Citrus Sinensis ID: 024764

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MEEETIIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPILFSLTLHHLHSLSLPNKTLLIARHLLFSLQLLTQCFPRAPPPHSSTYQIKRRDHDAVLLLLLLCEVHQQDPEALSAAPQAKWPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNAMGGGGVRGGEKEGRDVAAAVAAVVRLPSVDGAGADQCCVICKEEMGGGRDVCSGSLLMMFLERSNGCGTLSLKRAAAAVLMENDNNAIIACD
ccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccHHHHHccccccccccccccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHcccEEEccccccccccccccccccccccccHHHHHHHcccccccccccccccHHHHHHccccccccc
cHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccHHHHHHHHHHHHHHccccHHHcccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEccccHHEEEEcccccccccccEEEEEHHHHcccccHHHHHHHHHHHHHcccccccccHHHHHHHHccccccEEEEcc
MEEETIIISALStltpnklkDLTHTILSLSDHWRRRLSAVISSPILFSLTLHhlhslslpnKTLLIARHLLFSLQLLtqcfprappphsstyqikrrDHDAVLLLLLLCEVHqqdpealsaapqakwpavlgkhfcESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVnamggggvrggekeGRDVAAAVAAVVRlpsvdgagadQCCVICkeemgggrdvcsgSLLMMFLErsngcgtlSLKRAAAAVLMEndnnaiiacd
MEEETIIISALstltpnklkdLTHTILSLSDHWRRRLSAVISSPILFSLTLHHLHSLSLPNKTLLIARHLLFSLQLLTQCFPRAPPPHSSTYQIKRRDHDAVLLLLLLCEVHQQDPEALSAAPQAKWPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNAMggggvrggekEGRDVAAAVAAVVrlpsvdgagaDQCCVICKEEMGGGRDVCSGSLLMMFLERSNGCGTLSLKRAAAAVLmendnnaiiacd
MEEETIIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPIlfsltlhhlhslslPNKTLLIARHLLFSLQLLTQCFPRAPPPHSSTYQIKRRDHDAVllllllCEVHQQDPEALSAAPQAKWPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNAMggggvrggekegrDvaaavaavvRLPSVDGAGADQCCVICKEEMGGGRDVCSGSLLMMFLERSNGCGTLSLKRAAAAVLMENDNNAIIACD
*****IIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPILFSLTLHHLHSLSLPNKTLLIARHLLFSLQLLTQCFPRA******TYQIKRRDHDAVLLLLLLCEVHQQDPEALSAAPQAKWPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNAMGGGGVRGGEKEGRDVAAAVAAVVRLPSVDGAGADQCCVICKEEMGGGRDVCSGSLLMMFLERSNGCGTLSLKRAAAAVLMENDNNAII***
***ETIIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPILFSLTLHHLHSLSLPNKTLLIARHLLFSLQLLTQCFP***********IKRRDHDAVLLLLLLC*****************WPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNA*********************AVVRLPSVDGAGADQCCVICKEEMGGGRDVCSGSLLMMFLERSNGCGTLSLKRAAAAVLMEN*********
MEEETIIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPILFSLTLHHLHSLSLPNKTLLIARHLLFSLQLLTQCFPRAPPPHSSTYQIKRRDHDAVLLLLLLCEVHQQDPEALSAAPQAKWPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNAMGGGGVRGGEKEGRDVAAAVAAVVRLPSVDGAGADQCCVICKEEMGGGRDVCSGSLLMMFLERSNGCGTLSLKRAAAAVLMENDNNAIIACD
*EEETIIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPILFSLTLHHLHSLSLPNKTLLIARHLLFSLQLLTQCFPRAPPPHSSTYQIKRRDHDAVLLLLLLCEVHQQDPEALSAAPQAKWPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNAMGGGGVRGGEKEGRDVAAAVAAVVRLPSVDGAGADQCCVICKEEMGGGRDVCSGSLLMMFLERSNGCGTLSLKRAAAAVLMENDNNAIIACD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEETIIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPILFSLTLHHLHSLSLPNKTLLIARHLLFSLQLLTQCFPRAPPPHSSTYQIKRRDHDAVLLLLLLCEVHQQDPEALSAAPQAKWPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNAMGGGGVRGGEKEGRDVAAAVAAVVRLPSVDGAGADQCCVICKEEMGGGRDVCSGSLLMMFLERSNGCGTLSLKRAAAAVLMENDNNAIIACD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
255568472275 zinc finger protein, putative [Ricinus c 0.923 0.883 0.526 1e-41
224088615276 predicted protein [Populus trichocarpa] 0.942 0.898 0.5 3e-41
356537435264 PREDICTED: uncharacterized protein LOC10 0.790 0.787 0.56 2e-37
30679751283 RING/U-box domain-containing protein [Ar 0.821 0.763 0.468 1e-36
297806207283 zinc finger family protein [Arabidopsis 0.882 0.819 0.455 5e-36
7413550274 putative protein [Arabidopsis thaliana] 0.851 0.817 0.429 3e-34
449440361283 PREDICTED: uncharacterized protein LOC10 0.923 0.858 0.434 4e-28
356548186260 PREDICTED: uncharacterized protein LOC10 0.775 0.784 0.533 3e-24
224138550136 predicted protein [Populus trichocarpa] 0.448 0.867 0.557 7e-17
218196787277 hypothetical protein OsI_19938 [Oryza sa 0.684 0.649 0.377 2e-11
>gi|255568472|ref|XP_002525210.1| zinc finger protein, putative [Ricinus communis] gi|223535507|gb|EEF37176.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 138/262 (52%), Positives = 172/262 (65%), Gaps = 19/262 (7%)

Query: 1   MEEETIIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPILFSLTLHHLHSLSLP 60
           ME+ET+I++ALSTLTP +L  LTH+ILS + H    LS+++SSP  FSLTLHHLHSLSLP
Sbjct: 1   MEDETMIMAALSTLTPPQLSHLTHSILSQTLHHHHSLSSLLSSPSSFSLTLHHLHSLSLP 60

Query: 61  NKTLLIARHLLFSLQLLTQCFPRAPPPHSSTYQIKRRDHDAVLLLLLLCEVHQQDPEALS 120
           +KTLLIA+HLL SL  LT+ FP   P H S   IK RD DAVLLLLLLC+VHQ +P+ L 
Sbjct: 61  HKTLLIAKHLLSSLHQLTRFFPS--PSHPSA-TIKHRDLDAVLLLLLLCDVHQHNPDLLR 117

Query: 121 AAPQAKWPAVLGKHFCESALSLSGIVGGAYEGAVLLPYVEMVTRCRRFVNAMGGGGVRGG 180
             P+ +W  +L K   ++ L+ SGI  G + G VLLPYVEM+TRC +FV AMGG     G
Sbjct: 118 -TPRDEWRGILTKRCSDTILTHSGI--GVHYGGVLLPYVEMITRCWKFVAAMGG----CG 170

Query: 181 EKEGRDVAAAVAAVVRLPSVDGAG-ADQCCVICKEEMGGGRDVCSGSLLMMF-------- 231
           EKEGR+VAAA +AVV LP+V+  G     C IC+EEM  GRDVC      +F        
Sbjct: 171 EKEGREVAAAPSAVVALPTVEVTGDVTGECAICREEMREGRDVCELPCQHLFHWMCILPW 230

Query: 232 LERSNGCGTLSLKRAAAAVLME 253
           L++ N C     +     VL E
Sbjct: 231 LKKRNTCPCCRFQLPTEDVLGE 252

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224088615|ref|XP_002308497.1| predicted protein [Populus trichocarpa] gi|222854473|gb|EEE92020.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356537435|ref|XP_003537233.1| PREDICTED: uncharacterized protein LOC100810879 [Glycine max] Back     alignment and taxonomy information
>gi|30679751|ref|NP_195895.2| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|26451566|dbj|BAC42880.1| unknown protein [Arabidopsis thaliana] gi|28973295|gb|AAO63972.1| unknown protein [Arabidopsis thaliana] gi|332003130|gb|AED90513.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297806207|ref|XP_002870987.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297316824|gb|EFH47246.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|7413550|emb|CAB86029.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449440361|ref|XP_004137953.1| PREDICTED: uncharacterized protein LOC101209757 [Cucumis sativus] gi|449529876|ref|XP_004171924.1| PREDICTED: uncharacterized protein LOC101225495 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356548186|ref|XP_003542484.1| PREDICTED: uncharacterized protein LOC100818800 [Glycine max] Back     alignment and taxonomy information
>gi|224138550|ref|XP_002322842.1| predicted protein [Populus trichocarpa] gi|222867472|gb|EEF04603.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|218196787|gb|EEC79214.1| hypothetical protein OsI_19938 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
TAIR|locus:2151241283 SGR9 "SHOOT GRAVITROPISM 9" [A 0.817 0.759 0.377 1.5e-28
TAIR|locus:2151241 SGR9 "SHOOT GRAVITROPISM 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 318 (117.0 bits), Expect = 1.5e-28, P = 1.5e-28
 Identities = 89/236 (37%), Positives = 115/236 (48%)

Query:     1 MEEE--TIIISALSTLTPNKLKDLTHTILSLSDHWRRRLSAVISSPIXXXXXXXXXXXXX 58
             ME+E  TII+++LS L+P+ L +LTH+ILS+S H RRRL AV+SSP              
Sbjct:     1 MEDENTTIIMASLSALSPSHLTNLTHSILSISHHHRRRLGAVLSSPTLFSLTLRHLLSLS 60

Query:    59 XPNKTLLIARHLLFSLQLLTQCFPRAPPPHSSTYQI--KRRDHDAVXXXXXXCEVHQQDP 116
              P+KT LIA HLL  L  L     R    H S+Y +  K RD DAV      CE HQ  P
Sbjct:    61 LPDKTHLIANHLLSLLHPLL--IHRK---HHSSYAVTMKLRDLDAVVLLLFLCETHQLHP 115

Query:   117 EALSAAPQAKWPAVLGKHFCESALSL-SGIVGGAYEGAVLLPYVEMVTRCRRFVNAMXXX 175
             + L A+    W  +LG  +  + LS  SG+     +  +L+PY+E + RC+RFV+ M   
Sbjct:   116 DVLEASAD-NWREILGNTYSNNMLSNNSGL--WTCDAGILMPYIETLVRCKRFVDIMGGY 172

Query:   176 XXXXXXXXXXD----XXXXXXXXXRLPSVDGAGADQC----CVICKEEMGGGRDVC 223
                                     R   V    A       CVICKEEM  GRDVC
Sbjct:   173 NHLRRRDQKEGYQVPAARAAVVALRAVEVFNVAASNAGEVECVICKEEMSEGRDVC 228


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.322   0.134   0.409    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      263       221   0.00095  112 3  11 22  0.49    32
                                                     32  0.40    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  606 (64 KB)
  Total size of DFA:  181 KB (2104 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  17.05u 0.14s 17.19t   Elapsed:  00:00:01
  Total cpu time:  17.05u 0.14s 17.19t   Elapsed:  00:00:01
  Start:  Fri May 10 23:46:01 2013   End:  Fri May 10 23:46:02 2013
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0009501 "amyloplast" evidence=IDA
GO:0009630 "gravitropism" evidence=IMP

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 263
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.91
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.63
PHA02929238 N1R/p28-like protein; Provisional 98.52
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.24
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.19
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.9
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.74
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.38
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.94
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.89
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.89
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.8
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.73
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 96.35
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.32
PHA02926242 zinc finger-like protein; Provisional 96.21
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 96.12
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.0
PF1463444 zf-RING_5: zinc-RING finger domain 95.54
KOG149384 consensus Anaphase-promoting complex (APC), subuni 95.25
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 95.21
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 94.95
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 94.69
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 94.54
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.52
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 93.89
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.31
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 93.2
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 93.08
COG52191525 Uncharacterized conserved protein, contains RING Z 92.54
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 92.47
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 91.56
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 91.47
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 90.54
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 90.1
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 88.22
PHA02862156 5L protein; Provisional 88.12
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 88.1
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 86.34
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 85.67
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 85.32
PHA02825162 LAP/PHD finger-like protein; Provisional 84.1
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 82.74
KOG3002 299 consensus Zn finger protein [General function pred 82.68
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 80.33
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=98.91  E-value=7.1e-10  Score=105.64  Aligned_cols=67  Identities=15%  Similarity=0.194  Sum_probs=55.1

Q ss_pred             CchhhHHHHHcCCceecCCCCc-----cCccccccccCCCccccc------cc--chhhhhcCCC-CCCCCCCCCCchhh
Q 024764          186 DVAAAVAAVVRLPSVDGAGADQ-----CCVICKEEMGGGRDVCSG------SL--LMMFLERSNG-CGTLSLKRAAAAVL  251 (263)
Q Consensus       186 ~pPASkaaI~aLP~V~i~~~~~-----eCaIClEEf~~Ge~v~~L------H~--I~pWL~~~nT-CPvCR~eLptdD~~  251 (263)
                      .-...|..+.++|..++.+++.     .|+||+|+|+.||+++.|      |.  |.+||.++.+ ||+|+.+++++...
T Consensus       204 ~~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di~~~~~~  283 (348)
T KOG4628|consen  204 RNRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDIRTDSGS  283 (348)
T ss_pred             hhhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcCCCCCCC
Confidence            3467899999999999965433     899999999999987666      55  9999988755 99999999887664


Q ss_pred             h
Q 024764          252 M  252 (263)
Q Consensus       252 ~  252 (263)
                      .
T Consensus       284 ~  284 (348)
T KOG4628|consen  284 E  284 (348)
T ss_pred             C
Confidence            3

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.29
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.06
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.84
2ect_A78 Ring finger protein 126; metal binding protein, st 98.74
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.68
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.67
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.66
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.63
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.61
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.57
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.56
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.49
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.44
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.42
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.41
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.4
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.33
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.32
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.23
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.17
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.14
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.13
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.09
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.05
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.86
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.85
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.84
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.84
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.82
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.77
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.76
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.68
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.68
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.66
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.66
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.49
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.48
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.46
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.43
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.28
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.25
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.18
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.18
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.15
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.15
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.13
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.1
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.1
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.04
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.03
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.0
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.0
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.91
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.89
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 96.89
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.69
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.47
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.39
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.29
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 96.27
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 95.73
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 95.44
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 95.41
2f42_A179 STIP1 homology and U-box containing protein 1; cha 95.4
2ea5_A68 Cell growth regulator with ring finger domain prot 94.42
3nw0_A238 Non-structural maintenance of chromosomes element 93.71
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 92.37
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 91.86
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 91.73
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 90.6
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.29  E-value=2.3e-12  Score=96.94  Aligned_cols=63  Identities=19%  Similarity=0.320  Sum_probs=53.8

Q ss_pred             CCchhhHHHHHcCCceecCC------CCccCccccccccCCCccccc---c---c--chhhhhcCCCCCCCCCCCCC
Q 024764          185 RDVAAAVAAVVRLPSVDGAG------ADQCCVICKEEMGGGRDVCSG---S---L--LMMFLERSNGCGTLSLKRAA  247 (263)
Q Consensus       185 g~pPASkaaI~aLP~V~i~~------~~~eCaIClEEf~~Ge~v~~L---H---~--I~pWL~~~nTCPvCR~eLpt  247 (263)
                      +.++++++.|++||.+.+..      ++.+|+||+++|..|+.+..+   |   .  |.+||+.+++||+||.+++.
T Consensus        13 ~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           13 ANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             CCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            77889999999999998743      356799999999998866544   4   3  99999999999999999875
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.15
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.69
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.54
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.51
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.37
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.29
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.09
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.9
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.64
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.51
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.42
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.26
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.92
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.74
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.38
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 92.41
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.15  E-value=7.6e-12  Score=86.79  Aligned_cols=43  Identities=19%  Similarity=0.332  Sum_probs=36.8

Q ss_pred             CCCccCccccccccCCCccccc-------cc--chhhhhcCCCCCCCCCCCC
Q 024764          204 GADQCCVICKEEMGGGRDVCSG-------SL--LMMFLERSNGCGTLSLKRA  246 (263)
Q Consensus       204 ~~~~eCaIClEEf~~Ge~v~~L-------H~--I~pWL~~~nTCPvCR~eLp  246 (263)
                      +++.+|+||+++|..|+.+..+       |.  |.+||+.+++||+||+++.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            4567899999999999877554       44  9999999999999999874
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure