Citrus Sinensis ID: 024252

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270
MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIVVVFPSFGERYLSSVLFESVKKEAESMVFEP
cHHHHHHccccccccEEEEcccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHccccEEcccccccccHHHHHHcccHHHHccccccccEEEEccccccccccHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHccEEccHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHcccccc
cHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHcHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccccccccccHHHccEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHccccEEEEEcEcHHHHcccHHHHccccHHHHccccc
miadaeekglirpgesvlieptsgntgIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAelvltdpargmkGAVQKAEeirdktpnsyvlqqfenpanpkihyettgpeiwkgtggkiDALVsgigtggtvtgagkylkehnpeiklygvepvesavlsggkpgphkiqgigagfipgvldvnlldetvqISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIVVVFPSFGERYLSSVLFESVKKEAESMVFEP
miadaeekglirpgesvlieptsgnTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAeeirdktpnsyvlqqfenpanpkihYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIVVVFPSFGERYLSSVLfesvkkeaesmvfep
MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSgigtggtvtgagKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGaataaaiqiaKRPENAGKLIVVVFPSFGERYLSSVLFESVKKEAESMVFEP
*****************LIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPA********************YVLQQF****NPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIVVVFPSFGERYLSSVLFE*************
MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIVVVFPSFGERYLSSVLFESVKKEAE*M****
********GLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIVVVFPSFGERYLSSVLFESVK**********
MIA*AEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIVVVFPSFGERYLSSVLFESVKKEAES*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIVVVFPSFGERYLSSVLFESVKKEAESMVFEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query270 2.2.26 [Sep-21-2011]
Q43317325 Cysteine synthase OS=Citr N/A no 1.0 0.830 0.9 1e-127
Q00834325 Cysteine synthase OS=Spin N/A no 0.996 0.827 0.873 1e-125
P80608325 Cysteine synthase OS=Zea N/A no 1.0 0.830 0.851 1e-122
O81154325 Cysteine synthase OS=Sola N/A no 1.0 0.830 0.833 1e-122
P38076325 Cysteine synthase OS=Trit N/A no 0.996 0.827 0.836 1e-120
Q9XEA6321 Cysteine synthase OS=Oryz yes no 0.996 0.838 0.832 1e-120
Q9XEA8325 Cysteine synthase OS=Oryz no no 1.0 0.830 0.833 1e-119
O23733322 Cysteine synthase OS=Bras N/A no 0.996 0.835 0.817 1e-118
P47998322 Cysteine synthase OS=Arab yes no 0.996 0.835 0.810 1e-117
O23735324 Cysteine synthase OS=Bras N/A no 0.996 0.830 0.814 1e-116
>sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function desciption
 Score =  452 bits (1164), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 243/270 (90%), Positives = 258/270 (95%)

Query: 1   MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAF 60
           MI+DAE KGLI PGESVLIEPTSGNTGIGLAF+AAAKGYRLII MPASMSLERR +L AF
Sbjct: 56  MISDAENKGLITPGESVLIEPTSGNTGIGLAFIAAAKGYRLIICMPASMSLERRTILRAF 115

Query: 61  GAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGK 120
           GAELVLTDPARGMKGAVQKAEEI+ KTPNSY+LQQFENPANPKIHYETTGPEIW+G+GGK
Sbjct: 116 GAELVLTDPARGMKGAVQKAEEIKAKTPNSYILQQFENPANPKIHYETTGPEIWRGSGGK 175

Query: 121 IDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP 180
           IDALVSGIGTGGTVTGAGKYLKE NP IKLYGVEPVESA+LSGGKPGPHKIQGIGAGFIP
Sbjct: 176 IDALVSGIGTGGTVTGAGKYLKEQNPNIKLYGVEPVESAILSGGKPGPHKIQGIGAGFIP 235

Query: 181 GVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIV 240
           GVLDVNLLDE +Q+SSEE+IETAKLLALKEGLLVGISSGAA AAAI+IAKRPENAGKLIV
Sbjct: 236 GVLDVNLLDEVIQVSSEESIETAKLLALKEGLLVGISSGAAAAAAIRIAKRPENAGKLIV 295

Query: 241 VVFPSFGERYLSSVLFESVKKEAESMVFEP 270
            VFPSFGERYLS+VLFESVK+E E+MVFEP
Sbjct: 296 AVFPSFGERYLSTVLFESVKRETENMVFEP 325
Produces L-cysteine from O-acetyl-L-serine and hydrogen sulfide. Can also use pyrazole and 3,4-dihydroxypyridine instead of the hydrogen sulfide to produce two plant specific non-protein amino acids beta-pyrazolylalanine and L-mimosine.
Citrullus lanatus (taxid: 3654)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 5EC: 2
>sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function description
>sp|P80608|CYSK_MAIZE Cysteine synthase OS=Zea mays PE=1 SV=2 Back     alignment and function description
>sp|O81154|CYSK_SOLTU Cysteine synthase OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|P38076|CYSK_WHEAT Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XEA6|CYSK1_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2 Back     alignment and function description
>sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 Back     alignment and function description
>sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description
>sp|P47998|CYSK1_ARATH Cysteine synthase OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2 Back     alignment and function description
>sp|O23735|CYSK2_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query270
356573072325 PREDICTED: cysteine synthase-like [Glyci 1.0 0.830 0.903 1e-128
224125568325 predicted protein [Populus trichocarpa] 1.0 0.830 0.925 1e-127
255644573325 unknown [Glycine max] 1.0 0.830 0.896 1e-127
34099833292 O-acetylserine (thiol)lyase, partial [Po 1.0 0.924 0.922 1e-127
224144420325 predicted protein [Populus trichocarpa] 1.0 0.830 0.903 1e-126
224130736325 predicted protein [Populus trichocarpa] 1.0 0.830 0.9 1e-126
255542380325 cysteine synthase, putative [Ricinus com 1.0 0.830 0.914 1e-125
255647610325 unknown [Glycine max] 1.0 0.830 0.9 1e-125
2493895325 RecName: Full=Cysteine synthase; Short=C 1.0 0.830 0.9 1e-125
307136057325 cysteine synthase [Cucumis melo subsp. m 1.0 0.830 0.885 1e-125
>gi|356573072|ref|XP_003554689.1| PREDICTED: cysteine synthase-like [Glycine max] Back     alignment and taxonomy information
 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 244/270 (90%), Positives = 260/270 (96%)

Query: 1   MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAF 60
           MI DAEEKGLI PGESVLIEPTSGNTGIGLAFMAAAKGY+LIITMP+SMSLERR +L AF
Sbjct: 56  MIVDAEEKGLITPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAF 115

Query: 61  GAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGK 120
           GAELVLTDPA+GMKGAVQKAEEIRDKTPNSY+LQQFENPANPK+HYETTGPEIWKG+ GK
Sbjct: 116 GAELVLTDPAKGMKGAVQKAEEIRDKTPNSYMLQQFENPANPKVHYETTGPEIWKGSSGK 175

Query: 121 IDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP 180
           +DALVSGIGTGGTVTGAGKYLKE NP+IKLYG+EPVES +LSGGKPGPHKIQGIGAGFIP
Sbjct: 176 VDALVSGIGTGGTVTGAGKYLKEQNPDIKLYGIEPVESPILSGGKPGPHKIQGIGAGFIP 235

Query: 181 GVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIV 240
           GVLDV+LLDE VQISSEEAIETAKLLALKEGLLVGISSGAA AAA++IAKRPENAGKLIV
Sbjct: 236 GVLDVDLLDEVVQISSEEAIETAKLLALKEGLLVGISSGAAAAAAVKIAKRPENAGKLIV 295

Query: 241 VVFPSFGERYLSSVLFESVKKEAESMVFEP 270
            VFPSFGERYLSSVLFESVK+EAES+VFEP
Sbjct: 296 AVFPSFGERYLSSVLFESVKREAESLVFEP 325

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125568|ref|XP_002319618.1| predicted protein [Populus trichocarpa] gi|118482627|gb|ABK93233.1| unknown [Populus trichocarpa] gi|222857994|gb|EEE95541.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255644573|gb|ACU22789.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|34099833|gb|AAQ57205.1| O-acetylserine (thiol)lyase, partial [Populus tremula x Populus alba] Back     alignment and taxonomy information
>gi|224144420|ref|XP_002336146.1| predicted protein [Populus trichocarpa] gi|222874214|gb|EEF11345.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224130736|ref|XP_002328363.1| predicted protein [Populus trichocarpa] gi|222838078|gb|EEE76443.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542380|ref|XP_002512253.1| cysteine synthase, putative [Ricinus communis] gi|223548214|gb|EEF49705.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255647610|gb|ACU24268.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|2493895|sp|Q43317.1|CYSK_CITLA RecName: Full=Cysteine synthase; Short=CSase; AltName: Full=Beta-PA/CSase; AltName: Full=Beta-pyrazolylalanine synthase; AltName: Full=L-mimosine synthase; AltName: Full=O-acetylserine (thiol)-lyase; Short=OAS-TL; AltName: Full=O-acetylserine sulfhydrylase gi|540497|dbj|BAA05965.1| cysteine synthase [Citrullus lanatus subsp. vulgaris] Back     alignment and taxonomy information
>gi|307136057|gb|ADN33908.1| cysteine synthase [Cucumis melo subsp. melo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query270
TAIR|locus:2130419322 OASA1 "O-acetylserine (thiol) 0.996 0.835 0.743 8.3e-106
TAIR|locus:2043964392 OASB "O-acetylserine (thiol) l 0.985 0.678 0.703 9.4e-98
TAIR|locus:2080417433 OASC "O-acetylserine (thiol) l 0.985 0.614 0.680 1.6e-95
TAIR|locus:2114804324 CYSD1 "cysteine synthase D1" [ 0.985 0.820 0.635 5.9e-89
TAIR|locus:2143814323 CYSD2 "cysteine synthase D2" [ 0.996 0.832 0.620 3.3e-86
UNIPROTKB|Q1KLZ2376 CAS1 "L-3-cyanoalanine synthas 0.985 0.707 0.571 1.2e-83
TAIR|locus:2143754323 DES1 "L-cysteine desulfhydrase 0.996 0.832 0.602 1e-82
UNIPROTKB|Q43153368 CYSC "Bifunctional L-3-cyanoal 0.985 0.722 0.563 2.8e-82
UNIPROTKB|Q1KLZ1375 CAS2 "L-3-cyanoalanine synthas 0.985 0.709 0.563 7.4e-82
UNIPROTKB|Q76MX2351 PCAS-1 "Bifunctional L-3-cyano 0.985 0.757 0.563 1.5e-81
TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1047 (373.6 bits), Expect = 8.3e-106, P = 8.3e-106
 Identities = 200/269 (74%), Positives = 227/269 (84%)

Query:     1 MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAF 60
             MI+DAE+KGLI+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAF
Sbjct:    53 MISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAF 112

Query:    61 GAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGK 120
             G ELVLTDPA+GMKGA+ KAEEI  KTPN Y+LQQFENPANPKIHYETTGPEIWKGTGGK
Sbjct:   113 GVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGK 172

Query:   121 IDALVSXXXXXXXXXXXXKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP 180
             ID  VS            KYLKE N  +KLYGVEPVESA+LSGGKPGPHKIQGIGAGFIP
Sbjct:   173 IDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIP 232

Query:   181 GVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGXXXXXXXXXXKRPENAGKLIV 240
              VL+V+L+DE VQ+SS+E+I+ A+ LALKEGLLVGISSG          +RPENAGKL V
Sbjct:   233 SVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFV 292

Query:   241 VVFPSFGERYLSSVLFESVKKEAESMVFE 269
              +FPSFGERYLS+VLF++ +KEAE+M FE
Sbjct:   293 AIFPSFGERYLSTVLFDATRKEAEAMTFE 321
GO:0003824 "catalytic activity" evidence=IEA
GO:0004124 "cysteine synthase activity" evidence=IEA;IGI;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006535 "cysteine biosynthetic process from serine" evidence=IEA;TAS
GO:0008152 "metabolic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0005829 "cytosol" evidence=ISS;IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA;IMP;IDA
GO:0007568 "aging" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0019344 "cysteine biosynthetic process" evidence=RCA;IMP
GO:0048046 "apoplast" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006816 "calcium ion transport" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
TAIR|locus:2143754 DES1 "L-cysteine desulfhydrase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q43153 CYSC "Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ1 CAS2 "L-3-cyanoalanine synthase 2, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0A535CYSK_MYCBO2, ., 5, ., 1, ., 4, 70.59450.95550.8322yesno
P0A534CYSK_MYCTU2, ., 5, ., 1, ., 4, 70.59450.95550.8322yesno
P57171CYSK_BUCAI2, ., 5, ., 1, ., 4, 70.56040.88510.7587yesno
P63871CYSK_STAAN2, ., 5, ., 1, ., 4, 70.54080.93700.8161yesno
P63872CYSK_STAAW2, ., 5, ., 1, ., 4, 70.54080.93700.8161yesno
P37887CYSK_BACSU2, ., 5, ., 1, ., 4, 70.56970.94070.8246yesno
P31300CYSKP_CAPAN2, ., 5, ., 1, ., 4, 70.73680.94810.6844N/Ano
P45040CYSK_HAEIN2, ., 5, ., 1, ., 4, 70.54470.95920.8196yesno
P63870CYSK_STAAM2, ., 5, ., 1, ., 4, 70.54080.93700.8161yesno
P47998CYSK1_ARATH2, ., 5, ., 1, ., 4, 70.81040.99620.8354yesno
O81155CYSKP_SOLTU2, ., 5, ., 1, ., 4, 70.76310.98510.6891N/Ano
Q8KA48CYSK_BUCAP2, ., 5, ., 1, ., 4, 70.56250.96660.8105yesno
P0ABK6CYSK_ECO572, ., 5, ., 1, ., 4, 70.54940.97400.8142N/Ano
P38076CYSK_WHEAT2, ., 5, ., 1, ., 4, 70.83640.99620.8276N/Ano
P0ABK5CYSK_ECOLI4, ., 5, ., 1, ., 50.54940.97400.8142N/Ano
Q6GJF8CYSK_STAAR2, ., 5, ., 1, ., 4, 70.54080.93700.8161yesno
Q6GBX5CYSK_STAAS2, ., 5, ., 1, ., 4, 70.54080.93700.8161yesno
O81154CYSK_SOLTU2, ., 5, ., 1, ., 4, 70.83331.00.8307N/Ano
Q5HIG2CYSK_STAAC2, ., 5, ., 1, ., 4, 70.54080.93700.8161yesno
P0A1E4CYSK_SALTI2, ., 5, ., 1, ., 4, 70.55670.97400.8142N/Ano
P32260CYSKP_SPIOL2, ., 5, ., 1, ., 4, 70.72180.98510.6945N/Ano
P0A1E3CYSK_SALTY2, ., 5, ., 1, ., 4, 70.55670.97400.8142yesno
Q8CMT6CYSK_STAES2, ., 5, ., 1, ., 4, 70.52910.93700.8161yesno
Q5XAQ3CYSK_STRP62, ., 5, ., 1, ., 4, 70.55420.94070.8115N/Ano
P73410CYSK_SYNY32, ., 5, ., 1, ., 4, 70.61150.96290.8333N/Ano
O32978CYSK_MYCLE2, ., 5, ., 1, ., 4, 70.59370.94440.8225yesno
Q5HRP1CYSK_STAEQ2, ., 5, ., 1, ., 4, 70.52910.93700.8161yesno
Q43317CYSK_CITLA2, ., 5, ., 1, ., 5, 20.91.00.8307N/Ano
Q00834CYSK_SPIOL2, ., 5, ., 1, ., 4, 70.87360.99620.8276N/Ano
P80608CYSK_MAIZE2, ., 5, ., 1, ., 4, 70.85181.00.8307N/Ano
Q9XEA8CYSK2_ORYSJ2, ., 5, ., 1, ., 4, 70.83331.00.8307nono
P71128CYSM_CAMJE2, ., 5, ., 1, ., 4, 70.48630.92960.8394yesno
O23733CYSK1_BRAJU2, ., 5, ., 1, ., 4, 70.81780.99620.8354N/Ano
Q7DDL5CYSK_NEIMB2, ., 5, ., 1, ., 4, 70.57970.94440.8225yesno
Q9XEA6CYSK1_ORYSJ2, ., 5, ., 1, ., 4, 70.83270.99620.8380yesno
O23735CYSK2_BRAJU2, ., 5, ., 1, ., 4, 70.81410.99620.8302N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.470.979
3rd Layer2.5.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00130338
RecName- Full=Cysteine synthase; EC=2.5.1.47; (326 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pm.C_LG_XV0472
serine O-acetyltransferase (EC-2.3.1.30) (293 aa)
• •  •• 0.942
estExt_fgenesh4_pg.C_410108
serine O-acetyltransferase (EC-2.3.1.30) (294 aa)
• •  •• 0.941
estExt_fgenesh4_pm.C_LG_I1139
serine O-acetyltransferase (EC-2.3.1.30) (334 aa)
• •  •• 0.938
estExt_fgenesh4_pg.C_LG_V0392
hypothetical protein (395 aa)
  •  •• 0.923
gw1.IX.3567.1
sulfite reductase (EC-1.8.7.1) (576 aa)
     •• 0.917
gw1.I.1513.1
sulfite reductase (EC-1.8.7.1) (634 aa)
     •• 0.914
estExt_Genewise1_v1.C_LG_I4741
phosphateglycerate kinase (EC-2.5.1.47) (424 aa)
  •  •••0.907
gw1.XIV.1323.1
cysteine synthase/L-3-cyanoalanine synthase (EC-4.4.1.9) (342 aa)
  •  • •0.902
grail3.0039007102
RecName- Full=Cysteine synthase; EC=2.5.1.47; (375 aa)
  •  • •0.902
eugene3.00700109
hypothetical protein (324 aa)
  •  • •0.901

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
PLN02565322 PLN02565, PLN02565, cysteine synthase 0.0
TIGR01136299 TIGR01136, cysKM, cysteine synthase 1e-146
TIGR01139298 TIGR01139, cysK, cysteine synthase A 1e-144
cd01561291 cd01561, CBS_like, CBS_like: This subgroup include 1e-139
PLN00011323 PLN00011, PLN00011, cysteine synthase 1e-138
PLN03013429 PLN03013, PLN03013, cysteine synthase 1e-135
PLN02556368 PLN02556, PLN02556, cysteine synthase/L-3-cyanoala 1e-134
COG0031300 COG0031, CysK, Cysteine synthase [Amino acid trans 1e-127
PRK10717330 PRK10717, PRK10717, cysteine synthase A; Provision 1e-100
PRK11761296 PRK11761, cysM, cysteine synthase B; Provisional 8e-90
TIGR01138290 TIGR01138, cysM, cysteine synthase B 1e-83
TIGR01137 454 TIGR01137, cysta_beta, cystathionine beta-synthase 2e-77
TIGR03945304 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio 4e-63
cd00640244 cd00640, Trp-synth-beta_II, Tryptophan synthase be 6e-63
pfam00291295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 4e-54
PLN02356423 PLN02356, PLN02356, phosphateglycerate kinase 3e-26
cd01562304 cd01562, Thr-dehyd, Threonine dehydratase: The fir 2e-15
COG1171347 COG1171, IlvA, Threonine dehydratase [Amino acid t 2e-14
TIGR01127380 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, m 9e-12
PRK06815317 PRK06815, PRK06815, hypothetical protein; Provisio 2e-10
cd01563324 cd01563, Thr-synth_1, Threonine synthase is a pyri 8e-09
TIGR01124 499 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, b 1e-08
PRK12483 521 PRK12483, PRK12483, threonine dehydratase; Reviewe 2e-08
PRK06382406 PRK06382, PRK06382, threonine dehydratase; Provisi 5e-07
PRK06608338 PRK06608, PRK06608, threonine dehydratase; Provisi 9e-06
PLN02550 591 PLN02550, PLN02550, threonine dehydratase 2e-05
COG0498411 COG0498, ThrC, Threonine synthase [Amino acid tran 2e-05
TIGR00263385 TIGR00263, trpB, tryptophan synthase, beta subunit 3e-05
PRK09224 504 PRK09224, PRK09224, threonine dehydratase; Reviewe 1e-04
PRK08526403 PRK08526, PRK08526, threonine dehydratase; Provisi 1e-04
PRK08639420 PRK08639, PRK08639, threonine dehydratase; Validat 2e-04
PRK08198404 PRK08198, PRK08198, threonine dehydratase; Provisi 2e-04
PRK06110322 PRK06110, PRK06110, hypothetical protein; Provisio 5e-04
cd06446365 cd06446, Trp-synth_B, Tryptophan synthase-beta: Tr 0.001
TIGR02079409 TIGR02079, THD1, threonine dehydratase 0.001
COG0133396 COG0133, TrpB, Tryptophan synthase beta chain [Ami 0.002
TIGR03528396 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammoni 0.002
PRK08246310 PRK08246, PRK08246, threonine dehydratase; Provisi 0.002
>gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase Back     alignment and domain information 
 Score =  507 bits (1308), Expect = 0.0
 Identities = 248/270 (91%), Positives = 263/270 (97%)

Query: 1   MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAF 60
           MI DAEEKGLI+PGESVLIEPTSGNTGIGLAFMAAAKGY+LIITMPASMSLERR++LLAF
Sbjct: 53  MITDAEEKGLIKPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAF 112

Query: 61  GAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGK 120
           GAELVLTDPA+GMKGAVQKAEEI  KTPNSY+LQQFENPANPKIHYETTGPEIWKGTGGK
Sbjct: 113 GAELVLTDPAKGMKGAVQKAEEILAKTPNSYILQQFENPANPKIHYETTGPEIWKGTGGK 172

Query: 121 IDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP 180
           +DA VSGIGTGGT+TGAGKYLKE NP+IKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP
Sbjct: 173 VDAFVSGIGTGGTITGAGKYLKEQNPDIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP 232

Query: 181 GVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIV 240
           GVLDV+LLDE VQ+SS+EAIETAKLLALKEGLLVGISSGAA AAAI+IAKRPENAGKLIV
Sbjct: 233 GVLDVDLLDEVVQVSSDEAIETAKLLALKEGLLVGISSGAAAAAAIKIAKRPENAGKLIV 292

Query: 241 VVFPSFGERYLSSVLFESVKKEAESMVFEP 270
           V+FPSFGERYLSSVLFESVKKEAE+MVFEP
Sbjct: 293 VIFPSFGERYLSSVLFESVKKEAENMVFEP 322

Length = 322
>gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase Back     alignment and domain information
>gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A Back     alignment and domain information
>gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase Back     alignment and domain information
>gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase Back     alignment and domain information
>gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase Back     alignment and domain information
>gnl|CDD|107205 cd01562, Thr-dehyd, Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>gnl|CDD|224092 COG1171, IlvA, Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130197 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, medium form Back     alignment and domain information
>gnl|CDD|180709 PRK06815, PRK06815, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|107206 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>gnl|CDD|130194 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>gnl|CDD|237111 PRK12483, PRK12483, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|180550 PRK06382, PRK06382, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|235842 PRK06608, PRK06608, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|178165 PLN02550, PLN02550, threonine dehydratase Back     alignment and domain information
>gnl|CDD|223572 COG0498, ThrC, Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|232897 TIGR00263, trpB, tryptophan synthase, beta subunit Back     alignment and domain information
>gnl|CDD|236417 PRK09224, PRK09224, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|181457 PRK08526, PRK08526, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|236318 PRK08639, PRK08639, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|236182 PRK08198, PRK08198, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|235699 PRK06110, PRK06110, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|107207 cd06446, Trp-synth_B, Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>gnl|CDD|233712 TIGR02079, THD1, threonine dehydratase Back     alignment and domain information
>gnl|CDD|223211 COG0133, TrpB, Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234245 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammonia-lyase Back     alignment and domain information
>gnl|CDD|181319 PRK08246, PRK08246, threonine dehydratase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 270
PLN02565322 cysteine synthase 100.0
COG0031300 CysK Cysteine synthase [Amino acid transport and m 100.0
PLN02556368 cysteine synthase/L-3-cyanoalanine synthase 100.0
PLN00011323 cysteine synthase 100.0
PLN03013429 cysteine synthase 100.0
TIGR01136299 cysKM cysteine synthases. This model discriminates 100.0
TIGR01139298 cysK cysteine synthase A. This model distinguishes 100.0
KOG1252362 consensus Cystathionine beta-synthase and related 100.0
PRK11761296 cysM cysteine synthase B; Provisional 100.0
PRK10717330 cysteine synthase A; Provisional 100.0
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 100.0
PLN02356423 phosphateglycerate kinase 100.0
cd01561291 CBS_like CBS_like: This subgroup includes Cystathi 100.0
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 100.0
COG1171347 IlvA Threonine dehydratase [Amino acid transport a 100.0
cd06448316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 100.0
PLN02550 591 threonine dehydratase 100.0
PRK12483 521 threonine dehydratase; Reviewed 100.0
PRK08329347 threonine synthase; Validated 100.0
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 100.0
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 100.0
PRK06352351 threonine synthase; Validated 100.0
PRK08526403 threonine dehydratase; Provisional 100.0
PRK02991441 D-serine dehydratase; Provisional 100.0
PRK06608338 threonine dehydratase; Provisional 100.0
PRK08813349 threonine dehydratase; Provisional 100.0
PRK09224 504 threonine dehydratase; Reviewed 100.0
PRK07591421 threonine synthase; Validated 100.0
PRK08197394 threonine synthase; Validated 100.0
PLN02970328 serine racemase 100.0
PRK06382406 threonine dehydratase; Provisional 100.0
PRK07048321 serine/threonine dehydratase; Validated 100.0
PRK06721352 threonine synthase; Reviewed 100.0
PRK08639420 threonine dehydratase; Validated 100.0
PRK08198404 threonine dehydratase; Provisional 100.0
PRK06110322 hypothetical protein; Provisional 100.0
PRK07476322 eutB threonine dehydratase; Provisional 100.0
PRK06815317 hypothetical protein; Provisional 100.0
PRK08638333 threonine dehydratase; Validated 100.0
PRK07334403 threonine dehydratase; Provisional 100.0
TIGR02079409 THD1 threonine dehydratase. This model represents 100.0
PRK07409353 threonine synthase; Validated 100.0
TIGR02035431 D_Ser_am_lyase D-serine ammonia-lyase. This family 100.0
KOG1250457 consensus Threonine/serine dehydratases [Amino aci 100.0
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phos 100.0
cd01562304 Thr-dehyd Threonine dehydratase: The first step in 100.0
TIGR02991317 ectoine_eutB ectoine utilization protein EutB. Mem 100.0
cd06447404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 100.0
PLN02569484 threonine synthase 100.0
PRK08246310 threonine dehydratase; Provisional 100.0
KOG1251323 consensus Serine racemase [Signal transduction mec 100.0
PRK06260397 threonine synthase; Validated 100.0
PRK06381319 threonine synthase; Validated 100.0
PRK08206399 diaminopropionate ammonia-lyase; Provisional 100.0
PRK06450338 threonine synthase; Validated 100.0
PRK05638442 threonine synthase; Validated 100.0
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfa 100.0
TIGR01747376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 100.0
TIGR00260328 thrC threonine synthase. Involved in threonine bio 100.0
cd06446365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 100.0
TIGR03844398 cysteate_syn cysteate synthase. Members of this fa 100.0
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 100.0
KOG1481391 consensus Cysteine synthase [Amino acid transport 100.0
PRK13028402 tryptophan synthase subunit beta; Provisional 100.0
TIGR03528396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 100.0
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
TIGR00263385 trpB tryptophan synthase, beta subunit. Tryptophan 100.0
TIGR01275311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 100.0
PRK12391427 tryptophan synthase subunit beta; Reviewed 100.0
PRK04346397 tryptophan synthase subunit beta; Validated 100.0
TIGR01274337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 100.0
TIGR01415419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 100.0
PLN02618410 tryptophan synthase, beta chain 100.0
PRK13802695 bifunctional indole-3-glycerol phosphate synthase/ 100.0
PRK03910331 D-cysteine desulfhydrase; Validated 100.0
PF00291306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 100.0
PRK14045329 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
PRK13803610 bifunctional phosphoribosylanthranilate isomerase/ 100.0
COG0498411 ThrC Threonine synthase [Amino acid transport and 100.0
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 99.97
PRK09225462 threonine synthase; Validated 99.96
cd01560460 Thr-synth_2 Threonine synthase catalyzes the final 99.95
COG0133396 TrpB Tryptophan synthase beta chain [Amino acid tr 99.95
COG1350432 Predicted alternative tryptophan synthase beta-sub 99.91
KOG1395477 consensus Tryptophan synthase beta chain [Amino ac 99.89
COG3048443 DsdA D-serine dehydratase [Amino acid transport an 99.86
KOG2616266 consensus Pyridoxalphosphate-dependent enzyme/pred 94.15
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 90.41
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 90.03
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 89.81
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 89.75
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 89.44
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 87.71
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 86.68
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 86.58
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 86.5
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 86.46
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 86.45
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 86.28
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 86.16
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 85.53
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 85.35
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 85.34
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 85.14
PRK09880343 L-idonate 5-dehydrogenase; Provisional 84.71
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 84.35
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 83.93
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 83.14
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 82.99
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 82.55
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 82.47
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 82.39
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 82.34
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 82.25
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 82.21
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 81.99
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 81.75
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 81.54
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 81.41
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 81.38
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 81.06
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 80.82
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 80.8
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 80.57
>PLN02565 cysteine synthase Back     alignment and domain information 
Probab=100.00  E-value=1.9e-58  Score=405.04  Aligned_cols=270  Identities=92%  Similarity=1.369  Sum_probs=249.0

Q ss_pred             CHHHHHHcCCCCCCCcEEEeeCCcHHHHHHHHHHHHcCCcEEEEeCCCCCHHHHHHHHHcCCEEEEeCCCCChHHHHHHH
Q 024252            1 MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKA   80 (270)
Q Consensus         1 ~i~~a~~~g~l~~g~~~vv~aSsGN~g~alA~aa~~~G~~~~iv~p~~~~~~k~~~~~~~Ga~v~~~~~~~~~~~~~~~a   80 (270)
                      ||..++++|.+.||.++||++||||||+|+|++|+.+|++|+||||+++++.|+++|+.|||+|+.+++..+++++.+.+
T Consensus        53 ~l~~~~~~g~~~~g~~~vv~aSsGN~g~alA~~a~~~G~~~~ivvp~~~~~~k~~~i~~~GA~V~~~~~~~~~~~~~~~a  132 (322)
T PLN02565         53 MITDAEEKGLIKPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAELVLTDPAKGMKGAVQKA  132 (322)
T ss_pred             HHHHHHHcCCCCCCCcEEEEECCChHHHHHHHHHHHcCCeEEEEeCCCCcHHHHHHHHHcCCEEEEeCCCCCcHHHHHHH
Confidence            47789999999999778999999999999999999999999999999999999999999999999998754567888889


Q ss_pred             HHHHHhCCCccccCCCCCCCchhhhhhchHHHHHHhhCCCCCEEEEecCCchhHHHHHHHhhhcCCCeEEEEEecCCCcc
Q 024252           81 EEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAV  160 (270)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~G~~t~~~EI~~ql~~~~d~iv~~vG~Gg~~aGi~~~~~~~~~~~~vigV~~~~~~~  160 (270)
                      ++++++.++.|+++||+|+.|+..||+|+++||++|+++.||+||+|+|+||+++|++.+||+.+|++|||+|||+++++
T Consensus       133 ~~l~~~~~~~~~~~q~~n~~n~~~~~~t~a~Ei~~q~~~~~d~vv~~vG~GG~l~Gi~~~lk~~~p~~kvi~Vep~~s~~  212 (322)
T PLN02565        133 EEILAKTPNSYILQQFENPANPKIHYETTGPEIWKGTGGKVDAFVSGIGTGGTITGAGKYLKEQNPDIKLYGVEPVESAV  212 (322)
T ss_pred             HHHHHhCCCcEeecccCCHhHHHHHHHHHHHHHHHhcCCCCCEEEEcCCchHHHHHHHHHHHHhCCCCEEEEEecCCCcc
Confidence            99888766789999999999988899999999999997679999999999999999999999999999999999999998


Q ss_pred             ccCCCCCCcccccCCCCCCccccccccCCcEEEcCHHHHHHHHHHHHHHcCCeechhHHHHHHHHHHHhhcCCCCCCeEE
Q 024252          161 LSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIV  240 (270)
Q Consensus       161 ~~~~~~~~~~~~gl~~~~~~~~~~~~~~~~~~~V~~~e~~~a~~~l~~~~gi~~ep~sg~alaa~~~~~~~~~~~~~~vv  240 (270)
                      +.++++.++.+++++.+..|..+..+++|+++.|+|+|+++++++|++++|+++||+||+++++++++.++...++++||
T Consensus       213 ~~~g~~~~~~~~glg~~~~~~~~~~~~vd~~v~V~d~ea~~a~~~l~~~~gi~vg~ssga~laaa~~~a~~~~~~~~~vV  292 (322)
T PLN02565        213 LSGGKPGPHKIQGIGAGFIPGVLDVDLLDEVVQVSSDEAIETAKLLALKEGLLVGISSGAAAAAAIKIAKRPENAGKLIV  292 (322)
T ss_pred             ccCCCCCCccCCCCCCCCCCCcCCHhHCCEEEEECHHHHHHHHHHHHHHhCcEEeccHHHHHHHHHHHHHhcCCCCCeEE
Confidence            88777777788999887667777778899999999999999999999999999999999999999999876645678999


Q ss_pred             EEecCCCCCCcchhhcHHHHHhhhcCCCCC
Q 024252          241 VVFPSFGERYLSSVLFESVKKEAESMVFEP  270 (270)
Q Consensus       241 ~i~t~gg~~~~~~~~~~~~~~~~~~~~~~~  270 (270)
                      +++||+|.||+++++|+.+..+.++|.+++
T Consensus       293 ~v~~d~G~ky~~~~~~~~~~~~~~~~~~~~  322 (322)
T PLN02565        293 VIFPSFGERYLSSVLFESVKKEAENMVFEP  322 (322)
T ss_pred             EEECCCccccCCchhhHHHHHHHhcCccCC
Confidence            999999999999999999999999998865

>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] Back     alignment and domain information
>KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2616 consensus Pyridoxalphosphate-dependent enzyme/predicted threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
1z7w_A322 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-116
1z7y_A322 Crystal Structure Of The Arabidopsis Thaliana O-Ace 1e-116
2isq_A320 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-116
4aec_A430 Crystal Structure Of The Arabidopsis Thaliana O-Ace 1e-105
3vc3_A344 Crystal Structure Of Beta-Cyanoalanine Synthase K95 4e-91
3vbe_A344 Crystal Structure Of Beta-Cyanoalanine Synthase In 5e-91
2q3b_A313 1.8 A Resolution Crystal Structure Of O-Acetylserin 5e-77
2q3d_A313 2.2 A Resolution Crystal Structure Of O-acetylserin 6e-77
3rr2_A314 Structure Of A Cysteine Synthase (O-Acetylserine Su 2e-75
4i1y_A314 The Structure Of Cysteine Synthase From Mycobacteri 6e-75
1d6s_A322 Crystal Structure Of The K41a Mutant Of O-Acetylser 2e-69
1oas_A322 O-Acetylserine Sulfhydrylase From Salmonella Typhim 2e-69
3t4p_A334 Crystal Structure Of O-Acetyl Serine Sulfhydrylase 1e-67
4air_A354 Leishmania Major Cysteine Synthase Length = 354 1e-66
1y7l_A316 O-Acetylserine Sulfhydrylase Complex Length = 316 3e-62
1ve1_A304 Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh 6e-62
2egu_A308 Crystal Structure Of O-Acetylserine Sulfhydrase Fro 1e-59
1o58_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase ( 1e-54
3fca_A291 Genetic Incorporation Of A Metal-Ion Chelating Amin 1e-54
3bm5_A338 Crystal Structure Of O-Acetyl-Serine Sulfhydrylase 5e-49
2pqm_A343 Crystal Structure Of Cysteine Synthase (Oass) From 5e-49
2bht_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase B 2e-47
2bhs_A303 Crystal Structure Of Cysteine Synthase B Length = 3 1e-46
2v03_A303 High Resolution Structure And Catalysis Of An O- Ac 5e-46
2jc3_A303 Structure Of O-acetylserine Sulfhydrylase B From Sa 2e-45
1m54_A363 Cystathionine-Beta Synthase: Reduced Vicinal Thiols 4e-42
1jbq_A435 Structure Of Human Cystathionine Beta-Synthase: A U 1e-41
3dki_A326 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac 4e-31
3dwg_A325 Crystal Structure Of A Sulfur Carrier Protein Compl 4e-31
3pc2_A 527 Full Length Structure Of Cystathionine Beta-Synthas 2e-30
3dwi_A323 Crystal Structure Of Mycobacterium Tuberculosis Cys 2e-30
1wkv_A389 Crystal Structure Of O-Phosphoserine Sulfhydrylase 3e-08
3vsc_A389 Crystal Structure Of The K127a Mutant Of O-Phosphos 3e-08
>pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 Back     alignment and structure 
Iteration: 1

 Score =  413 bits (1061), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 227/269 (84%)
Query: 1   MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAF 60
           MI+DAE+KGLI+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAF
Sbjct: 53  MISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAF 112
Query: 61  GAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGK 120
           G ELVLTDPA+GMKGA+ KAEEI  KTPN Y+LQQFENPANPKIHYETTGPEIWKGTGGK
Sbjct: 113 GVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGK 172
Query: 121 IDALVSXXXXXXXXXXXXKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP 180
           ID  VS            KYLKE N  +KLYGVEPVESA+LSGGKPGPHKIQGIGAGFIP
Sbjct: 173 IDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIP 232
Query: 181 GVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGXXXXXXXXXXKRPENAGKLIV 240
            VL+V+L+DE VQ+SS+E+I+ A+ LALKEGLLVGISSG          +RPENAGKL V
Sbjct: 233 SVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFV 292
Query: 241 VVFPSFGERYLSSVLFESVKKEAESMVFE 269
            +FPSFGERYLS+VLF++ +KEAE+M FE
Sbjct: 293 AIFPSFGERYLSTVLFDATRKEAEAMTFE 321
>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 Back     alignment and structure
>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 Back     alignment and structure
>pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 Back     alignment and structure
>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 Back     alignment and structure
>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 Back     alignment and structure
>pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 Back     alignment and structure
>pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 Back     alignment and structure
>pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 Back     alignment and structure
>pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 Back     alignment and structure
>pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Back     alignment and structure
>pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 Back     alignment and structure
>pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 Back     alignment and structure
>pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 Back     alignment and structure
>pdb|1Y7L|A Chain A, O-Acetylserine Sulfhydrylase Complex Length = 316 Back     alignment and structure
>pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 Back     alignment and structure
>pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 Back     alignment and structure
>pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 Back     alignment and structure
>pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 Back     alignment and structure
>pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 Back     alignment and structure
>pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 Back     alignment and structure
>pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 Back     alignment and structure
>pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 Back     alignment and structure
>pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 Back     alignment and structure
>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 Back     alignment and structure
>pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 Back     alignment and structure
>pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 Back     alignment and structure
>pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 Back     alignment and structure
>pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 Back     alignment and structure
>pdb|1WKV|A Chain A, Crystal Structure Of O-Phosphoserine Sulfhydrylase Length = 389 Back     alignment and structure
>pdb|3VSC|A Chain A, Crystal Structure Of The K127a Mutant Of O-Phosphoserine Sulfhydrylase Complexed With External Schiff Base Of Pyridoxal 5'-Phosphate With O- Phospho-L-Serine Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 0.0
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 0.0
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 0.0
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 0.0
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 1e-180
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 1e-180
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 1e-179
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 1e-173
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 1e-169
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 1e-160
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 1e-155
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 1e-147
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-144
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 1e-143
3ss7_X442 D-serine dehydratase; type II fold, ALFA,beta-elim 9e-18
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 3e-15
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 8e-15
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 5e-14
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 3e-13
1e5x_A486 Threonine synthase; threonine biosynthesis, PLP en 5e-13
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 4e-12
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 6e-12
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 1e-11
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 2e-10
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 6e-10
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 2e-09
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 4e-09
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 2e-08
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 2e-06
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 Back     alignment and structure
 Score =  531 bits (1371), Expect = 0.0
 Identities = 218/269 (81%), Positives = 248/269 (92%)

Query: 1   MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAF 60
           MI+DAE+KGLI+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAF
Sbjct: 53  MISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAF 112

Query: 61  GAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGK 120
           G ELVLTDPA+GMKGA+ KAEEI  KTPN Y+LQQFENPANPKIHYETTGPEIWKGTGGK
Sbjct: 113 GVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGK 172

Query: 121 IDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP 180
           ID  VSGIGTGGT+TGAGKYLKE N  +KLYGVEPVESA+LSGGKPGPHKIQGIGAGFIP
Sbjct: 173 IDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIP 232

Query: 181 GVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIV 240
            VL+V+L+DE VQ+SS+E+I+ A+ LALKEGLLVGISSGAA AAAI++A+RPENAGKL V
Sbjct: 233 SVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFV 292

Query: 241 VVFPSFGERYLSSVLFESVKKEAESMVFE 269
            +FPSFGERYLS+VLF++ +KEAE+M FE
Sbjct: 293 AIFPSFGERYLSTVLFDATRKEAEAMTFE 321
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 Back     alignment and structure
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Length = 442 Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Length = 398 Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Length = 360 Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Length = 351 Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Length = 352 Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Length = 486 Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Length = 323 Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* Length = 346 Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Length = 311 Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Length = 372 Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Length = 318 Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Length = 514 Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Length = 366 Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query270
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 100.0
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 100.0
3vc3_A344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 100.0
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 100.0
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 100.0
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 100.0
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 100.0
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 100.0
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 100.0
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 100.0
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 100.0
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 100.0
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 100.0
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 100.0
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 100.0
4h27_A364 L-serine dehydratase/L-threonine deaminase; PLP de 100.0
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 100.0
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 100.0
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 100.0
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 100.0
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 100.0
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 100.0
3ss7_X442 D-serine dehydratase; type II fold, ALFA,beta-elim 100.0
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 100.0
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 100.0
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 100.0
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 100.0
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 100.0
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 100.0
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 100.0
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 100.0
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 100.0
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 100.0
1e5x_A486 Threonine synthase; threonine biosynthesis, PLP en 100.0
1x1q_A418 Tryptophan synthase beta chain; structural genomic 100.0
1v8z_A388 Tryptophan synthase beta chain 1; beta+alpha, rike 100.0
1qop_B396 Tryptophan synthase beta chain; lyase, carbon-oxyg 100.0
2o2e_A422 Tryptophan synthase beta chain; amino-acid biosynt 100.0
1vb3_A428 Threonine synthase; PLP-dependent enzyme, lyase; H 100.0
1kl7_A514 Threonine synthase; threonine synthesis, pyridoxal 100.0
4f4f_A468 Threonine synthase; structural genomics, niaid, na 100.0
3v7n_A487 Threonine synthase; ssgcid, structural genomics, s 99.97
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.11
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.68
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 93.58
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 93.41
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 93.29
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 93.28
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 93.26
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 93.16
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 92.71
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 92.68
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 92.64
4eye_A342 Probable oxidoreductase; structural genomics, niai 92.5
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 92.49
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 92.02
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 91.68
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 91.32
3gms_A340 Putative NADPH:quinone reductase; structural genom 91.22
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 91.11
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 90.99
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 90.93
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 90.81
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 90.76
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 90.55
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 90.39
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 90.32
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 90.21
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 90.2
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 90.19
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 90.17
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 90.13
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 90.03
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 89.98
3krt_A456 Crotonyl COA reductase; structural genomics, prote 89.97
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 89.97
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 89.8
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 89.67
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 89.55
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 89.45
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 89.44
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 89.11
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 88.93
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 88.79
3fbg_A346 Putative arginate lyase; structural genomics, unkn 88.64
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 88.4
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 88.25
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 88.19
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 88.16
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 88.13
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 88.01
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 87.59
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 87.57
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 87.24
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 87.19
1vp8_A201 Hypothetical protein AF0103; putative pyruvate kin 86.84
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 85.7
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 85.59
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 85.39
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 85.24
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 85.23
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 85.07
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 85.05
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 84.63
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 84.59
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 84.39
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 83.02
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 83.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 82.93
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 82.73
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 82.38
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 82.35
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 82.3
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 81.86
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 81.53
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 81.24
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 80.87
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 80.16
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 80.08
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=7.7e-58  Score=412.38  Aligned_cols=268  Identities=74%  Similarity=1.180  Sum_probs=246.5

Q ss_pred             CHHHHHHcCCCCCCCcEEEeeCCcHHHHHHHHHHHHcCCcEEEEeCCCCCHHHHHHHHHcCCEEEEeCCCCChHHHHHHH
Q 024252            1 MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKA   80 (270)
Q Consensus         1 ~i~~a~~~g~l~~g~~~vv~aSsGN~g~alA~aa~~~G~~~~iv~p~~~~~~k~~~~~~~Ga~v~~~~~~~~~~~~~~~a   80 (270)
                      ||.+|+++|.++||.++||++|+||||+++|++|+++|++|+||||++++..|+++++.|||+|+.++...+++++.+.+
T Consensus       161 ~i~~A~~~G~l~~g~~~VV~aSsGNhG~AlA~aAa~~Gl~~~IvmP~~~s~~k~~~~r~~GAeVv~v~~~~~~~~a~~~a  240 (430)
T 4aec_A          161 MVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAKGMTGAVQKA  240 (430)
T ss_dssp             HHHHHHHTTSCCTTTCEEEEECSSHHHHHHHHHHHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHH
T ss_pred             HHHHHHHcCCCCCCCcEEEEECCCHHHHHHHHHHHHhCCEEEEEEcCCCCHHHHHHHHHCCCEEEEECCCCChHHHHHHH
Confidence            46789999999999889999999999999999999999999999999999999999999999999998655688899999


Q ss_pred             HHHHHhCCCccccCCCCCCCchhhhhhchHHHHHHhhCCCCCEEEEecCCchhHHHHHHHhhhcCCCeEEEEEecCCCcc
Q 024252           81 EEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAV  160 (270)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~G~~t~~~EI~~ql~~~~d~iv~~vG~Gg~~aGi~~~~~~~~~~~~vigV~~~~~~~  160 (270)
                      ++++++.+++||++||+||.+++.||.|+++||++|+++.||+||+|+|+|||++|++.++|+.+|++|||||||.+++.
T Consensus       241 ~el~~~~~~~~~i~~~~np~~~~aG~~T~a~EI~eQl~~~~D~vVvpvG~GGtlaGi~~~lk~~~p~~kVigVep~~s~~  320 (430)
T 4aec_A          241 EEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTGGTITGVGRFIKEKNPKTQVIGVEPTESDI  320 (430)
T ss_dssp             HHHHHHSTTEEECCTTTCTHHHHHHHHTHHHHHHHHTTSCEEEEEEECSSSHHHHHHHHHHHHHCTTSEEEEEEEGGGCG
T ss_pred             HHHHHhcCCcEEecCCCCccHHHHHHHHHHHHHHHHcCCCCCEEEEeCCccHHHHHHHHHHHHhCCCCEEEEEEeCCCcH
Confidence            99998877889999999999888999999999999997789999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCcccccCCCCCCccccccccCCcEEEcCHHHHHHHHHHHHHHcCCeechhHHHHHHHHHHHhhcCCCCCCeEE
Q 024252          161 LSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIV  240 (270)
Q Consensus       161 ~~~~~~~~~~~~gl~~~~~~~~~~~~~~~~~~~V~~~e~~~a~~~l~~~~gi~~ep~sg~alaa~~~~~~~~~~~~~~vv  240 (270)
                      +.++++.++.+++|+.+..|+.++++++|+++.|+|+|+++++++|++++|+++||++|+++++++++.+++..++++||
T Consensus       321 l~~g~~~~~~i~Gl~~~~~p~~l~~~~vd~~v~Vsd~ea~~a~r~La~~eGi~vepssGaa~aAal~la~~~~~~g~~VV  400 (430)
T 4aec_A          321 LSGGKPGPHKIQGIGAGFIPKNLDQKIMDEVIAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIKVAKRPENAGKLIA  400 (430)
T ss_dssp             GGTCCCCCCSCTTSCCSSCCTTCCTTTCSEEEEECHHHHHHHHHHHHHHHCCCBCHHHHHHHHHHHHHTTSGGGTTCEEE
T ss_pred             hhCCCccceeehhccCCCCcHHHHHHhCCeEEEECHHHHHHHHHHHHHHCCCEEehHHHHHHHHHHHHHHhcCCCcCeEE
Confidence            88888888889999988778889899999999999999999999999999999999999999999998776545789999


Q ss_pred             EEecCCCCCCcchhhcHHHHHhhhcCCC
Q 024252          241 VVFPSFGERYLSSVLFESVKKEAESMVF  268 (270)
Q Consensus       241 ~i~t~gg~~~~~~~~~~~~~~~~~~~~~  268 (270)
                      +|+||+|.||+++.+|+++.++-..|.+
T Consensus       401 ~Il~d~G~rylst~~~~~~~~~~~~~~~  428 (430)
T 4aec_A          401 VVFPSFGERYLSTPLFQSIREEVEKMQP  428 (430)
T ss_dssp             EEECBBGGGGTTSHHHHHHHHHC-----
T ss_pred             EEECCCCccccchhhhhhhhhhhhcCcc
Confidence            9999999999999999999888776654
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1vp8_A Hypothetical protein AF0103; putative pyruvate kinase, structural genomics, joint center structural genomics, JCSG; HET: MSE FMN; 1.30A {Archaeoglobus fulgidus} SCOP: c.49.1.2 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 270
d1z7wa1320 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C 6e-83
d1o58a_293 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 2e-72
d1y7la1310 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C 1e-65
d1ve1a1302 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C 2e-63
d1fcja_302 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 6e-59
d1jbqa_355 c.79.1.1 (A:) Cystathionine beta-synthase {Human ( 6e-59
d1wkva1382 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C 3e-52
d2bhsa1292 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C 2e-50
d1tdja1331 c.79.1.1 (A:5-335) Threonine deaminase {Escherichi 3e-31
d1tyza_338 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-26
d1v8za1386 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun 7e-26
d1v71a1318 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S 2e-23
d1ve5a1310 c.79.1.1 (A:2-311) Threonine deaminase {Thermus th 2e-21
d1j0aa_325 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 2e-21
d1f2da_341 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 3e-21
d1qopb_390 c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S 3e-18
d1e5xa_477 c.79.1.1 (A:) Threonine synthase {Mouse-ear cress 6e-17
d1v7ca_351 c.79.1.1 (A:) Threonine synthase {Thermus thermoph 4e-15
d1p5ja_319 c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa 1e-12
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  249 bits (637), Expect = 6e-83
 Identities = 218/269 (81%), Positives = 248/269 (92%)

Query: 1   MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAF 60
           MI+DAE+KGLI+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAF
Sbjct: 51  MISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAF 110

Query: 61  GAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGK 120
           G ELVLTDPA+GMKGA+ KAEEI  KTPN Y+LQQFENPANPKIHYETTGPEIWKGTGGK
Sbjct: 111 GVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGK 170

Query: 121 IDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIP 180
           ID  VSGIGTGGT+TGAGKYLKE N  +KLYGVEPVESA+LSGGKPGPHKIQGIGAGFIP
Sbjct: 171 IDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIP 230

Query: 181 GVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIV 240
            VL+V+L+DE VQ+SS+E+I+ A+ LALKEGLLVGISSGAA AAAI++A+RPENAGKL V
Sbjct: 231 SVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFV 290

Query: 241 VVFPSFGERYLSSVLFESVKKEAESMVFE 269
            +FPSFGERYLS+VLF++ +KEAE+M FE
Sbjct: 291 AIFPSFGERYLSTVLFDATRKEAEAMTFE 319
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query270
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ve1a1302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1p5ja_319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 100.0
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 100.0
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 100.0
d1ve5a1310 Threonine deaminase {Thermus thermophilus [TaxId: 100.0
d1v7ca_351 Threonine synthase {Thermus thermophilus [TaxId: 2 100.0
d1e5xa_477 Threonine synthase {Mouse-ear cress (Arabidopsis t 100.0
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1j0aa_325 1-aminocyclopropane-1-carboxylate deaminase {Archa 99.97
d1tyza_338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 99.97
d1f2da_341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 99.96
d1vb3a1428 Threonine synthase {Escherichia coli [TaxId: 562]} 99.81
d1kl7a_511 Threonine synthase {Baker's yeast (Saccharomyces c 99.41
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.55
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.49
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.39
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.19
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.04
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.99
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.97
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.95
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.84
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.71
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 95.65
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.59
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.43
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.4
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.31
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.04
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.93
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.91
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 93.9
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 93.37
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 92.9
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.85
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.4
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.32
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 91.69
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.44
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.04
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.03
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 89.94
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 89.12
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 88.61
d1vp8a_190 Hypothetical protein AF0103 {Archaeoglobus fulgidu 88.35
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 86.93
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 86.87
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.14
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 85.8
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 85.35
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 85.24
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 84.64
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 84.34
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 84.27
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 83.72
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 83.61
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 83.52
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 83.52
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 83.47
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 83.12
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 82.3
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 81.19
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 80.82
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 80.07
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 80.02
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=1.2e-56  Score=392.07  Aligned_cols=270  Identities=81%  Similarity=1.270  Sum_probs=247.4

Q ss_pred             CHHHHHHcCCCCCCCcEEEeeCCcHHHHHHHHHHHHcCCcEEEEeCCCCCHHHHHHHHHcCCEEEEeCCCCChHHHHHHH
Q 024252            1 MIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKA   80 (270)
Q Consensus         1 ~i~~a~~~g~l~~g~~~vv~aSsGN~g~alA~aa~~~G~~~~iv~p~~~~~~k~~~~~~~Ga~v~~~~~~~~~~~~~~~a   80 (270)
                      ||.+|+++|.++++..+||++||||||+|+|++|+.+|++|+||+|+++++.|+++++.+||+|+.++...+.......+
T Consensus        51 ~i~~a~~~g~~~~~~~~vv~aSsGN~g~a~A~~a~~~g~~~~iv~p~~~~~~k~~~i~~~Ga~vi~~~~~~~~~~~~~~~  130 (320)
T d1z7wa1          51 MISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKA  130 (320)
T ss_dssp             HHHHHHHTTSCCTTTCEEEEECSSHHHHHHHHHHHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHH
T ss_pred             HHHHHHHcCCCCCCCceEEeeCCchHHHHHHHHHHhhccceEEeehhhhhhhhhhhhhccCcceEEeeccccccccchhH
Confidence            47889999999998889999999999999999999999999999999999999999999999999998644334444455


Q ss_pred             HHHHHhCCCccccCCCCCCCchhhhhhchHHHHHHhhCCCCCEEEEecCCchhHHHHHHHhhhcCCCeEEEEEecCCCcc
Q 024252           81 EEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAV  160 (270)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~G~~t~~~EI~~ql~~~~d~iv~~vG~Gg~~aGi~~~~~~~~~~~~vigV~~~~~~~  160 (270)
                      .+...+.++.+++++|+|+.+++.||+|+++||++|+.+.||+||+|+|+||+++|++.+|+..+|.+++++|||.+++.
T Consensus       131 ~~~~~~~~~~~~~~~~~~~~n~~~g~~t~~~EI~~q~~~~~D~vv~~vGgGg~~~Gi~~~~k~~~~~~~~igve~~~s~~  210 (320)
T d1z7wa1         131 EEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAI  210 (320)
T ss_dssp             HHHHHHCTTEEECCTTTCTHHHHHHHHTHHHHHHHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCG
T ss_pred             HHHHHhCCCceecccccccchHHHhhhhHHHHHHHhccCCCCEEEeCCCCCcccchhhhhhhhhhcceeeecccccCCcc
Confidence            55555666899999999999888999999999999997789999999999999999999999999999999999999998


Q ss_pred             ccCCCCCCcccccCCCCCCccccccccCCcEEEcCHHHHHHHHHHHHHHcCCeechhHHHHHHHHHHHhhcCCCCCCeEE
Q 024252          161 LSGGKPGPHKIQGIGAGFIPGVLDVNLLDETVQISSEEAIETAKLLALKEGLLVGISSGAATAAAIQIAKRPENAGKLIV  240 (270)
Q Consensus       161 ~~~~~~~~~~~~gl~~~~~~~~~~~~~~~~~~~V~~~e~~~a~~~l~~~~gi~~ep~sg~alaa~~~~~~~~~~~~~~vv  240 (270)
                      +..+.+.++.+++++.+.+|+.+.++.+|+++.|+|+|+++++++|++++|+++||+||+++++++++.++...++++||
T Consensus       211 ~~~~~~~~~~~~gig~~~~~~~~~~~~id~~~~V~d~e~~~a~~~l~~~eGi~ve~ssga~~aaa~k~a~~~~~~~~~VV  290 (320)
T d1z7wa1         211 LSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFV  290 (320)
T ss_dssp             GGTCCCCCCSCTTSCCSSCCTTCCGGGCSEEEEECHHHHHHHHHHHHHHHSCCBCHHHHHHHHHHHHHHTSGGGTTCEEE
T ss_pred             ccCCCCCCceeeeccCCcCcchhhhhhcceeeccCHHHHHHHHHHHHHHCCEEEehHHHHHHHHHHHHHhhccCCCCEEE
Confidence            88888888889999998889889999999999999999999999999999999999999999999998876556889999


Q ss_pred             EEecCCCCCCcchhhcHHHHHhhhcCCCCC
Q 024252          241 VVFPSFGERYLSSVLFESVKKEAESMVFEP  270 (270)
Q Consensus       241 ~i~t~gg~~~~~~~~~~~~~~~~~~~~~~~  270 (270)
                      +|+||+|.||+++++||+|.++.+.|+.++
T Consensus       291 ~i~~d~G~kYlst~~~d~~~~e~~~~~~~~  320 (320)
T d1z7wa1         291 AIFPSFGERYLSTVLFDATRKEAEAMTFEA  320 (320)
T ss_dssp             EEECBBGGGGTTSGGGHHHHHHHHTCCCCC
T ss_pred             EEECCCchhhcccccCHHHHHHHhcCCCCC
Confidence            999999999999999999999999998753
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1vp8a_ c.49.1.2 (A:) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure