Citrus Sinensis ID: 024249

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270

MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETEKNMSLRKLWK

cccccccccccccccccHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccEEcccccccHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHcc

ccccccccccHHHHccHHHHHHHHHHHHHcccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHccccEEEEEcHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEcHHHccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHccccccccEEEEcccc

mkvekvpdstydmIGGLDQQIKEIKEVIelpikhpelfeslgiaqpkgvllygppgtgkTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREhapsiifmDEIDSIGSarmesgsgngdsEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDqallrpgridrkiefpnpneesrLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETEKNMSLRKLWK

mkvekvpdstydmigGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDctfirvsgseLVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMAtnridildqallrpgridrkiefpnpneesrldiLKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMkketeknmslrklwk

**********YDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEID*********************MLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEF********LDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVA******************

****KVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS**************QRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVA************LRKLWK

********STYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSAR**********EVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKK*************

*****VPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA*********DSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKET*KNMS******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		270	2.2.26 [Sep-21-2011]
Q94BQ2		419	26S protease regulatory s	yes	no	1.0	0.644	0.985	1e-156
Q9C5U3		419	26S protease regulatory s	yes	no	1.0	0.644	0.985	1e-156
P62198		406	26S protease regulatory s	yes	no	0.996	0.662	0.877	1e-139
P62197		406	26S protease regulatory s	yes	no	0.996	0.662	0.877	1e-139
P62196		406	26S protease regulatory s	yes	no	0.996	0.662	0.877	1e-139
P62195		406	26S protease regulatory s	yes	no	0.996	0.662	0.877	1e-139
P62194		406	26S protease regulatory s	yes	no	0.996	0.662	0.877	1e-139
P54814		402	26S protease regulatory s	N/A	no	0.996	0.669	0.874	1e-139
O18413		405	26S protease regulatory s	yes	no	0.996	0.664	0.874	1e-139
Q25544		414	26S protease regulatory s	N/A	no	1.0	0.652	0.855	1e-137

>sp\|Q94BQ2\|PRS8B_ARATH 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=2 SV=1	Back alignment and function desciption

 Score =  550 bits (1418), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/270 (98%), Positives = 269/270 (99%)

Query: 1   MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT 60
           MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT
Sbjct: 150 MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT 209

Query: 61  LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA 120
           LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA
Sbjct: 210 LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA 269

Query: 121 RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE 180
           RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE
Sbjct: 270 RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE 329

Query: 181 FPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRI 240
           FPNPNEESR DILKIHSR+MNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+
Sbjct: 330 FPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRV 389

Query: 241 HVTQEDFEMAVAKVMKKETEKNMSLRKLWK 270
           HVTQEDFEMAVAKVMKK+TEKNMSLRKLWK
Sbjct: 390 HVTQEDFEMAVAKVMKKDTEKNMSLRKLWK 419

The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9C5U3\|PRS8A_ARATH 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=2 SV=1	Back alignment and function description

>sp\|P62198\|PRS8_RAT 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1	Back alignment and function description

>sp\|P62197\|PRS8_PIG 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1	Back alignment and function description

>sp\|P62196\|PRS8_MOUSE 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1	Back alignment and function description

>sp\|P62195\|PRS8_HUMAN 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1	Back alignment and function description

>sp\|P62194\|PRS8_BOVIN 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1	Back alignment and function description

>sp\|P54814\|PRS8_MANSE 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1	Back alignment and function description

>sp\|O18413\|PRS8_DROME 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Pros45 PE=1 SV=2	Back alignment and function description

>sp\|Q25544\|PRS8_NAEFO 26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		270
442539518		417	26S proteasome ATPase regulatory subunit	1.0	0.647	0.992	1e-155
359806735		418	uncharacterized protein LOC100812783 [Gl	1.0	0.645	0.996	1e-155
442539516		417	26S proteasome ATPase regulatory subunit	1.0	0.647	0.988	1e-155
225430151		420	PREDICTED: 26S protease regulatory subun	1.0	0.642	0.985	1e-155
297808061		419	ATSUG1 [Arabidopsis lyrata subsp. lyrata	1.0	0.644	0.985	1e-154
449464342		418	PREDICTED: 26S protease regulatory subun	1.0	0.645	0.981	1e-154
15241241		419	AAA-type ATPase family protein [Arabidop	1.0	0.644	0.985	1e-154
18420092		419	regulatory particle triple-A ATPase 6A [	1.0	0.644	0.985	1e-154
6652888		405	26S proteasome AAA-ATPase subunit RPT6a	1.0	0.666	0.985	1e-154
297808063		419	ATSUG1 [Arabidopsis lyrata subsp. lyrata	1.0	0.644	0.985	1e-154

>gi\|442539518\|gb\|AGC54442.1\| 26S proteasome ATPase regulatory subunit 6 [Nicotiana tabacum]	Back alignment and taxonomy information

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/270 (99%), Positives = 270/270 (100%)

Query: 1   MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT 60
           MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT
Sbjct: 148 MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT 207

Query: 61  LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA 120
           LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA
Sbjct: 208 LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA 267

Query: 121 RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE 180
           RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE
Sbjct: 268 RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE 327

Query: 181 FPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRI 240
           FPNPNEESRLDILKIHSR+MNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+
Sbjct: 328 FPNPNEESRLDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRV 387

Query: 241 HVTQEDFEMAVAKVMKKETEKNMSLRKLWK 270
           HVTQEDFEMAVAKVMKKETEKNMSLRKLWK
Sbjct: 388 HVTQEDFEMAVAKVMKKETEKNMSLRKLWK 417

Source: Nicotiana tabacum

Species: Nicotiana tabacum

Genus: Nicotiana

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359806735\|ref\|NP_001241552.1\| uncharacterized protein LOC100812783 [Glycine max] gi\|255639529\|gb\|ACU20059.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|442539516\|gb\|AGC54441.1\| 26S proteasome ATPase regulatory subunit 6 [Capsicum annuum]	Back alignment and taxonomy information

>gi\|225430151\|ref\|XP_002284747.1\| PREDICTED: 26S protease regulatory subunit 8 homolog A [Vitis vinifera] gi\|296081963\|emb\|CBI20968.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297808061\|ref\|XP_002871914.1\| ATSUG1 [Arabidopsis lyrata subsp. lyrata] gi\|297317751\|gb\|EFH48173.1\| ATSUG1 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449464342\|ref\|XP_004149888.1\| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cucumis sativus] gi\|449521908\|ref\|XP_004167971.1\| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|15241241|ref|NP_197500.1| AAA-type ATPase family protein [Arabidopsis thaliana] gi|75165109|sp|Q94BQ2.1|PRS8B_ARATH RecName: Full=26S protease regulatory subunit 8 homolog B; AltName: Full=26S proteasome AAA-ATPase subunit RPT6b; AltName: Full=26S proteasome subunit 8 homolog B; AltName: Full=Regulatory particle triple-A ATPase subunit 6b gi|14532682|gb|AAK64142.1| putative 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis thaliana] gi|19310807|gb|AAL85134.1| putative 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis thaliana] gi|21593097|gb|AAM65046.1| 26S proteasome AAA-ATPase subunit RPT6a-like protein [Arabidopsis thaliana] gi|110740531|dbj|BAE98371.1| 26S proteasome AAA-ATPase subunit RPT6a - like protein [Arabidopsis thaliana] gi|332005395|gb|AED92778.1| AAA-type ATPase family protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi|18420092|ref|NP_568389.1| regulatory particle triple-A ATPase 6A [Arabidopsis thaliana] gi|75168996|sp|Q9C5U3.1|PRS8A_ARATH RecName: Full=26S protease regulatory subunit 8 homolog A; AltName: Full=26S proteasome AAA-ATPase subunit RPT6a; AltName: Full=26S proteasome subunit 8 homolog A; AltName: Full=Regulatory particle triple-A ATPase subunit 6a gi|13537115|dbj|BAB40755.1| AtSUG1 [Arabidopsis thaliana] gi|17473854|gb|AAL38350.1| unknown protein [Arabidopsis thaliana] gi|32306505|gb|AAP78936.1| At5g19990 [Arabidopsis thaliana] gi|332005394|gb|AED92777.1| regulatory particle triple-A ATPase 6A [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|6652888\|gb\|AAF22526.1\|AF123395_1 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297808063\|ref\|XP_002871915.1\| ATSUG1 [Arabidopsis lyrata subsp. lyrata] gi\|297317752\|gb\|EFH48174.1\| ATSUG1 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		270
TAIR\|locus:2147670		419	RPT6A "regulatory particle tri	1.0	0.644	0.985	5.1e-138
TAIR\|locus:2147685		419	AT5G20000 [Arabidopsis thalian	1.0	0.644	0.985	5.1e-138
DICTYBASE\|DDB_G0292382		403	psmC5 "HIV TAT binding-protein	1.0	0.669	0.885	1.4e-126
UNIPROTKB\|F1NU79		412	PSMC5 "Uncharacterized protein	0.996	0.652	0.877	3e-124
UNIPROTKB\|P62194		406	PSMC5 "26S protease regulatory	0.996	0.662	0.877	3e-124
UNIPROTKB\|P62195		406	PSMC5 "26S protease regulatory	0.996	0.662	0.877	3e-124
UNIPROTKB\|P62197		406	PSMC5 "26S protease regulatory	0.996	0.662	0.877	3e-124
UNIPROTKB\|Q4RG45		406	GSTENG00035021001 "Chromosome	0.996	0.662	0.877	3e-124
UNIPROTKB\|Q6AZU7		414	Q6AZU7 "Putative uncharacteriz	0.996	0.649	0.877	3e-124
UNIPROTKB\|Q6P380		414	psmc5 "Putative uncharacterize	0.996	0.649	0.877	3e-124

TAIR\|locus:2147670 RPT6A "regulatory particle triple-A ATPase 6A" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1351 (480.6 bits), Expect = 5.1e-138, P = 5.1e-138
 Identities = 266/270 (98%), Positives = 269/270 (99%)

Query:     1 MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT 60
             MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT
Sbjct:   150 MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT 209

Query:    61 LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA 120
             LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA
Sbjct:   210 LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA 269

Query:   121 RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE 180
             RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE
Sbjct:   270 RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE 329

Query:   181 FPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRI 240
             FPNPNEESR DILKIHSR+MNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+
Sbjct:   330 FPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRV 389

Query:   241 HVTQEDFEMAVAKVMKKETEKNMSLRKLWK 270
             HVTQEDFEMAVAKVMKK+TEKNMSLRKLWK
Sbjct:   390 HVTQEDFEMAVAKVMKKDTEKNMSLRKLWK 419

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM;TAS

GO:0005737 "cytoplasm" evidence=IEA

GO:0016787 "hydrolase activity" evidence=IEA

GO:0016887 "ATPase activity" evidence=IGI;ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0030163 "protein catabolic process" evidence=IEA

GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS

GO:0005886 "plasma membrane" evidence=IDA

GO:0000502 "proteasome complex" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0008540 "proteasome regulatory particle, base subcomplex" evidence=IDA

TAIR\|locus:2147685 AT5G20000 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0292382 psmC5 "HIV TAT binding-protein-related" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NU79 PSMC5 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|P62194 PSMC5 "26S protease regulatory subunit 8" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P62195 PSMC5 "26S protease regulatory subunit 8" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|P62197 PSMC5 "26S protease regulatory subunit 8" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4RG45 GSTENG00035021001 "Chromosome 2 SCAF15106, whole genome shotgun sequence." [Tetraodon nigroviridis (taxid:99883)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6AZU7 Q6AZU7 "Putative uncharacterized protein" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6P380 psmc5 "Putative uncharacterized protein MGC75584" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
A4G0S4	PAN_METM5	No assigned EC number	0.5559	0.9851	0.6535	yes	no
Q9C5U3	PRS8A_ARATH	No assigned EC number	0.9851	1.0	0.6443	yes	no
P34124	PRS8_DICDI	No assigned EC number	0.8851	1.0	0.6699	yes	no
O28303	PAN_ARCFU	No assigned EC number	0.6061	0.9555	0.6482	yes	no
O57940	PAN_PYRHO	No assigned EC number	0.6309	0.9259	0.6265	yes	no
Q25544	PRS8_NAEFO	No assigned EC number	0.8555	1.0	0.6521	N/A	no
Q9V287	PAN_PYRAB	No assigned EC number	0.6269	0.9259	0.6313	yes	no
Q8U4H3	PAN_PYRFU	No assigned EC number	0.6269	0.9259	0.6313	yes	no
P41836	PRS8_SCHPO	No assigned EC number	0.8407	1.0	0.6699	yes	no
Q8SQK0	PRS8_ENCCU	No assigned EC number	0.8296	0.9962	0.5938	yes	no
Q6LWR0	PAN_METMP	No assigned EC number	0.5522	0.9851	0.6535	yes	no
O26824	PAN_METTH	No assigned EC number	0.5862	0.9629	0.6341	yes	no
Q01939	PRS8_YEAST	No assigned EC number	0.8222	0.9962	0.6641	yes	no
Q5JHS5	PAN_PYRKO	No assigned EC number	0.6190	0.9259	0.6297	yes	no
A9A916	PAN_METM6	No assigned EC number	0.5559	0.9851	0.6535	yes	no
P54814	PRS8_MANSE	No assigned EC number	0.8740	0.9962	0.6691	N/A	no
O18413	PRS8_DROME	No assigned EC number	0.8740	0.9962	0.6641	yes	no
Q8TX03	PAN_METKA	No assigned EC number	0.6022	0.9925	0.6146	yes	no
Q94BQ2	PRS8B_ARATH	No assigned EC number	0.9851	1.0	0.6443	yes	no
B6YXR2	PAN_THEON	No assigned EC number	0.6230	0.9259	0.6281	yes	no
P62198	PRS8_RAT	No assigned EC number	0.8777	0.9962	0.6625	yes	no
P62194	PRS8_BOVIN	No assigned EC number	0.8777	0.9962	0.6625	yes	no
P62195	PRS8_HUMAN	No assigned EC number	0.8777	0.9962	0.6625	yes	no
P62196	PRS8_MOUSE	No assigned EC number	0.8777	0.9962	0.6625	yes	no
P62197	PRS8_PIG	No assigned EC number	0.8777	0.9962	0.6625	yes	no
C5A6P8	PAN_THEGJ	No assigned EC number	0.6190	0.9259	0.6297	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.21	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00032563001	SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (420 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00014791001	SubName- Full=Putative uncharacterized protein (Chromosome chr18 scaffold_1, whole genome shotg [...] (309 aa)		•	•	•	•	0.851
	GSVIVG00010470001	SubName- Full=Chromosome chr17 scaffold_263, whole genome shotgun sequence; (386 aa)		•	•	•	•	0.820
	GSVIVG00036762001	SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (440 aa)		•	•	•	•	0.805
	GSVIVG00024499001	RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (245 aa)		•	•	•	•	0.705
	GSVIVG00015420001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (191 aa)	•	•	•	•		0.688
	GSVIVG00034204001	RecName- Full=Ubiquitin carboxyl-terminal hydrolase; EC=3.1.2.15; (479 aa)		•	•		•	0.663
	GSVIVG00015634001	SubName- Full=Chromosome chr2 scaffold_11, whole genome shotgun sequence; (365 aa)		•	•	•	•	0.652
	GSVIVG00018640001	SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (629 aa)		•	•	•	•	0.645
	GSVIVG00006696001	SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (267 aa)		•	•	•	•	0.628
	GSVIVG00031868001	SubName- Full=Chromosome undetermined scaffold_60, whole genome shotgun sequence; (1005 aa)		•	•	•	•	0.621

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		270
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	1e-176
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	1e-158
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	1e-127
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	1e-125
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	1e-112
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	1e-82
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	2e-81
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	7e-77
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	6e-73
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	3e-69
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	4e-68
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	1e-59
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	1e-54
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	2e-53
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	1e-48
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	2e-43
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	5e-26
CHL00195		489	CHL00195, ycf46, Ycf46; Provisional	1e-20
smart00382		148	smart00382, AAA, ATPases associated with a variety	3e-18
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	4e-09
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	5e-09
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	1e-08
pfam07728		135	pfam07728, AAA_5, AAA domain (dynein-related subfa	9e-07
PHA02544		316	PHA02544, 44, clamp loader, small subunit; Provisi	9e-07
TIGR03922		557	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas	1e-06
TIGR02928		365	TIGR02928, TIGR02928, orc1/cdc6 family replication	1e-06
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	1e-06
PRK13341		725	PRK13341, PRK13341, recombination factor protein R	2e-05
pfam07726		131	pfam07726, AAA_3, ATPase family associated with va	2e-05
pfam07724		168	pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	2e-05
cd00267		157	cd00267, ABC_ATPase, ATP-binding cassette transpor	4e-05
pfam13191		154	pfam13191, AAA_16, AAA ATPase domain	8e-05
COG1484		254	COG1484, DnaC, DNA replication protein [DNA replic	9e-05
TIGR00382		413	TIGR00382, clpX, endopeptidase Clp ATP-binding reg	1e-04
COG1224		450	COG1224, TIP49, DNA helicase TIP49, TBP-interactin	6e-04
TIGR00635		305	TIGR00635, ruvB, Holliday junction DNA helicase, R	7e-04
pfam13481		154	pfam13481, AAA_25, AAA domain	0.002
pfam06068		395	pfam06068, TIP49, TIP49 C-terminus	0.002
PRK00080		328	PRK00080, ruvB, Holliday junction DNA helicase Ruv	0.003
COG1219		408	COG1219, ClpX, ATP-dependent protease Clp, ATPase	0.003
TIGR00763		775	TIGR00763, lon, ATP-dependent protease La	0.003
pfam01057		271	pfam01057, Parvo_NS1, Parvovirus non-structural pr	0.003
COG1474		366	COG1474, CDC6, Cdc6-related protein, AAA superfami	0.004

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

 Score =  491 bits (1265), Expect = e-176
 Identities = 185/268 (69%), Positives = 222/268 (82%), Gaps = 1/268 (0%)

Query: 1   MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKT 60
           M+VE+ PD TY+ IGGLD+QI+EI+EV+ELP+K+PELFE LGI  PKGVLLYGPPGTGKT
Sbjct: 140 MEVEEKPDVTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKT 199

Query: 61  LLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA 120
           LLA+AVA+ TD TFIRV GSELVQKYIGEG+R+VRELF +ARE APSIIF+DEID+IG+ 
Sbjct: 200 LLAKAVANQTDATFIRVVGSELVQKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAK 259

Query: 121 RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIE 180
           R +SG+  GD EVQRTMLELLNQLDGF+    +KV+MATNR DILD ALLRPGR DRKIE
Sbjct: 260 RFDSGTS-GDREVQRTMLELLNQLDGFDPRGNVKVIMATNRPDILDPALLRPGRFDRKIE 318

Query: 181 FPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRI 240
           FP P+EE R +ILKIH+R+MNL   +DL+ +A    G SGA+LKA+CTEAGMFA+RERR 
Sbjct: 319 FPLPDEEGRAEILKIHTRKMNLADDVDLELLARLTEGFSGADLKAICTEAGMFAIRERRD 378

Query: 241 HVTQEDFEMAVAKVMKKETEKNMSLRKL 268
            VT EDF  AV KV+KK+ + + + R L
Sbjct: 379 EVTMEDFLKAVEKVVKKKKKLSSTARYL 406

Length = 406

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|177094 CHL00195, ycf46, Ycf46; Provisional	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily)	Back alignment and domain information

>gnl\|CDD\|222866 PHA02544, 44, clamp loader, small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA	Back alignment and domain information

>gnl\|CDD\|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	Back alignment and domain information

>gnl\|CDD\|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain	Back alignment and domain information

>gnl\|CDD\|221970 pfam13191, AAA_16, AAA ATPase domain	Back alignment and domain information

>gnl\|CDD\|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>gnl\|CDD\|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>gnl\|CDD\|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>gnl\|CDD\|222165 pfam13481, AAA_25, AAA domain	Back alignment and domain information

>gnl\|CDD\|147949 pfam06068, TIP49, TIP49 C-terminus	Back alignment and domain information

>gnl\|CDD\|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>gnl\|CDD\|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233119 TIGR00763, lon, ATP-dependent protease La	Back alignment and domain information

>gnl\|CDD\|216270 pfam01057, Parvo_NS1, Parvovirus non-structural protein NS1	Back alignment and domain information

>gnl\|CDD\|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		270
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	100.0
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0736		953	consensus Peroxisome assembly factor 2 containing	100.0
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	100.0
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	100.0
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	100.0
PRK03992		389	proteasome-activating nucleotidase; Provisional	100.0
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	100.0
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	100.0
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	100.0
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	100.0
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	100.0
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	100.0
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	100.0
CHL00195		489	ycf46 Ycf46; Provisional	100.0
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	100.0
CHL00176		638	ftsH cell division protein; Validated	100.0
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	100.0
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	100.0
CHL00206		2281	ycf2 Ycf2; Provisional	100.0
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	100.0
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	100.0
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	100.0
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	99.93
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.92
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.91
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.9
CHL00181		287	cbbX CbbX; Provisional	99.9
KOG0736		953	consensus Peroxisome assembly factor 2 containing	99.9
PF00004		132	AAA: ATPase family associated with various cellula	99.9
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.89
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.89
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.84
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.83
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.83
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.83
PRK04195		482	replication factor C large subunit; Provisional	99.82
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.81
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.81
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.8
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.79
PHA02544		316	44 clamp loader, small subunit; Provisional	99.77
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.77
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.77
PRK12402		337	replication factor C small subunit 2; Reviewed	99.77
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.77
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.77
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.77
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.76
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.76
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.76
PLN03025		319	replication factor C subunit; Provisional	99.76
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.76
PRK13342		413	recombination factor protein RarA; Reviewed	99.75
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.75
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.74
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.74
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.73
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.73
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.73
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.73
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.73
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.73
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.72
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.72
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.72
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.72
PRK06893		229	DNA replication initiation factor; Validated	99.72
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.72
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.72
PRK10865		857	protein disaggregation chaperone; Provisional	99.71
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.71
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.71
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.71
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.7
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.7
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.7
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.7
CHL00095		821	clpC Clp protease ATP binding subunit	99.7
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.69
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.69
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.69
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.68
PRK12422		445	chromosomal replication initiation protein; Provis	99.68
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.68
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.68
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.68
PRK08727		233	hypothetical protein; Validated	99.68
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.68
PRK08084		235	DNA replication initiation factor; Provisional	99.68
PRK13341		725	recombination factor protein RarA/unknown domain f	99.67
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.67
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	99.66
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.66
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.66
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.66
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.65
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.65
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	99.65
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.65
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.65
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.64
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.63
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.63
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	99.63
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.63
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.62
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.62
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	99.62
KOG1969		877	consensus DNA replication checkpoint protein CHL12	99.62
COG2884		223	FtsE Predicted ATPase involved in cell division [C	99.61
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.61
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	99.6
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.6
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.6
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.59
PRK05642		234	DNA replication initiation factor; Validated	99.59
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.57
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.56
cd03216		163	ABC_Carb_Monos_I This family represents the domain	99.54
PRK06620		214	hypothetical protein; Validated	99.54
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.53
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.53
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.53
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.52
KOG2028		554	consensus ATPase related to the helicase subunit o	99.52
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	99.52
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	99.52
COG1127		263	Ttg2A ABC-type transport system involved in resist	99.52
PRK09087		226	hypothetical protein; Validated	99.52
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	99.51
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.5
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	99.5
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.5
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.49
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	99.49
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	99.49
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	99.49
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	99.49
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	99.49
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.48
COG0593		408	DnaA ATPase involved in DNA replication initiation	99.48
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	99.48
COG4619		223	ABC-type uncharacterized transport system, ATPase	99.47
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.47
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	99.47
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	99.47
PRK13537		306	nodulation ABC transporter NodI; Provisional	99.47
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	99.47
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.46
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	99.46
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	99.46
cd03246		173	ABCC_Protease_Secretion This family represents the	99.46
COG3638		258	ABC-type phosphate/phosphonate transport system, A	99.46
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	99.45
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	99.45
cd03269		210	ABC_putative_ATPase This subfamily is involved in	99.45
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	99.45
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.45
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	99.44
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	99.44
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	99.44
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	99.44
PRK13536		340	nodulation factor exporter subunit NodI; Provision	99.44
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	99.44
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	99.43
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	99.43
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	99.43
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.43
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	99.43
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	99.43
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	99.43
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	99.43
PRK09112		351	DNA polymerase III subunit delta'; Validated	99.42
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	99.42
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	99.42
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	99.42
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	99.42
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	99.42
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	99.42
cd03215		182	ABC_Carb_Monos_II This family represents domain II	99.42
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	99.42
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	99.42
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	99.42
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	99.41
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	99.41
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	99.41
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	99.41
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	99.41
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	99.41
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	99.41
PRK07471		365	DNA polymerase III subunit delta'; Validated	99.41
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	99.4
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	99.4
COG4586		325	ABC-type uncharacterized transport system, ATPase	99.4
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	99.4
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	99.4
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	99.4
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	99.4
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	99.4
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	99.39
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	99.39
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	99.39
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	99.39
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	99.39
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	99.39
PRK10908		222	cell division protein FtsE; Provisional	99.39
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	99.39
TIGR03265		353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	99.39
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	99.39
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	99.39
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	99.39
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	99.39
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	99.38
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	99.38
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	99.38
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	99.38
PRK09536		402	btuD corrinoid ABC transporter ATPase; Reviewed	99.38
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	99.38
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	99.38
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	99.38
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	99.38
COG4181		228	Predicted ABC-type transport system involved in ly	99.37
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	99.37
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	99.37
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	99.37
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	99.37
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	99.37
PRK13531		498	regulatory ATPase RavA; Provisional	99.37
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	99.37
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.37
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	99.36
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	99.36
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	99.36
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	99.36
COG4152		300	ABC-type uncharacterized transport system, ATPase	99.36
COG4525		259	TauB ABC-type taurine transport system, ATPase com	99.36
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.36
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.36
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	99.36
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	99.36
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	99.36
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	99.35
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	99.35
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.35
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	99.35
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	99.35
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	99.35
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	99.35
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	99.35
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	99.35
smart00382		148	AAA ATPases associated with a variety of cellular	99.35
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.35
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	99.34
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	99.34
PRK10865		857	protein disaggregation chaperone; Provisional	99.34
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	99.34
PRK05564		313	DNA polymerase III subunit delta'; Validated	99.34
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	99.34
COG4618		580	ArpD ABC-type protease/lipase transport system, AT	99.34
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	99.34
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	99.34
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	99.34
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.34
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	99.34
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	99.33
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	99.33
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.33
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	99.33
PRK13546		264	teichoic acids export protein ATP-binding subunit;	99.33
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	99.33
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	99.33
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	99.33
TIGR02142		354	modC_ABC molybdenum ABC transporter, ATP-binding p	99.33
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	99.33
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	99.33
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	99.33
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	99.33
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	99.33
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	99.32
COG0714		329	MoxR-like ATPases [General function prediction onl	99.32
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	99.32
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	99.32
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	99.32
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	99.32
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.32
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.32
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	99.32
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.31
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	99.31
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	99.31
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	99.31
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	99.31
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	99.31
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	99.31
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	99.31
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	99.31
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	99.31
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	99.31
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	99.31
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	99.31
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	99.31
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	99.31
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	99.3
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	99.3
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	99.3
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	99.3
cd03299		235	ABC_ModC_like Archeal protein closely related to M	99.3
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	99.3
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	99.3
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	99.3
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	99.3
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	99.29
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	99.29
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	99.29
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	99.29
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	99.29
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.29
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	99.29
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.29
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	99.28
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	99.28
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	99.28
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	99.28
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	99.28
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	99.28
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	99.28
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	99.28
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.28
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	99.28
cd03234		226	ABCG_White The White subfamily represents ABC tran	99.28
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	99.28
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	99.27
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	99.27
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	99.27
PRK03695		248	vitamin B12-transporter ATPase; Provisional	99.27
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.27
PHA02244		383	ATPase-like protein	99.27
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	99.27
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	99.27
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.27
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.26
COG1123		539	ATPase components of various ABC-type transport sy	99.26
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	99.26
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	99.26
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	99.26
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	99.26
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	99.26
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	99.26
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	99.26
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	99.26
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	99.26
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	99.26
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	99.25
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	99.25
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	99.25
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	99.25
COG0410		237	LivF ABC-type branched-chain amino acid transport	99.25
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	99.25
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	99.25
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	99.25
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	99.25
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	99.25
COG1134		249	TagH ABC-type polysaccharide/polyol phosphate tran	99.25
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.25
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	99.25
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	99.24
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	99.24
PRK10938		490	putative molybdenum transport ATP-binding protein	99.24
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	99.24
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	99.24
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	99.24
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	99.24
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	99.24
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	99.24
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	99.24
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	99.24
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	99.24
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	99.24
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	99.24
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	99.24
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	99.23
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	99.23
COG4988		559	CydD ABC-type transport system involved in cytochr	99.23
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	99.23
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	99.23
PRK09984		262	phosphonate/organophosphate ester transporter subu	99.23
cd03290		218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	99.23
KOG1514		767	consensus Origin recognition complex, subunit 1, a	99.23
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	99.23
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	99.23
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	99.23
CHL00095		821	clpC Clp protease ATP binding subunit	99.23
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	99.23
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	99.23
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	99.23
KOG0058		716	consensus Peptide exporter, ABC superfamily [Intra	99.22
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	99.22
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	99.22
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	99.22
PRK07399		314	DNA polymerase III subunit delta'; Validated	99.22
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	99.22
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	99.22
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	99.22
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.22
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	99.22
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	99.22
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	99.22
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	99.21
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	99.21
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.21
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	99.21
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	99.21
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	99.21
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	99.21
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	99.21
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	99.21
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	99.21
COG0411		250	LivG ABC-type branched-chain amino acid transport	99.21
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	99.21
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	99.2
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	99.2
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	99.2
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	99.2
PRK14266		250	phosphate ABC transporter ATP-binding protein; Pro	99.2
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	99.2
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.2
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	99.2
smart00350		509	MCM minichromosome maintenance proteins.	99.2
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.2
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	99.19
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	99.19
COG4598		256	HisP ABC-type histidine transport system, ATPase c	99.19
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	99.19
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.19
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	99.18
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.18
KOG0057		591	consensus Mitochondrial Fe/S cluster exporter, ABC	99.18
PLN03211		659	ABC transporter G-25; Provisional	99.18
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	99.18
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	99.17
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.17
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.17
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	99.17
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.16
PRK04132		846	replication factor C small subunit; Provisional	99.16
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.16
TIGR01187		325	potA spermidine/putrescine ABC transporter ATP-bin	99.15
PRK08058		329	DNA polymerase III subunit delta'; Validated	99.15
COG4133		209	CcmA ABC-type transport system involved in cytochr	99.15
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	99.15
PRK13409		590	putative ATPase RIL; Provisional	99.15
KOG0055		1228	consensus Multidrug/pheromone exporter, ABC superf	99.14
COG1123		539	ATPase components of various ABC-type transport sy	99.14
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	99.14
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	99.14
PRK05707		328	DNA polymerase III subunit delta'; Validated	99.14
COG4987		573	CydC ABC-type transport system involved in cytochr	99.13
PRK13409		590	putative ATPase RIL; Provisional	99.13
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.13
PRK10522		547	multidrug transporter membrane component/ATP-bindi	99.12
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	99.12
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	99.12
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	99.12
PRK10938		490	putative molybdenum transport ATP-binding protein	99.12
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.12
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.12
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	99.12
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.12
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.12
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.11
COG4148		352	ModC ABC-type molybdate transport system, ATPase c	99.11
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.11
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.11
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	99.1
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.1
PRK12377		248	putative replication protein; Provisional	99.1
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.1
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.1
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	99.1
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	99.09
COG3845		501	ABC-type uncharacterized transport systems, ATPase	99.09
PRK11147		635	ABC transporter ATPase component; Reviewed	99.09
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.09
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	99.08
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.08

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=1.6e-66  Score=439.85  Aligned_cols=260  Identities=70%  Similarity=1.095  Sum_probs=251.6

Q ss_pred             CccccCCCCCcccccCcHHHHHHHHHHhhccccChHHHHhcCCCCCceEEEEcCCCchHHHHHHHHHHhcCCeEEEEcch
Q 024249            1 MKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGS   80 (270)
Q Consensus         1 ~~~~~~~~~~~~~i~G~~~~~~~l~~~l~~~l~~~~~~~~~~~~~~~~ilL~Gp~GtGKTtl~~~ia~~~~~~~i~i~~~   80 (270)
                      |.|++.|+++|+||||+++|+++|++.+..|+.+|++|..+||.||+|||||||||||||.|||++|++.++.|+++.++
T Consensus       140 M~v~e~PdvtY~dIGGL~~Qi~EirE~VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T~AtFIrvvgS  219 (406)
T COG1222         140 MEVEEKPDVTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVVGS  219 (406)
T ss_pred             eeeccCCCCChhhccCHHHHHHHHHHHhcccccCHHHHHHcCCCCCCceEeeCCCCCcHHHHHHHHHhccCceEEEeccH
Confidence            67899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHhhhchhhHHHHHHHHHHHhcCCeEEEEcCCCcccCcccCCCCCCCChHHHHHHHHHHHhhcCCcCCCCeEEEEEeC
Q 024249           81 ELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATN  160 (270)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~a~~~~p~il~lDeid~l~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~vi~tt~  160 (270)
                      ++.++|+|++.+.++++|..|+.++||||||||+|++..+|.++. ++.|.+.++.+.++|++|+++...+++-||++||
T Consensus       220 ElVqKYiGEGaRlVRelF~lArekaPsIIFiDEIDAIg~kR~d~~-t~gDrEVQRTmleLL~qlDGFD~~~nvKVI~ATN  298 (406)
T COG1222         220 ELVQKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRFDSG-TSGDREVQRTMLELLNQLDGFDPRGNVKVIMATN  298 (406)
T ss_pred             HHHHHHhccchHHHHHHHHHHhhcCCeEEEEechhhhhcccccCC-CCchHHHHHHHHHHHHhccCCCCCCCeEEEEecC
Confidence            999999999999999999999999999999999999999998754 4578999999999999999999999999999999


Q ss_pred             CCCCchhhhcCCCCcceEEEeCCCCHHHHHHHHHHhhccCCCCCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhcCC
Q 024249          161 RIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRI  240 (270)
Q Consensus       161 ~~~~l~~~l~r~~r~~~~i~~~~p~~~~r~~il~~~~~~~~~~~~~~~~~la~~~~g~~~~dl~~l~~~a~~~a~~~~~~  240 (270)
                      +++.|||+++||||||+.|+||.|+.+.|.+||+.|.+++.+..++|++.+|..|+|+||+||+++|.+|++.|+++++.
T Consensus       299 R~D~LDPALLRPGR~DRkIEfplPd~~gR~~Il~IHtrkM~l~~dvd~e~la~~~~g~sGAdlkaictEAGm~AiR~~R~  378 (406)
T COG1222         299 RPDILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDLELLARLTEGFSGADLKAICTEAGMFAIRERRD  378 (406)
T ss_pred             CccccChhhcCCCcccceeecCCCCHHHHHHHHHHHhhhccCccCcCHHHHHHhcCCCchHHHHHHHHHHhHHHHHhccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHhhhhhcc
Q 024249          241 HVTQEDFEMAVAKVMKKETEK  261 (270)
Q Consensus       241 ~i~~~d~~~a~~~~~~~~~~~  261 (270)
                      .++++||.+|+.++.....+.
T Consensus       379 ~Vt~~DF~~Av~KV~~~~~~~  399 (406)
T COG1222         379 EVTMEDFLKAVEKVVKKKKKL  399 (406)
T ss_pred             eecHHHHHHHHHHHHhccccc
Confidence            999999999999998855443

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>cd03290 ABCC_SUR1_N The SUR domain 1	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN03211 ABC transporter G-25; Provisional	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		270
4b4t_J		405	Near-Atomic Resolution Structural Model Of The Yeas		1e-131
3h4m_A		285	Aaa Atpase Domain Of The Proteasome- Activating Nuc		4e-88
4b4t_I		437	Near-Atomic Resolution Structural Model Of The Yeas		6e-88
4b4t_H		467	Near-Atomic Resolution Structural Model Of The Yeas		2e-86
4b4t_M		434	Near-Atomic Resolution Structural Model Of The Yeas		7e-80
4b4t_L		437	Near-Atomic Resolution Structural Model Of The Yeas		1e-74
4b4t_K		428	Near-Atomic Resolution Structural Model Of The Yeas		2e-71
2ce7_A		476	Edta Treated Length = 476		1e-57
3kds_E		465	Apo-ftsh Crystal Structure Length = 465		4e-57
3cf1_A		806	Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len		1e-52
3hu2_A		489	Structure Of P97 N-D1 R86a Mutant In Complex With A		1e-52
3hu3_A		489	Structure Of P97 N-D1 R155h Mutant In Complex With		1e-52
3hu1_A		489	Structure Of P97 N-D1 R95g Mutant In Complex With A		1e-52
1r7r_A		816	The Crystal Structure Of Murine P97VCP AT 3.6A Leng		2e-52
1lv7_A		257	Crystal Structure Of The Aaa Domain Of Ftsh Length		2e-52
1e32_A		458	Structure Of The N-Terminal Domain And The D1 Aaa D		2e-52
2r62_A		268	Crystal Structure Of Helicobacter Pylori Atp Depend		7e-51
3cf0_A		301	Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH		8e-51
2dhr_A		499	Whole Cytosolic Region Of Atp-Dependent Metalloprot		2e-50
4eiw_A		508	Whole Cytosolic Region Of Atp-Dependent Metalloprot		2e-50
1iy2_A		278	Crystal Structure Of The Ftsh Atpase Domain From Th		1e-48
1ixz_A		254	Crystal Structure Of The Ftsh Atpase Domain From Th		1e-48
2qz4_A		262	Human Paraplegin, Aaa Domain In Complex With Adp Le		1e-46
2x8a_A		274	Human Nuclear Valosin Containing Protein Like (Nvl)		2e-44
3d8b_A		357	Crystal Structure Of Human Fidgetin-Like Protein 1		1e-37
1xwi_A		322	Crystal Structure Of Vps4b Length = 322		3e-36
3vfd_A		389	Human Spastin Aaa Domain Length = 389		3e-36
2zam_A		444	Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt		4e-36
2qp9_X		355	Crystal Structure Of S.Cerevisiae Vps4 Length = 355		6e-36
2rko_A		331	Crystal Structure Of The Vps4p-Dimer Length = 331		6e-36
3eie_A		322	Crystal Structure Of S.Cerevisiae Vps4 In The So4-B		2e-35
3eih_A		340	Crystal Structure Of S.Cerevisiae Vps4 In The Prese		2e-35
3b9p_A		297	Spastin Length = 297		3e-34
2krk_A		86	Solution Nmr Structure Of 26s Protease Regulatory S		2e-31
3kw6_A		78	Crystal Structure Of A Domain Of 26s Proteasome Reg		1e-28
4a3v_B		95	Yeast Regulatory Particle Proteasome Assembly Chape		3e-13
3vlf_B		88	Crystal Structure Of Yeast Proteasome Interacting P		8e-11
2dvw_B		83	Structure Of The Oncoprotein Gankyrin In Complex Wi		2e-07
1ofh_A		310	Asymmetric Complex Between Hslv And I-domain Delete		8e-07
3u5z_B		324	Structure Of T4 Bacteriophage Clamp Loader Bound To		2e-05
1um8_A		376	Crystal Structure Of Helicobacter Pylori Clpx Lengt		5e-05
3pvs_A		447	Structure And Biochemical Activities Of Escherichia		2e-04
3hte_A		363	Crystal Structure Of Nucleotide-Free Hexameric Clpx		3e-04
3hws_A		363	Crystal Structure Of Nucleotide-Bound Hexameric Clp		4e-04
1g3i_A		444	Crystal Structure Of The Hsluv Protease-Chaperone C		7e-04
1g4a_E		443	Crystal Structures Of The Hslvu Peptidase-Atpase Co		7e-04
1do2_A		442	Trigonal Crystal Form Of Heat Shock Locus U (Hslu)		7e-04
1e94_E		449	Hslv-Hslu From E.Coli Length = 449		7e-04

>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405