Citrus Sinensis ID: 024888

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MLEKQIELLRSMQRSQLSMMFTNQEDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFNPNSMPKVQAEEIRELTTVNTEVAGYDLSQFPQPEFSSSSDLSASSGVEKGMPSSSLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDGSQSN
ccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccEEEEcccccccccEEEEEEEEccEEEcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHccccccHHcccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccEEEEccccccc
cccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEEEccEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEcccccEEEEEccEEEEEEcccccc
MLEKQIELLRSMQRSQLSMMFTNQEDDSVLYKNVLQELAQKEAYalpvyntkqsgeshaptfVSTVEvggevfsgqgakskKQAEMSAAKVAYMRlkepnpsqgpalvspdiqaqadysssslqsnvtaDLHHNIQTagrlvfnpnsmpkVQAEEIRELTTVNtevagydlsqfpqpefssssdlsassgvekgmpssslplectvdprvdpiaqsvradgrtckiirvrpnrpnmkfpegssvlhrdnqwvawtdgsqsn
MLEKQIELLRSMQRSQLSMMFTNQEDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVfsgqgakskkqAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAgrlvfnpnSMPKVQAEEIRELTTVNTEVAGYDLSQFPQPEFSSSSDLSASSGVEKGMPSSSLPLECTVDPRVDpiaqsvradgrtckiirvrpnrpnmkfpegssvlhrdnqwvawtdgsqsn
MLEKQIELLRSMQRSQLSMMFTNQEDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFNPNSMPKVQAEEIRELTTVNTEVAGYDLsqfpqpefssssdlsassGVEKGMPSSSLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDGSQSN
****************************VLYKNVLQELAQKEAYALPVYN************V**V******************************************************************HNIQTAGRLVF***************LTTVNTEVAG*************************************************RADGRTCKIIRV******************DNQWVAW*******
MLEKQIELLRSMQRSQLSMMFTNQEDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGG***************MSAAKVAYMR********************************************************************************************************************************CKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDG****
MLEKQIELLRSMQRSQLSMMFTNQEDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFS**************AKVAYMRLKE********LVSPDIQA**********SNVTADLHHNIQTAGRLVFNPNSMPKVQAEEIRELTTVNTEVAGYDLSQFP***********************SLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDGSQSN
*LEKQIELLRSMQR**LSMM*TNQEDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEP************************************************************************************************************************DGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEKQIELLRSMQRSQLSMMFTNQEDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFNPNSMPKVQAEEIRELTTVNTEVAGYDLSQFPQPEFSSSSDLSASSGVEKGMPSSSLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDGSQSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query261 2.2.26 [Sep-21-2011]
Q8H1D4355 Double-stranded RNA-bindi no no 0.854 0.628 0.316 9e-21
B7E321404 Double-stranded RNA-bindi yes no 0.363 0.235 0.427 6e-14
Q0DKP4 593 Double-stranded RNA-bindi yes no 0.275 0.121 0.465 3e-13
Q9LJF5359 Double-stranded RNA-bindi no no 0.275 0.200 0.479 3e-13
Q9AV50 514 Double-stranded RNA-bindi no no 0.279 0.142 0.479 4e-13
Q9SKN2 434 Double-stranded RNA-bindi no no 0.275 0.165 0.493 7e-13
Q8GY79393 Double-stranded RNA-bindi no no 0.275 0.183 0.465 1e-12
Q5N8Z0441 Double-stranded RNA-bindi no no 0.321 0.190 0.423 1e-11
Q0IV63 473 Double-stranded RNA-bindi no no 0.256 0.141 0.455 7e-09
Q0IQN6424 Double-stranded RNA-bindi no no 0.256 0.158 0.455 7e-09
>sp|Q8H1D4|DRB4_ARATH Double-stranded RNA-binding protein 4 OS=Arabidopsis thaliana GN=DBR4 PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (250), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 137/281 (48%), Gaps = 58/281 (20%)

Query: 25  EDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQA 84
           E   V YKN+LQE+AQKE+  LP Y T  SG SHAPTF STVE  G+VFSG+ AK+KK A
Sbjct: 77  EGIDVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLA 136

Query: 85  EMSAAKVAYMRLKEPNPSQ--GPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLV 142
           EMSAAKVA+M +K  N +Q   P L S   + Q D +S+   S    ++H   Q + ++V
Sbjct: 137 EMSAAKVAFMSIKNGNSNQTGSPTLPS---ERQEDVNSNVKSS--PQEIHS--QPSSKVV 189

Query: 143 FNPNSMP---KVQAEEIRELTTV---NTEVAGYDLSQFPQPEFSSSSDLSASSGVEKGMP 196
             P++     KV  +E  +L      N +     L++   P    +     + G++  + 
Sbjct: 190 MTPDTPSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGTLSALTTDGMKMNIA 249

Query: 197 SSSLPLE------CTVD-PRVDPIAQSVRA-----------DG---RTCKI--------- 226
           SSSLP+        T++ P  + I +++ A           DG    +C +         
Sbjct: 250 SSSLPIPHNPTNVITLNAPAANGIKRNIAACSSWMPQNPTNDGSETSSCVVDESEKKKLI 309

Query: 227 -------------IRVRPNRPNMKFPEGSSVLHRDNQWVAW 254
                        +  RP  P +  P+ + +L RD++++A+
Sbjct: 310 MGTGHLSIPTGQHVVCRPWNPEITLPQDAEMLFRDDKFIAY 350
Double-stranded RNA-binding protein involved in RNA-mediated post-transcriptional gene silencing (PTGS). Functions in the trans-acting small interfering RNAs (ta-siRNAs) biogenesis by binding and assisting DICER-LIKE 4 (DCL4). Required for DCL4 activity. Required for the 21 nucleotide ta-siRNAs production of the TAS3 transcript in leaves but not in flowers. Plays an important role in silencing RNA of both DNA and RNA viruses. Involved with argonaute 7 (AGO7) and RDR6 in turnip crinkle virus (TCV) silencing. May not be directly involved in viral siRNA production. May stabilize the 21 nucleotide viral siRNAs and deliver them to the RISC complex. Targeted by the viral silencing suppressor (VSR) transactivator/viroplasmin (TAV) protein of the cauliflower mosaic virus (CaMV) that inactivates DRB4 function in RNA silencing. Probably not involved in the guide strand selection from RNA duplexes. Involved in leaf morphology through its function in ta-siRNA-mediated silencing.
Arabidopsis thaliana (taxid: 3702)
>sp|B7E321|DRB5_ORYSJ Double-stranded RNA-binding protein 5 OS=Oryza sativa subsp. japonica GN=DRB5 PE=2 SV=1 Back     alignment and function description
>sp|Q0DKP4|DRB2_ORYSJ Double-stranded RNA-binding protein 2 OS=Oryza sativa subsp. japonica GN=DRB2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJF5|DRB3_ARATH Double-stranded RNA-binding protein 3 OS=Arabidopsis thaliana GN=DRB3 PE=2 SV=1 Back     alignment and function description
>sp|Q9AV50|DRB6_ORYSJ Double-stranded RNA-binding protein 6 OS=Oryza sativa subsp. japonica GN=DRB6 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKN2|DRB2_ARATH Double-stranded RNA-binding protein 2 OS=Arabidopsis thaliana GN=DRB2 PE=1 SV=1 Back     alignment and function description
>sp|Q8GY79|DRB5_ARATH Double-stranded RNA-binding protein 5 OS=Arabidopsis thaliana GN=DRB5 PE=1 SV=1 Back     alignment and function description
>sp|Q5N8Z0|DRB1_ORYSJ Double-stranded RNA-binding protein 1 OS=Oryza sativa subsp. japonica GN=DRB1 PE=2 SV=1 Back     alignment and function description
>sp|Q0IV63|DRB7_ORYSJ Double-stranded RNA-binding protein 7 OS=Oryza sativa subsp. japonica GN=DRB7 PE=2 SV=1 Back     alignment and function description
>sp|Q0IQN6|DRB8_ORYSJ Double-stranded RNA-binding protein 8 OS=Oryza sativa subsp. japonica GN=DRB8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
224150739330 predicted protein [Populus trichocarpa] 0.777 0.615 0.361 3e-25
296085908 494 unnamed protein product [Vitis vinifera] 0.475 0.251 0.523 1e-21
359481028 495 PREDICTED: uncharacterized protein LOC10 0.467 0.246 0.516 1e-20
224125924240 predicted protein [Populus trichocarpa] 0.302 0.329 0.590 2e-20
255569490280 double-stranded RNA binding protein, put 0.785 0.732 0.315 6e-20
147856819292 hypothetical protein VITISV_028064 [Viti 0.279 0.25 0.648 2e-19
238480134329 double-stranded-RNA-binding protein 4 [A 0.839 0.665 0.338 3e-19
7362760345 putative protein [Arabidopsis thaliana] 0.839 0.634 0.317 5e-19
22331912355 double-stranded-RNA-binding protein 4 [A 0.854 0.628 0.316 5e-19
18389232355 unknown protein [Arabidopsis thaliana] 0.854 0.628 0.316 6e-19
>gi|224150739|ref|XP_002337003.1| predicted protein [Populus trichocarpa] gi|222837556|gb|EEE75921.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 136/271 (50%), Gaps = 68/271 (25%)

Query: 25  EDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQA 84
           E+D   YK++LQELAQ+E   LP Y T +SGE+H PTFVS VE+ GE+F+GQGAK+KKQA
Sbjct: 77  EEDGFGYKSLLQELAQREGCGLPTYWTDKSGEAHVPTFVSKVEIEGEIFTGQGAKTKKQA 136

Query: 85  EMSAAKVAYMRLKEPNPSQGPALVSPDIQAQ----------------------ADYSSSS 122
           EMSAAK+AY  L++   SQ P  +S   Q Q                        +S S+
Sbjct: 137 EMSAAKIAYTALQQRYSSQSPGFLSTSSQFQEAPRSSPLSPARQSQEAVQSETPQFSVSN 196

Query: 123 LQSNVTADLHHNIQTAGRLVFNPNSMPKV-----QAEEIRELTTV---NTEVA--GYD-- 170
           L++ +TA L  NIQ            PK+     QAEE R  + V   N  +A  G D  
Sbjct: 197 LRAGLTAYLQQNIQ------------PKLPVSNEQAEEYRANSVVSNHNPSIASPGQDSC 244

Query: 171 ---LSQFPQPEFSSSS----DLSASSGVEKGMPSSSLPLECTVDPRVDPIAQSVRADGRT 223
               S  P P  + SS    DL++SS     +PS S P        ++ + + +R     
Sbjct: 245 SAMASITPSPAAAISSSPKHDLTSSS-----LPSDS-PTNLATSSSIEFMVRGIR----- 293

Query: 224 CKIIRVRPNRPNMKFPEGSSVLH-RDNQWVA 253
              + + P+   M +P GS+VL   D++W A
Sbjct: 294 ---VLMHPSGTKMTYPAGSTVLPISDDKWAA 321

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296085908|emb|CBI31232.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481028|ref|XP_002270719.2| PREDICTED: uncharacterized protein LOC100243264 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125924|ref|XP_002319709.1| predicted protein [Populus trichocarpa] gi|222858085|gb|EEE95632.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255569490|ref|XP_002525712.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223535012|gb|EEF36695.1| double-stranded RNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147856819|emb|CAN79168.1| hypothetical protein VITISV_028064 [Vitis vinifera] Back     alignment and taxonomy information
>gi|238480134|ref|NP_001154686.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|197267565|dbj|BAG69145.1| dsRNA-binding protein [Arabidopsis thaliana] gi|332646874|gb|AEE80395.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7362760|emb|CAB83130.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22331912|ref|NP_191839.2| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|42572769|ref|NP_974480.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|75244610|sp|Q8H1D4.1|DRB4_ARATH RecName: Full=Double-stranded RNA-binding protein 4; AltName: Full=dsRNA-binding protein 4; Short=AtDRB4 gi|23297784|gb|AAN13025.1| unknown protein [Arabidopsis thaliana] gi|332646872|gb|AEE80393.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|332646873|gb|AEE80394.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18389232|gb|AAL67059.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
TAIR|locus:2081620355 DRB4 "double-stranded-RNA-bind 0.662 0.487 0.385 9.4e-27
TAIR|locus:2057491 434 DRB2 "dsRNA-binding protein 2" 0.329 0.198 0.430 3.5e-13
TAIR|locus:2829928359 DRB3 "dsRNA-binding protein 3" 0.279 0.203 0.479 3.6e-13
TAIR|locus:2163016393 DRB5 "dsRNA-binding protein 5" 0.279 0.185 0.465 4.1e-12
UNIPROTKB|Q0IQN6424 DRB8 "Double-stranded RNA-bind 0.283 0.174 0.441 7.6e-08
TAIR|locus:2024407419 HYL1 "HYPONASTIC LEAVES 1" [Ar 0.340 0.212 0.362 2.9e-07
UNIPROTKB|C9JUP4141 ADARB1 "Double-stranded RNA-sp 0.237 0.439 0.437 5.9e-06
UNIPROTKB|F1SG34 565 F1SG34 "Uncharacterized protei 0.348 0.161 0.361 9.5e-06
ZFIN|ZDB-GENE-000627-2 720 adarb1a "adenosine deaminase, 0.344 0.125 0.354 1e-05
UNIPROTKB|E2R5U0 701 ADARB1 "Uncharacterized protei 0.409 0.152 0.330 1.3e-05
TAIR|locus:2081620 DRB4 "double-stranded-RNA-binding protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 265 (98.3 bits), Expect = 9.4e-27, Sum P(2) = 9.4e-27
 Identities = 71/184 (38%), Positives = 98/184 (53%)

Query:    25 EDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQA 84
             E   V YKN+LQE+AQKE+  LP Y T  SG SHAPTF STVE  G+VFSG+ AK+KK A
Sbjct:    77 EGIDVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLA 136

Query:    85 EMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFN 144
             EMSAAKVA+M +K  N +Q  +   P  + Q D +S+   S    ++H   Q + ++V  
Sbjct:   137 EMSAAKVAFMSIKNGNSNQTGSPTLPS-ERQEDVNSNVKSS--PQEIHS--QPSSKVVMT 191

Query:   145 PNSMPK---VQAEEIRELTTV---NTEVAGYDLXXXXXXXXXXXXXXXXXXGVEKGMPSS 198
             P++  K   V  +E  +L      N +     L                  G++  + SS
Sbjct:   192 PDTPSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGTLSALTTDGMKMNIASS 251

Query:   199 SLPL 202
             SLP+
Sbjct:   252 SLPI 255
GO:0003723 "RNA binding" evidence=IEA
GO:0003725 "double-stranded RNA binding" evidence=IEA;ISS;IDA
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA;IMP
GO:0060145 "viral gene silencing in virus induced gene silencing" evidence=IMP
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA;IMP
GO:0070919 "production of siRNA involved in chromatin silencing by small RNA" evidence=IMP
GO:0051607 "defense response to virus" evidence=RCA
TAIR|locus:2057491 DRB2 "dsRNA-binding protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2829928 DRB3 "dsRNA-binding protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163016 DRB5 "dsRNA-binding protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IQN6 DRB8 "Double-stranded RNA-binding protein 8" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2024407 HYL1 "HYPONASTIC LEAVES 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C9JUP4 ADARB1 "Double-stranded RNA-specific editase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SG34 F1SG34 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000627-2 adarb1a "adenosine deaminase, RNA-specific, B1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5U0 ADARB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_6651000001
hypothetical protein (330 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
cd0004868 cd00048, DSRM, Double-stranded RNA binding motif 2e-19
TIGR02191220 TIGR02191, RNaseIII, ribonuclease III, bacterial 3e-17
PRK00102229 PRK00102, rnc, ribonuclease III; Reviewed 7e-17
smart0035867 smart00358, DSRM, Double-stranded RNA binding moti 3e-16
pfam0003566 pfam00035, dsrm, Double-stranded RNA binding motif 4e-16
COG0571235 COG0571, Rnc, dsRNA-specific ribonuclease [Transcr 7e-14
PRK12371235 PRK12371, PRK12371, ribonuclease III; Reviewed 4e-05
TIGR04238201 TIGR04238, seadorna_dsRNA, seadornavirus double-st 2e-04
PHA03103183 PHA03103, PHA03103, double-strand RNA-binding prot 2e-04
>gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif Back     alignment and domain information 
 Score = 79.2 bits (196), Expect = 2e-19
 Identities = 30/68 (44%), Positives = 40/68 (58%), Gaps = 3/68 (4%)

Query: 31 YKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGG-EVFSGQGAKSKKQAEMSA 88
           K++LQELAQK    LP Y   ++ G  HAP F   V VGG     G+G  SKK+A+ +A
Sbjct: 2  PKSLLQELAQKRGKPLPEYELVEEEGPDHAPRFTVEVTVGGKITGEGEG-SSKKEAKQNA 60

Query: 89 AKVAYMRL 96
          A+ A  +L
Sbjct: 61 AEAALRKL 68

Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III, RNases H1, and dsRNA dependent adenosine deaminases. Length = 68
>gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial Back     alignment and domain information
>gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed Back     alignment and domain information
>gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] Back     alignment and domain information
>gnl|CDD|171444 PRK12371, PRK12371, ribonuclease III; Reviewed Back     alignment and domain information
>gnl|CDD|234517 TIGR04238, seadorna_dsRNA, seadornavirus double-stranded RNA-binding protein Back     alignment and domain information
>gnl|CDD|222987 PHA03103, PHA03103, double-strand RNA-binding protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 261
PRK12371235 ribonuclease III; Reviewed 99.86
COG0571235 Rnc dsRNA-specific ribonuclease [Transcription] 99.84
PRK14718467 ribonuclease III; Provisional 99.81
PRK12372413 ribonuclease III; Reviewed 99.8
PRK00102229 rnc ribonuclease III; Reviewed 99.76
TIGR02191220 RNaseIII ribonuclease III, bacterial. This family 99.74
PHA03103183 double-strand RNA-binding protein; Provisional 99.72
PHA02701183 ORF020 dsRNA-binding PKR inhibitor; Provisional 99.72
cd0004868 DSRM Double-stranded RNA binding motif. Binding is 99.7
smart0035867 DSRM Double-stranded RNA binding motif. 99.67
PF0003567 dsrm: Double-stranded RNA binding motif; InterPro: 99.64
KOG1817533 consensus Ribonuclease [RNA processing and modific 99.44
PF1470980 DND1_DSRM: double strand RNA binding domain from D 99.43
KOG3732339 consensus Staufen and related double-stranded-RNA- 99.27
KOG3732339 consensus Staufen and related double-stranded-RNA- 99.19
KOG3769333 consensus Ribonuclease III domain proteins [Transl 98.56
KOG2777 542 consensus tRNA-specific adenosine deaminase 1 [RNA 98.49
KOG4334650 consensus Uncharacterized conserved protein, conta 98.01
KOG2777 542 consensus tRNA-specific adenosine deaminase 1 [RNA 96.9
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 95.96
PF0336890 Dicer_dimer: Dicer dimerisation domain; InterPro: 95.7
KOG2334477 consensus tRNA-dihydrouridine synthase [Translatio 93.39
PF14954252 LIX1: Limb expression 1 91.13
KOG3792 816 consensus Transcription factor NFAT, subunit NF90 83.75
>PRK12371 ribonuclease III; Reviewed Back     alignment and domain information 
Probab=99.86  E-value=1.3e-21  Score=176.28  Aligned_cols=99  Identities=27%  Similarity=0.250  Sum_probs=91.0

Q ss_pred             CchhcHHHHHHHHHHHHhhhhccccCCCCChHHHHHHHHHHcCCCCCcEEe-cccCCCCCCcEEEEEEECCEEeecccCC
Q 024888            1 MLEKQIELLRSMQRSQLSMMFTNQEDDSVLYKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAK   79 (261)
Q Consensus         1 ~LD~Gle~ar~fV~kll~~~l~~~~~~~~n~KS~LQEl~Qk~~~~~P~Y~~-~~sGp~H~~~Ftv~V~V~g~~~g~G~G~   79 (261)
                      |||+|++.|++||.++|.+.+........|||+.||||||+.++..|.|++ ...||+|.+.|+|.|.|+|..++.|.|+
T Consensus       133 ylD~G~~~a~~~i~~~~~~~~~~~~~~~~d~Ks~LqE~~q~~~~~~p~Y~~~~~~Gp~h~~~F~v~v~v~~~~~~~g~G~  212 (235)
T PRK12371        133 YLDGGLEAARPFIQRYWQKRALETDAARRDAKTELQEWAHAQFGVTPVYRVDSRSGPDHDPRFTVEVEVKGFAPETGEGR  212 (235)
T ss_pred             HHcCCHHHHHHHHHHHHHHHHhccccccCCHHHHHHHHHHhcCCCCCeEEEEEeecCCCCCeEEEEEEECCEEEEEeeeC
Confidence            689999999999999999877665455679999999999999898999998 5789999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHhhCC
Q 024888           80 SKKQAEMSAAKVAYMRLKEP   99 (261)
Q Consensus        80 SKKeAEq~AAk~AL~~L~~~   99 (261)
                      |||+|||+||+.||+.|...
T Consensus       213 sKK~Ae~~AA~~al~~~~~~  232 (235)
T PRK12371        213 SKRAAEQVAAEKMLEREGVW  232 (235)
T ss_pred             CHHHHHHHHHHHHHHHhhhh
Confidence            99999999999999998753

>COG0571 Rnc dsRNA-specific ribonuclease [Transcription] Back     alignment and domain information
>PRK14718 ribonuclease III; Provisional Back     alignment and domain information
>PRK12372 ribonuclease III; Reviewed Back     alignment and domain information
>PRK00102 rnc ribonuclease III; Reviewed Back     alignment and domain information
>TIGR02191 RNaseIII ribonuclease III, bacterial Back     alignment and domain information
>PHA03103 double-strand RNA-binding protein; Provisional Back     alignment and domain information
>PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional Back     alignment and domain information
>cd00048 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>smart00358 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] Back     alignment and domain information
>KOG1817 consensus Ribonuclease [RNA processing and modification] Back     alignment and domain information
>PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 Back     alignment and domain information
>KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] Back     alignment and domain information
>KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] Back     alignment and domain information
>KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] Back     alignment and domain information
>KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] Back     alignment and domain information
>KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases Back     alignment and domain information
>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14954 LIX1: Limb expression 1 Back     alignment and domain information
>KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
2l2m_A77 Solution Structure Of The Second Dsrbd Of Hyl1 Leng 9e-08
3adj_A76 Structure Of Arabidopsis Hyl1 And Its Molecular Imp 1e-07
2l3j_A236 The Solution Structure Of The Adar2 Dsrbm-Rna Compl 2e-05
2l3c_A74 Solution Structure Of Adar2 Dsrbm1 Bound To Lsl Rna 1e-04
2b7t_A73 Structure Of Adar2 Dsrbm1 Length = 73 1e-04
2l2n_A103 Backbone 1h, 13c, And 15n Chemical Shift Assignment 3e-04
3adg_A73 Structure Of Arabidopsis Hyl1 And Its Molecular Imp 5e-04
>pdb|2L2M|A Chain A, Solution Structure Of The Second Dsrbd Of Hyl1 Length = 77 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
Query: 30 LYKNVLQELAQKEAYALPVYNTKQ-SGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSA 88
          L KN+LQE AQK  YA+P+Y  ++         F  TVE+GG  ++G   ++KK AE+SA
Sbjct: 8  LCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISA 67
Query: 89 AKVAYMRLK 97
           + A + ++
Sbjct: 68 GRTALLAIQ 76
>pdb|3ADJ|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 76 Back     alignment and structure
>pdb|2L3J|A Chain A, The Solution Structure Of The Adar2 Dsrbm-Rna Complex Reveals A Sequence-Specific Read Out Of The Minor Groove Length = 236 Back     alignment and structure
>pdb|2L3C|A Chain A, Solution Structure Of Adar2 Dsrbm1 Bound To Lsl Rna Length = 74 Back     alignment and structure
>pdb|2B7T|A Chain A, Structure Of Adar2 Dsrbm1 Length = 73 Back     alignment and structure
>pdb|2L2N|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For The First Dsrbd Of Protein Hyl1 Length = 103 Back     alignment and structure
>pdb|3ADG|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 1e-28
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 4e-24
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 3e-23
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 4e-20
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 3e-18
2a11_A242 Ribonuclease III, RNAse III; nuclease domain, stru 2e-19
2nug_A221 Ribonuclease III, RNAse III; dsRNA, RNA interferen 5e-19
1x49_A97 Interferon-induced, double-stranded RNA- activated 7e-19
1whn_A128 Hypothetical protein riken cDNA 2310016K04; double 2e-18
1o0w_A252 Ribonuclease III, RNAse III; TM1102, structural ge 5e-18
3adl_A88 RISC-loading complex subunit tarbp2; TRBP2, miRNA 6e-18
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 1e-17
3n3w_A248 Ribonuclease III; nuclease domain, ribonuclase III 2e-17
1di2_A69 XLRBPA, double stranded RNA binding protein A; pro 3e-17
3llh_A90 RISC-loading complex subunit tarbp2; DSRBD, DSRM, 4e-17
2cpn_A89 TAR RNA-binding protein 2; double-stranded RNA bin 8e-17
2dix_A84 Interferon-inducible double stranded RNA- dependen 2e-16
3p1x_A75 Interleukin enhancer-binding factor 3; structural 5e-16
1whq_A99 RNA helicase A; double-stranded RNA binding domain 6e-16
2dmy_A97 Spermatid perinuclear RNA-binding protein; DSRM do 7e-16
2khx_A85 Ribonuclease 3; drosha, RNA binding domain, hydrol 1e-15
2b7v_A71 Double-stranded RNA-specific editase 1; RNA editin 4e-15
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 3e-14
1ekz_A76 DSRBDIII, maternal effect protein (staufen); struc 3e-14
2ljh_A114 Double-stranded RNA-specific editase ADAR; DSRBD, 4e-14
2l33_A91 Interleukin enhancer-binding factor 3; structural 5e-14
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 8e-14
3c4b_A265 Endoribonuclease dicer; RNAse, dsRNA binding prote 1e-13
3rv0_A341 K. polysporus DCR1; RNAse III enzyme, RNA binding 2e-13
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 2e-11
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 5e-06
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 8e-11
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 4e-10
1x48_A88 Interferon-induced, double-stranded RNA- activated 8e-08
2qvw_A756 GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral 2e-06
1t4o_A117 Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro 4e-05
1t4n_A94 Ribonuclease III; DSRBD, RNA-binding, hydrolase; N 1e-04
1uil_A113 Double-stranded RNA-binding motif; structural geno 4e-04
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 Back     alignment and structure
 Score =  103 bits (258), Expect = 1e-28
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 27  DSVLYKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAE 85
              L KN+LQE AQK  YA+P+Y   K         F  TVE+GG  ++G   ++KK AE
Sbjct: 2   SHGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAE 61

Query: 86  MSAAKVAYMRLKEPN 100
           +SA + A + ++   
Sbjct: 62  ISAGRTALLAIQSDT 76
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 Back     alignment and structure
>2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 Back     alignment and structure
>2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 Back     alignment and structure
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 Back     alignment and structure
>1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 Back     alignment and structure
>1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 Back     alignment and structure
>3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 Back     alignment and structure
>3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 Back     alignment and structure
>1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 Back     alignment and structure
>3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 Back     alignment and structure
>2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 Back     alignment and structure
>2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 Back     alignment and structure
>3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 Back     alignment and structure
>1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 Back     alignment and structure
>2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 Back     alignment and structure
>2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 Back     alignment and structure
>1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 Back     alignment and structure
>2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 Back     alignment and structure
>2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 Back     alignment and structure
>3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 Back     alignment and structure
>3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 Back     alignment and structure
>1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 88 Back     alignment and structure
>2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 Back     alignment and structure
>1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B Length = 117 Back     alignment and structure
>1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 Length = 94 Back     alignment and structure
>1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 99.86
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 99.85
3adl_A88 RISC-loading complex subunit tarbp2; TRBP2, miRNA 99.84
1di2_A69 XLRBPA, double stranded RNA binding protein A; pro 99.84
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 99.83
2khx_A85 Ribonuclease 3; drosha, RNA binding domain, hydrol 99.83
2cpn_A89 TAR RNA-binding protein 2; double-stranded RNA bin 99.83
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 99.83
1o0w_A252 Ribonuclease III, RNAse III; TM1102, structural ge 99.83
1ekz_A76 DSRBDIII, maternal effect protein (staufen); struc 99.82
2nug_A221 Ribonuclease III, RNAse III; dsRNA, RNA interferen 99.82
2dix_A84 Interferon-inducible double stranded RNA- dependen 99.82
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 99.81
3llh_A90 RISC-loading complex subunit tarbp2; DSRBD, DSRM, 99.81
3n3w_A248 Ribonuclease III; nuclease domain, ribonuclase III 99.8
1x49_A97 Interferon-induced, double-stranded RNA- activated 99.8
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 99.8
1whq_A99 RNA helicase A; double-stranded RNA binding domain 99.79
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 99.79
1t4n_A94 Ribonuclease III; DSRBD, RNA-binding, hydrolase; N 99.79
1x48_A88 Interferon-induced, double-stranded RNA- activated 99.79
2a11_A242 Ribonuclease III, RNAse III; nuclease domain, stru 99.79
2dmy_A97 Spermatid perinuclear RNA-binding protein; DSRM do 99.78
1uil_A113 Double-stranded RNA-binding motif; structural geno 99.77
2ljh_A114 Double-stranded RNA-specific editase ADAR; DSRBD, 99.76
1t4o_A117 Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro 99.76
1whn_A128 Hypothetical protein riken cDNA 2310016K04; double 99.76
2l33_A91 Interleukin enhancer-binding factor 3; structural 99.75
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 99.73
2b7v_A71 Double-stranded RNA-specific editase 1; RNA editin 99.71
3p1x_A75 Interleukin enhancer-binding factor 3; structural 99.65
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 99.61
3rv0_A341 K. polysporus DCR1; RNAse III enzyme, RNA binding 99.61
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 99.55
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 99.5
3c4b_A265 Endoribonuclease dicer; RNAse, dsRNA binding prote 99.45
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 99.41
2qvw_A756 GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral 96.3
2kou_A102 Dicer-like protein 4; ATP-binding, endonuclease, h 94.29
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 93.73
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 86.63
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 84.58
1uil_A113 Double-stranded RNA-binding motif; structural geno 84.21
3p1x_A75 Interleukin enhancer-binding factor 3; structural 83.88
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 81.91
2db2_A119 KIAA0890 protein; DSRM domain, structural genomics 80.98
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 80.05
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Back     alignment and structure
Probab=99.86  E-value=1.3e-21  Score=145.20  Aligned_cols=70  Identities=40%  Similarity=0.475  Sum_probs=66.3

Q ss_pred             CCChHHHHHHHHHHcCCCCCcEEecccCCCCCCcEEEEEEECCEEeecccC-CCHHHHHHHHHHHHHHHhh
Q 024888           28 SVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGA-KSKKQAEMSAAKVAYMRLK   97 (261)
Q Consensus        28 ~~n~KS~LQEl~Qk~~~~~P~Y~~~~sGp~H~~~Ftv~V~V~g~~~g~G~G-~SKKeAEq~AAk~AL~~L~   97 (261)
                      ..|||+.||||||++++.+|.|++..+||+|.+.|+|.|.|+|..++.|.| +|||+|||+||+.||+.|.
T Consensus         2 ~~d~Kt~LqE~~q~~~~~~p~Y~~~~~Gp~h~~~F~~~v~v~g~~~~~G~G~~sKK~Aeq~AA~~al~~L~   72 (73)
T 3adg_A            2 SHVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELA   72 (73)
T ss_dssp             CCSHHHHHHHHHHHTTCCCCEEEEEEESSTTSCEEEEEEEETTEEEECCSCBSSHHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHcCCCCCEEEEEeECCCCCCeEEEEEEECCEEEEeeeccCCHHHHHHHHHHHHHHHhh
Confidence            479999999999999999999998556999999999999999999999999 9999999999999999885
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Back     alignment and structure
>3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Back     alignment and structure
>1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Back     alignment and structure
>2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Back     alignment and structure
>1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Back     alignment and structure
>2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Back     alignment and structure
>2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Back     alignment and structure
>3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Back     alignment and structure
>3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Back     alignment and structure
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Back     alignment and structure
>1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 Back     alignment and structure
>1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Back     alignment and structure
>2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B Back     alignment and structure
>1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Back     alignment and structure
>3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Back     alignment and structure
>2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Back     alignment and structure
>3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Back     alignment and structure
>2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 261
d1o0wa269 d.50.1.1 (A:168-236) RNase III, C-terminal domain 9e-17
d2dmya184 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin 4e-15
d2nuga268 d.50.1.1 (A:151-218) RNase III, C-terminal domain 5e-15
d1x48a176 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p 6e-15
d1qu6a190 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p 1e-13
d2b7va171 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R 1e-12
d1whna_128 d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, 4e-12
d1x47a185 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie 6e-12
d1x49a185 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p 9e-12
d2b7ta173 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R 8e-11
d1di2a_69 d.50.1.1 (A:) Double-stranded RNA-binding protein 1e-10
d1uila_113 d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { 1e-09
d1qu6a289 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase 1e-09
d1ekza_76 d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros 8e-09
d1t4oa_81 d.50.1.1 (A:) RNase III, C-terminal domain {Baker' 1e-08
d1whqa_99 d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { 4e-08
d2cpna176 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu 2e-07
d2dixa173 d.50.1.1 (A:7-79) Interferon-inducible double stra 5e-07
d1uhza_89 d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul 3e-05
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: dsRBD-like
superfamily: dsRNA-binding domain-like
family: Double-stranded RNA-binding domain (dsRBD)
domain: RNase III, C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

 Score = 70.7 bits (173), Expect = 9e-17
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 31 YKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAA 89
          YK  LQE+ Q E    P Y   +         FV  V V G+  +    ++KK+AE  AA
Sbjct: 2  YKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAA 61

Query: 90 KVAYMRL 96
          ++AY +L
Sbjct: 62 RIAYEKL 68
>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 Back     information, alignment and structure
>d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 Back     information, alignment and structure
>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
d1o0wa269 RNase III, C-terminal domain {Thermotoga maritima 99.86
d2nuga268 RNase III, C-terminal domain {Aquifex aeolicus [Ta 99.82
d2dixa173 Interferon-inducible double stranded RNA-dependent 99.81
d1di2a_69 Double-stranded RNA-binding protein A, second dsRB 99.81
d2cpna176 TAR RNA-binding protein 2 {Human (Homo sapiens) [T 99.81
d1x49a185 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 99.8
d1qu6a190 dsRNA-dependent protein kinase pkr {Human (Homo sa 99.8
d1x48a176 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 99.8
d1whqa_99 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 99.79
d1uhza_89 staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 99.78
d1qu6a289 dsRNA-dependent protein kinase pkr {Human (Homo sa 99.77
d1x47a185 Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1ekza_76 Staufen, domain III {Fruit fly (Drosophila melanog 99.76
d1uila_113 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 99.74
d1whna_128 tRNA-dihydrouridine synthase 2-like, Dus2l (231001 99.72
d2b7va171 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 99.65
d1t4oa_81 RNase III, C-terminal domain {Baker's yeast (Sacch 99.64
d2dmya184 Spermatid perinuclear RNA-binding protein {Human ( 99.59
d2b7ta173 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 99.55
d1x47a185 Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} 88.8
d1whqa_99 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 86.06
d1qu6a289 dsRNA-dependent protein kinase pkr {Human (Homo sa 84.59
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: dsRBD-like
superfamily: dsRNA-binding domain-like
family: Double-stranded RNA-binding domain (dsRBD)
domain: RNase III, C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=99.86  E-value=4.4e-22  Score=144.20  Aligned_cols=67  Identities=34%  Similarity=0.489  Sum_probs=64.7

Q ss_pred             ChHHHHHHHHHHcCCCCCcEEe-cccCCCCCCcEEEEEEECCEEeecccCCCHHHHHHHHHHHHHHHh
Q 024888           30 LYKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRL   96 (261)
Q Consensus        30 n~KS~LQEl~Qk~~~~~P~Y~~-~~sGp~H~~~Ftv~V~V~g~~~g~G~G~SKKeAEq~AAk~AL~~L   96 (261)
                      |||+.||||||++++.+|.|++ ..+||+|.+.|++.|.|+|..++.|.|+|||+|||+||+.||+.|
T Consensus         1 d~Ks~LqE~~Qk~~~~~P~Y~~~~~~g~~h~~~F~~~v~v~~~~~~~g~g~sKK~Aeq~AA~~aL~~L   68 (69)
T d1o0wa2           1 DYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKL   68 (69)
T ss_dssp             CHHHHHHHHHHHHHSSCCEEEEEEEECCTTSCEEEEEEEETTEEEEEEEESSHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHHHHHHcCCCCCEEEEEEeeCCCCCceEEEEEEECCEEEEEEEeCCHHHHHHHHHHHHHHHh
Confidence            8999999999999999999998 678999999999999999999999999999999999999999987
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure