		271
PF07021		193	MetW: Methionine biosynthesis protein MetW; InterP	98.6
TIGR02081		194	metW methionine biosynthesis protein MetW. This pr	97.48
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	97.46
TIGR02021		219	BchM-ChlM magnesium protoporphyrin O-methyltransfe	97.44
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	97.4
TIGR03587		204	Pse_Me-ase pseudaminic acid biosynthesis-associate	97.26
PLN02336		475	phosphoethanolamine N-methyltransferase	97.18
PRK07580		230	Mg-protoporphyrin IX methyl transferase; Validated	96.9
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	96.47
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	96.27
smart00828		224	PKS_MT Methyltransferase in polyketide synthase (P	96.26
TIGR00740		239	methyltransferase, putative. A simple BLAST search	96.0
PLN02244		340	tocopherol O-methyltransferase	95.64
PRK10258		251	biotin biosynthesis protein BioC; Provisional	95.61
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	95.31
PRK05785		226	hypothetical protein; Provisional	94.87
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	94.76
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	94.7
PLN02585		315	magnesium protoporphyrin IX methyltransferase	94.69
PRK06202		232	hypothetical protein; Provisional	94.55
PLN02336		475	phosphoethanolamine N-methyltransferase	94.39
TIGR00452		314	methyltransferase, putative. Known examples to dat	94.35
TIGR01983		224	UbiG ubiquinone biosynthesis O-methyltransferase.	94.14
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	94.11
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	93.73
PF08242		99	Methyltransf_12: Methyltransferase domain; InterPr	93.7
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	92.23
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	92.14
PRK05134		233	bifunctional 3-demethylubiquinone-9 3-methyltransf	91.71
PRK11207		197	tellurite resistance protein TehB; Provisional	91.7
PLN02490		340	MPBQ/MSBQ methyltransferase	91.43
PRK08317		241	hypothetical protein; Provisional	91.41
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	91.4
PLN02233		261	ubiquinone biosynthesis methyltransferase	91.37
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	91.15
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	90.54
PRK15068		322	tRNA mo(5)U34 methyltransferase; Provisional	90.24
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	89.94
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	89.35
PF13649		101	Methyltransf_25: Methyltransferase domain; PDB: 3B	88.46
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	87.66
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	87.56
PRK12335		287	tellurite resistance protein TehB; Provisional	87.18
PRK11088		272	rrmA 23S rRNA methyltransferase A; Provisional	86.31
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	85.17
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	85.09
smart00138		264	MeTrc Methyltransferase, chemotaxis proteins. Meth	84.58
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	83.78
PF11899		380	DUF3419: Protein of unknown function (DUF3419); In	81.16

>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins	Back alignment and domain information

Probab=98.60  E-value=3.1e-08  Score=86.70  Aligned_cols=144  Identities=22%  Similarity=0.398  Sum_probs=108.3

Q ss_pred             ccceeeecCCchhHhHhhhccccccccccccccccchhHHHHHHHhhce-eeeeeecCCCC-CCCCCccEEEeccccccc
Q 024173          101 MHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGI-VRVADIKFPLP-YRAKSFPLVIVSDALDYL  178 (271)
Q Consensus       101 M~kVLHVGPdtC~VVs~LLkEe~tEAWGVEPydied~d~~CKsLvrKGi-VRvADIkfpLP-YR~kSFslVivSDaLDyL  178 (271)
                      -.+||++|-......+.|.++.++++.|||-.     +.+..+-|+||+ |--.|+.-.|+ |..+||+.||.|++|..+
T Consensus        14 gsrVLDLGCGdG~LL~~L~~~k~v~g~GvEid-----~~~v~~cv~rGv~Viq~Dld~gL~~f~d~sFD~VIlsqtLQ~~   88 (193)
T PF07021_consen   14 GSRVLDLGCGDGELLAYLKDEKQVDGYGVEID-----PDNVAACVARGVSVIQGDLDEGLADFPDQSFDYVILSQTLQAV   88 (193)
T ss_pred             CCEEEecCCCchHHHHHHHHhcCCeEEEEecC-----HHHHHHHHHcCCCEEECCHHHhHhhCCCCCccEEehHhHHHhH
Confidence            37899999999999999999999999999832     345788899999 99999999997 999999999999999998


Q ss_pred             ChhhhcccccchhhcccCceEEEecCCCchhhhHHhhhhcCCcccc--ccchhHHHHHHHhccccchHHHHHHHHHHhhc
Q 024173          179 SPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKM--RSSSWWIRYFVQTSLEENEPAVKKFEQAASKK  256 (271)
Q Consensus       179 spryLNkTLPeLaRvsadglViF~G~PgqqrakvaelskfgrpaK~--rsssWW~r~F~qt~LeEnE~a~KkFeqa~~k~  256 (271)
                        ++-.+.|-|+.||...+||-|.-+ |--|.+. +|---||--..  =.-+|+-    +-++-  =-.+|-||..+.+.
T Consensus        89 --~~P~~vL~EmlRVgr~~IVsFPNF-g~W~~R~-~l~~~GrmPvt~~lPy~WYd----TPNih--~~Ti~DFe~lc~~~  158 (193)
T PF07021_consen   89 --RRPDEVLEEMLRVGRRAIVSFPNF-GHWRNRL-QLLLRGRMPVTKALPYEWYD----TPNIH--LCTIKDFEDLCREL  158 (193)
T ss_pred             --hHHHHHHHHHHHhcCeEEEEecCh-HHHHHHH-HHHhcCCCCCCCCCCCcccC----CCCcc--cccHHHHHHHHHHC
Confidence              667788999999999999988754 2222332 23323442222  2346652    22221  23578888888876


Q ss_pred             cCC
Q 024173          257 SYK  259 (271)
Q Consensus       257 sY~  259 (271)
                      ..+
T Consensus       159 ~i~  161 (193)
T PF07021_consen  159 GIR  161 (193)
T ss_pred             CCE
Confidence            553

Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, Gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In P. putida, as in Gram-positive bacteria and certain fungi, the second and third steps are a direct sulphydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells [].

>TIGR02081 metW methionine biosynthesis protein MetW	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK05785 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PLN02585 magnesium protoporphyrin IX methyltransferase	Back alignment and domain information

>PRK06202 hypothetical protein; Provisional	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>smart00138 MeTrc Methyltransferase, chemotaxis proteins	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		271
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-08
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	9e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 52.5 bits (125), Expect = 6e-08
 Identities = 45/286 (15%), Positives = 82/286 (28%), Gaps = 90/286 (31%)

Query: 23  ALQSKSRSSPLLSV-GL------VLVGAFLL---IGYAFSGSGIF----GGDKAAVSRIE 68
           AL  + R +  + + G+       +     L   +        IF        +  + +E
Sbjct: 143 ALL-ELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDF-KIFWLNLKNCNSPETVLE 200

Query: 69  G--ELCLHLVHCDFSCTSEIQRAIPI--------LKKAYGDSMHK----VLHVGPDTCSV 114
              +L   +   +++  S+    I +        L++      ++    VL    +  + 
Sbjct: 201 MLQKLLYQID-PNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLL---NVQN- 255

Query: 115 VSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSD- 173
                      A     +++      CK L+     +V D  F          L   S  
Sbjct: 256 -----------AKAWNAFNL-----SCKILLTTRFKQVTD--FLSAATTTHISLDHHSMT 297

Query: 174 -----ALDYLSPKYLNKTLPDLARVASDGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSS 228
                    L  KYL+    DL R            P   R     LS      +   ++
Sbjct: 298 LTPDEVKSLLL-KYLDCRPQDLPREVLT------TNP---RR----LSIIAESIRDGLAT 343

Query: 229 W--WIRYF-------VQTSLEENEPAVKKFEQAASKKSYKPNCQVF 265
           W  W           +++SL   EPA    E    +K +     VF
Sbjct: 344 WDNWKHVNCDKLTTIIESSLNVLEPA----EY---RKMFD-RLSVF 381

PyMOL of 1vt4

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		271
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	97.99
3lcc_A		235	Putative methyl chloride transferase; halide methy	97.79
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	97.72
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	97.65
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	97.65
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	97.62
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	97.61
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	97.61
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	97.6
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	97.57
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	97.53
3cc8_A		230	Putative methyltransferase; structural genomics, j	97.41
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	97.39
3f4k_A		257	Putative methyltransferase; structural genomics, P	97.38
1xxl_A		239	YCGJ protein; structural genomics, protein structu	97.37
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	97.37
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	97.33
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	97.31
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	97.21
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	97.18
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	97.14
2p7i_A		250	Hypothetical protein; putative methyltransferase,	97.13
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	97.02
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	97.01
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	97.01
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	96.95
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	96.92
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	96.9
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	96.89
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	96.84
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	96.84
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	96.81
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	96.74
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	96.69
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	96.68
3ege_A		261	Putative methyltransferase from antibiotic biosyn	96.63
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	96.6
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	96.58
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	96.57
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	96.55
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	96.5
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	96.5
2r3s_A		335	Uncharacterized protein; methyltransferase domain,	96.49
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	96.47
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	96.46
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	96.44
3bkx_A		275	SAM-dependent methyltransferase; YP_807781.1, cycl	96.39
2ip2_A		334	Probable phenazine-specific methyltransferase; pyo	96.36
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	96.34
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	96.33
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	96.33
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	96.31
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	96.3
1qzz_A		374	RDMB, aclacinomycin-10-hydroxylase; anthracycline,	96.28
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	96.26
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	96.25
1tw3_A		360	COMT, carminomycin 4-O-methyltransferase; anthracy	96.2
3mcz_A		352	O-methyltransferase; adomet_mtases, S-adenosylmeth	96.08
3i9f_A		170	Putative type 11 methyltransferase; structural gen	96.07
2g72_A		289	Phenylethanolamine N-methyltransferase; HET: SAM F	96.01
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	96.01
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	96.01
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	95.97
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	95.89
3dp7_A		363	SAM-dependent methyltransferase; structural genomi	95.86
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	95.85
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	95.85
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	95.83
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	95.77
2qe6_A		274	Uncharacterized protein TFU_2867; putative methylt	95.71
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	95.64
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	95.59
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	95.55
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	95.43
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	95.35
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	95.34
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	95.27
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	95.19
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	95.15
3gwz_A		369	MMCR; methyltransferase, mitomycin, S-adenosyl met	95.12
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	95.08
3i53_A		332	O-methyltransferase; CO-complex, rossmann-like fol	95.08
3lst_A		348	CALO1 methyltransferase; calicheamicin, enediyne,	94.79
1x19_A		359	CRTF-related protein; methyltransferase, bacterioc	94.66
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	94.59
1fp2_A		352	Isoflavone O-methyltransferase; protein-product co	94.56
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	94.42
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	94.42
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	94.34
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	94.16
3ocj_A		305	Putative exported protein; structural genomics, PS	94.12
1fp1_D		372	Isoliquiritigenin 2'-O-methyltransferase; protein-	94.06
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	93.98
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	93.9
1ne2_A		200	Hypothetical protein TA1320; structural genomics,	93.68
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	93.09
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	93.09
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	92.68
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	92.53
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	92.36
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	92.11
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	91.94
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	91.86
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	91.57
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	91.56
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	91.56
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	91.47
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	91.01
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	90.65
1zg3_A		358	Isoflavanone 4'-O-methyltransferase; rossman fold,	89.92
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	89.66
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	89.46
2esr_A		177	Methyltransferase; structural genomics, hypothetic	89.37
2ld4_A		176	Anamorsin; methyltransferase-like fold, alpha/beta	89.02
2pt6_A		321	Spermidine synthase; transferase, structural genom	88.91
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	88.89
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	88.84
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	88.76
2b3t_A		276	Protein methyltransferase HEMK; translation termin	88.71
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	88.5
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	88.35
3reo_A		368	(ISO)eugenol O-methyltransferase; directed evoluti	88.33
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	88.23
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	88.14
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	88.02
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	87.76
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	87.65
2o07_A		304	Spermidine synthase; structural genomics, structur	87.41
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	87.4
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	87.39
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	86.82
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	86.54
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	86.49
1ws6_A		171	Methyltransferase; structural genomics, riken stru	86.48
2y1w_A		348	Histone-arginine methyltransferase CARM1; histone	86.39
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	86.37
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	86.22
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	86.19
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	86.01
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	85.7
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	85.44
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	85.38
2bm8_A		236	Cephalosporin hydroxylase CMCI; cephamycin biosynt	85.23
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	85.04
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	84.75
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	84.53
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	84.45
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	84.39
1uwv_A		433	23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m	84.35
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	83.43
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	83.43
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	83.33
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	83.28
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	83.05
2qm3_A		373	Predicted methyltransferase; putative methyltransf	82.46
2b25_A		336	Hypothetical protein; structural genomics, methyl	81.78
3p9c_A		364	Caffeic acid O-methyltransferase; S-adenosylmethio	81.73
2i7c_A		283	Spermidine synthase; transferase, structural genom	81.62
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	80.99
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	80.98
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	80.65
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	80.52

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

Probab=97.99  E-value=1e-05  Score=62.06  Aligned_cols=136  Identities=15%  Similarity=0.097  Sum_probs=95.0

Q ss_pred             ccceeeecCCchhHhHhhhccccccccccccccccchhHHHHHHHhhceeeeeeecCCCCCCCCCccEEEecccccccCh
Q 024173          101 MHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVHKGIVRVADIKFPLPYRAKSFPLVIVSDALDYLSP  180 (271)
Q Consensus       101 M~kVLHVGPdtC~VVs~LLkEe~tEAWGVEPydied~d~~CKsLvrKGiVRvADIkfpLPYR~kSFslVivSDaLDyLsp  180 (271)
                      -.+||.||-.+......|.+. ..+..|||+.+  +.-..++....+--+..+|+. .+|+...+|++|+..++|.|+++
T Consensus        42 ~~~vLDiGcG~G~~~~~l~~~-~~~v~gvD~s~--~~~~~a~~~~~~~~~~~~d~~-~~~~~~~~fD~v~~~~~l~~~~~  117 (203)
T 3h2b_A           42 DGVILDVGSGTGRWTGHLASL-GHQIEGLEPAT--RLVELARQTHPSVTFHHGTIT-DLSDSPKRWAGLLAWYSLIHMGP  117 (203)
T ss_dssp             CSCEEEETCTTCHHHHHHHHT-TCCEEEECCCH--HHHHHHHHHCTTSEEECCCGG-GGGGSCCCEEEEEEESSSTTCCT
T ss_pred             CCeEEEecCCCCHHHHHHHhc-CCeEEEEeCCH--HHHHHHHHhCCCCeEEeCccc-ccccCCCCeEEEEehhhHhcCCH
Confidence            468999999999987777766 56889998753  222233332223345667764 46777899999999999999998


Q ss_pred             hhhcccccchhhccc-CceEEEecCCCchhhhHHhhhhcCCccccccchhHHHHHHHhccccch
Q 024173          181 KYLNKTLPDLARVAS-DGVLIFAGYPGQQRAKVAELSKFGRPAKMRSSSWWIRYFVQTSLEENE  243 (271)
Q Consensus       181 ryLNkTLPeLaRvsa-dglViF~G~PgqqrakvaelskfgrpaK~rsssWW~r~F~qt~LeEnE  243 (271)
                      ..+.+.|-++.|+-. +|.++++-..+..   ..++.....+....+...|.+.+.++|++.-+
T Consensus       118 ~~~~~~l~~~~~~L~pgG~l~i~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~l~~~Gf~~~~  178 (203)
T 3h2b_A          118 GELPDALVALRMAVEDGGGLLMSFFSGPS---LEPMYHPVATAYRWPLPELAQALETAGFQVTS  178 (203)
T ss_dssp             TTHHHHHHHHHHTEEEEEEEEEEEECCSS---CEEECCSSSCEEECCHHHHHHHHHHTTEEEEE
T ss_pred             HHHHHHHHHHHHHcCCCcEEEEEEccCCc---hhhhhchhhhhccCCHHHHHHHHHHCCCcEEE
Confidence            888899999999765 5666665533322   22233333344567788899999999987543

PyMOL of 3h2b

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme}	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei}	Back alignment and structure

>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa}	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A*	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A*	Back alignment and structure

>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus}	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca}	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A*	Back alignment and structure

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A*	Back alignment and structure

>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora}	Back alignment and structure

>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A*	Back alignment and structure

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana}	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A*	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A*	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A*	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A*	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A*	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A*	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		271
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	97.55
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	97.45
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	97.45
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	97.18
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	96.97
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	96.96
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	96.49
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	96.41
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	96.24
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	96.14
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	95.93
d1tw3a2		253	Carminomycin 4-O-methyltransferase {Streptomyces p	95.88
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	95.73
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	95.57
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	95.5
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	95.03
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	94.41
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	93.91
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	92.45
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	91.38
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	89.47
d1qzza2		256	Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu	87.76
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	87.7
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	85.76
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	81.04
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	80.9

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: CAC2371-like
domain: Hypothetical protein PH0226
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

Probab=97.55  E-value=0.00011  Score=54.77  Aligned_cols=113  Identities=25%  Similarity=0.316  Sum_probs=78.9

Q ss_pred             HHHhHhHHHHHHhcccccceeeecCCchhHhHhhhccccccccccccccccchhHHHHHHHh-hc---eeeeeeecCCCC
Q 024173           85 EIQRAIPILKKAYGDSMHKVLHVGPDTCSVVSTLLKEEETEAWGVEPYDIEDADARCKSLVH-KG---IVRVADIKFPLP  160 (271)
Q Consensus        85 eV~~AiP~LkkaYGdsM~kVLHVGPdtC~VVs~LLkEe~tEAWGVEPydied~d~~CKsLvr-KG---iVRvADIkfpLP  160 (271)
                      +..+--|++++--.+. .+||-||-.|-...-.|-+ ...+.+|+++.  ++.-..||.... +|   ....+|+. -||
T Consensus        23 ~~~~~~~~~~~~l~~~-~~ILDiGcG~G~~~~~la~-~~~~v~giD~S--~~~i~~ak~~~~~~~~~~~~~~~d~~-~l~   97 (226)
T d1ve3a1          23 RIETLEPLLMKYMKKR-GKVLDLACGVGGFSFLLED-YGFEVVGVDIS--EDMIRKAREYAKSRESNVEFIVGDAR-KLS   97 (226)
T ss_dssp             HHHHHHHHHHHSCCSC-CEEEEETCTTSHHHHHHHH-TTCEEEEEESC--HHHHHHHHHHHHHTTCCCEEEECCTT-SCC
T ss_pred             HHHHHHHHHHHhcCCC-CEEEEECCCcchhhhhHhh-hhccccccccc--ccchhhhhhhhccccccccccccccc-ccc
Confidence            4555566776643443 4799999999887665554 46688998864  333444544432 23   23344443 378


Q ss_pred             CCCCCccEEEecccccccChhhhcccccchhhccc-CceEEEe
Q 024173          161 YRAKSFPLVIVSDALDYLSPKYLNKTLPDLARVAS-DGVLIFA  202 (271)
Q Consensus       161 YR~kSFslVivSDaLDyLspryLNkTLPeLaRvsa-dglViF~  202 (271)
                      +...||++|+..+.+.|+++.-+++.|=++.|+-. +|..|+.
T Consensus        98 ~~~~~fD~I~~~~~l~~~~~~d~~~~l~~i~~~LkpgG~lii~  140 (226)
T d1ve3a1          98 FEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFIMY  140 (226)
T ss_dssp             SCTTCEEEEEEESCGGGCCHHHHHHHHHHHHHHEEEEEEEEEE
T ss_pred             ccCcCceEEEEecchhhCChhHHHHHHHHHHHHcCcCcEEEEE
Confidence            88899999999999999999999999999999855 4555543

PyMOL of d1ve3a1

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure