Citrus Sinensis ID: 024938


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MEQNLFEPETGYATEEDASLKQKWSPTSAPTNVPEKDGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRGGISSASDSKKPNLGEVVPSRPHPSALNTSVTSSSTSTRHQTQQLHSDFFQSQAPAFHNPQYFPHHYGSHAALASSSLGGMATISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVSNNPRIRRQEMELDKSLNRVSLFLFCCLVLCLLLF
ccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHHHHccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccccccccccccccccccccccccccccccccccccccEEEEEEHccccccEEEcccccccHHHHHHHHccccccccccccccccccEEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
meqnlfepetgyateedaslkqkwsptsaptnvpekdgsffecnicldsaqdpvvtlcghlycwpciykwlhvqtssldadeqqqncpvckanisvaslvplygrggissasdskkpnlgevvpsrphpsalntsvtssststrhqtQQLHSdffqsqapafhnpqyfphhygshaalassslggmatisffnplmgmlggmtlerifggsttslftypsqsllvsnnprirRQEMELDKSLNRVSLFLFCCLVLCLLLF
meqnlfepetgyateedaslkqkwspTSAPTNVPEKDGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRGGIssasdskkpnlgevvpsrphpsalnTSVTSSSTSTRHQTQQLHSDFFQSQAPAFHNPQYFPHHYGSHAALASSSLGGMATISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVSNNPRIRRQEMELDKSLNRVSLFLFCCLVLCLLLF
MEQNLFEPETGYATEEDASLKQKWSPTSAPTNVPEKDGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRGGISSASDSKKPNLGEVVPSRPHPSALNtsvtssststRHQTQQLHSDFFQSQAPAFHNPQYFPhhygshaalassslggMATISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVSNNPRIRRQEMELDKSLNRVSlflfcclvlclllf
**************************************SFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRG*******************************************************FHNPQYFPHHYGSHAALASSSLGGMATISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVS***********LDKSLNRVSLFLFCCLVLCLLL*
******************************************CNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTS****DEQQQNCPVCKANISVASLVPL***********************************************************F************************ATISFFNPLMGMLGGMTLERIFGGSTTSL**************************LNRVSLFLFCCLVLCLLLF
********************************VPEKDGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRGGISSASDSKKPNLGEVVP**************************HSDFFQSQAPAFHNPQYFPHHYGSHAALASSSLGGMATISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVSNNPRIRRQEMELDKSLNRVSLFLFCCLVLCLLLF
*************************************GSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRG************************************TRHQTQQLHSDFFQSQAPAFHNPQYFPHHYGSHAALASSSLGGMATISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVSNNPRIRRQEMELDKSLNRVSLFLFCCLVLCLLLF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQNLFEPETGYATEEDASLKQKWSPTSAPTNVPEKDGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRGGISSASDSKKPNLGEVVPSRPHPSALNTSVTSSSTSTRHQTQQLHSDFFQSQAPAFHNPQYFPHHYGSHAALASSSLGGMATISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVSNNPRIRRQEMELDKSLNRVSLFLFCCLVLCLLLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query260 2.2.26 [Sep-21-2011]
Q6R567252 E3 ubiquitin-protein liga N/A no 0.873 0.900 0.452 6e-49
Q8GUK7243 E3 ubiquitin-protein liga yes no 0.853 0.913 0.442 1e-48
O64425249 E3 ubiquitin-protein liga no no 0.85 0.887 0.402 2e-43
P93030193 E3 ubiquitin-protein liga no no 0.661 0.891 0.358 4e-31
Q09463235 RING finger protein 5 OS= yes no 0.388 0.429 0.467 4e-20
Q99942180 E3 ubiquitin-protein liga yes no 0.307 0.444 0.457 1e-18
Q91YT2192 E3 ubiquitin-protein liga yes no 0.296 0.401 0.466 2e-18
Q568Y3192 E3 ubiquitin-protein liga yes no 0.296 0.401 0.466 2e-18
Q96GF1192 E3 ubiquitin-protein liga no no 0.296 0.401 0.466 2e-18
Q5RFK9192 E3 ubiquitin-protein liga no no 0.296 0.401 0.466 3e-18
>sp|Q6R567|RMA1_CAPAN E3 ubiquitin-protein ligase RMA1H1 OS=Capsicum annuum GN=RMA1H1 PE=1 SV=1 Back     alignment and function desciption
 Score =  194 bits (492), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 148/241 (61%), Gaps = 14/241 (5%)

Query: 23  KWSPTSAPTNVPEKDGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQT-SSLDAD 81
           KW   S    V E     F+CNICLD   +PV+TLCGHLYCWPCIYKW++ Q+ SS ++D
Sbjct: 23  KWK--SMNDEVEENISGGFDCNICLDCVHEPVITLCGHLYCWPCIYKWIYFQSVSSENSD 80

Query: 82  EQQQNCPVCKANISVASLVPLYGRGGISSA-SDSKKPNLGEVVPSRPHPSALNTSVTSSS 140
           +QQ  CPVCKA +S  +L+PLYGRGG S+  S+ K PNLG V+P RP PS          
Sbjct: 81  QQQPQCPVCKAEVSEKTLIPLYGRGGQSTKPSEGKAPNLGIVIPQRP-PSPRCGGHFLLP 139

Query: 141 TSTRHQTQQLHSDFFQSQAPAFHNPQYFPHHYGSHAALASSSLGGMATISFFNPLMGMLG 200
           T+  + +Q L    +Q Q+         P + GS+ +    S GG AT +       M+G
Sbjct: 140 TTDSNPSQLLQRRGYQQQSQTRQ-----PAYQGSYMSSPMLSPGG-ATANMLQ--HSMIG 191

Query: 201 GMTLERIFGGSTTSLFTYP-SQSLLVSNNPRIRRQEMELDKSLNRVSLFLFCCLVLCLLL 259
            +   RIFG S+T+++TYP S +L +S++PR+RRQ  + D+SL R+  FLFCC V CL+L
Sbjct: 192 EVAYARIFGNSSTTMYTYPNSYNLAISSSPRMRRQLSQADRSLGRICFFLFCCFVTCLIL 251

Query: 260 F 260
           F
Sbjct: 252 F 252




E3 ubiquitin-protein ligase required for aquaporin levels regulation.
Capsicum annuum (taxid: 4072)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8GUK7|RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana GN=RMA3 PE=1 SV=1 Back     alignment and function description
>sp|O64425|RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana GN=RMA1 PE=1 SV=1 Back     alignment and function description
>sp|P93030|RMA2_ARATH E3 ubiquitin-protein ligase RMA2 OS=Arabidopsis thaliana GN=RMA2 PE=1 SV=1 Back     alignment and function description
>sp|Q09463|RNF5_CAEEL RING finger protein 5 OS=Caenorhabditis elegans GN=rnf-5 PE=1 SV=1 Back     alignment and function description
>sp|Q99942|RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens GN=RNF5 PE=1 SV=1 Back     alignment and function description
>sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 Back     alignment and function description
>sp|Q568Y3|RN185_RAT E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus GN=Rnf185 PE=2 SV=1 Back     alignment and function description
>sp|Q96GF1|RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens GN=RNF185 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFK9|RN185_PONAB E3 ubiquitin-protein ligase RNF185 OS=Pongo abelii GN=RNF185 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
449446936261 PREDICTED: E3 ubiquitin-protein ligase R 0.992 0.988 0.536 4e-71
449531287261 PREDICTED: E3 ubiquitin-protein ligase R 0.992 0.988 0.532 1e-70
225461411253 PREDICTED: E3 ubiquitin-protein ligase R 0.946 0.972 0.513 5e-69
224128161228 predicted protein [Populus trichocarpa] 0.873 0.995 0.568 1e-67
255573345265 rnf5, putative [Ricinus communis] gi|223 0.926 0.909 0.539 3e-67
224114956228 predicted protein [Populus trichocarpa] 0.873 0.995 0.560 1e-64
328929994250 MAKIBISHI 1 [Medicago truncatula] 0.896 0.932 0.527 3e-64
388507976248 unknown [Lotus japonicus] 0.888 0.931 0.535 5e-62
302143025308 unnamed protein product [Vitis vinifera] 0.780 0.659 0.467 2e-56
358249238246 uncharacterized protein LOC100817526 [Gl 0.880 0.930 0.485 2e-54
>gi|449446936|ref|XP_004141226.1| PREDICTED: E3 ubiquitin-protein ligase RMA3-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  273 bits (699), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 141/263 (53%), Positives = 177/263 (67%), Gaps = 5/263 (1%)

Query: 1   MEQNLFEPETGYATEEDASLKQKWSPTSAPTNVPEKDGSFFECNICLDSAQDPVVTLCGH 60
           MEQN   PE    +E+D SLKQ W   S  + + E     F+CNICLDSA DPVVTLCGH
Sbjct: 1   MEQNYSVPEAYLESEQDVSLKQNWKSISTQSTISEDANGCFDCNICLDSAADPVVTLCGH 60

Query: 61  LYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRGGISSASDSKKPNLG 120
           LYCWPCIYKWLHVQ SS +  E  QNCPVCKA+I+ +SLVPLYGRG  +S S+SKK +LG
Sbjct: 61  LYCWPCIYKWLHVQISS-NEPENTQNCPVCKASITPSSLVPLYGRGTSNSDSESKKSHLG 119

Query: 121 EVVPSRPHPSALNTSVTSSSTSTRHQTQQLHSDFFQSQAPAFHNPQYFPHH-YGSHAALA 179
             VP RP PS +NT   S+S+ST + +Q+LHS++ +S +   ++ QYFP   YG+ A+ +
Sbjct: 120 MAVPRRPPPS-MNTPSHSNSSSTLYPSQELHSNYIRSPSHPIYHQQYFPQATYGNFASYS 178

Query: 180 SSSLGGMATISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVSNNP--RIRRQEME 237
            S LG     S  NP +GM G     RIFG    +L  Y   +  +S N   R+RRQEM+
Sbjct: 179 PSYLGNAVITSLLNPTIGMFGETVFTRIFGSVDGNLLPYSPYNNSISGNASTRMRRQEMQ 238

Query: 238 LDKSLNRVSLFLFCCLVLCLLLF 260
           LDKSLNRVS+FLFCC ++CLLLF
Sbjct: 239 LDKSLNRVSIFLFCCFIICLLLF 261




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449531287|ref|XP_004172618.1| PREDICTED: E3 ubiquitin-protein ligase RMA3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225461411|ref|XP_002282248.1| PREDICTED: E3 ubiquitin-protein ligase RMA1H1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224128161|ref|XP_002329096.1| predicted protein [Populus trichocarpa] gi|222869765|gb|EEF06896.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255573345|ref|XP_002527599.1| rnf5, putative [Ricinus communis] gi|223533016|gb|EEF34780.1| rnf5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224114956|ref|XP_002316902.1| predicted protein [Populus trichocarpa] gi|222859967|gb|EEE97514.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|328929994|gb|AEB69786.1| MAKIBISHI 1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388507976|gb|AFK42054.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|302143025|emb|CBI20320.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358249238|ref|NP_001240271.1| uncharacterized protein LOC100817526 [Glycine max] gi|255640217|gb|ACU20399.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
TAIR|locus:2124004243 RMA3 "RING membrane-anchor 3" 0.823 0.880 0.436 1.9e-42
UNIPROTKB|Q6R567252 RMA1H1 "E3 ubiquitin-protein l 0.815 0.841 0.415 1.6e-40
TAIR|locus:2123663193 RMA2 "RING membrane-anchor 2" 0.319 0.430 0.520 7.6e-29
TAIR|locus:2016437226 AT1G19310 [Arabidopsis thalian 0.353 0.407 0.57 6.6e-28
TAIR|locus:2128746249 RMA1 "RING membrane-anchor 1" 0.780 0.815 0.344 3.5e-27
TAIR|locus:2049023227 AT2G23780 [Arabidopsis thalian 0.380 0.436 0.473 2.1e-25
TAIR|locus:2037294137 AT1G74990 [Arabidopsis thalian 0.438 0.832 0.440 2.6e-22
WB|WBGene00004381235 rnf-5 [Caenorhabditis elegans 0.384 0.425 0.472 2.4e-21
UNIPROTKB|Q09463235 rnf-5 "RING finger protein 5" 0.384 0.425 0.472 2.4e-21
TAIR|locus:2095833436 AT3G58030 [Arabidopsis thalian 0.311 0.185 0.478 1.1e-20
TAIR|locus:2124004 RMA3 "RING membrane-anchor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 449 (163.1 bits), Expect = 1.9e-42, P = 1.9e-42
 Identities = 100/229 (43%), Positives = 129/229 (56%)

Query:     1 MEQNLFEPETGYATEEDASL-KQKWSPTSAPTNVPEKDGSFFECNICLDSAQDPVVTLCG 59
             ME N F         ++  + KQK + T+APT     +   F+CNICLD+A DPVVTLCG
Sbjct:     1 MEGNFFIRSDAQRAHDNGFIAKQKPNLTTAPTAGQANESGCFDCNICLDTAHDPVVTLCG 60

Query:    60 HLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYGRGGISSASD--SKKP 117
             HL+CWPCIYKWLHVQ SS+  D+ Q NCPVCK+NI++ SLVPLYGRG  S +S   SKK 
Sbjct:    61 HLFCWPCIYKWLHVQLSSVSVDQHQNNCPVCKSNITITSLVPLYGRGMSSPSSTFGSKKQ 120

Query:   118 N-LGEVVPSRPHPSALNXXXXXXXXXXRHQTQQLHSDFFQSQAPAFHNPQYFPXXXXXXX 176
             + L   +P RP PSAL            + + Q H    Q+ +P+FHN QY P       
Sbjct:   121 DALSTDIPRRPAPSALRNPITSASSL--NPSLQ-H----QTLSPSFHNHQYSPRGFTTTE 173

Query:   177 XXXXXXXXXMATISFFNPLMGMLGGMTLERIFGGSTTSLFT-YPSQSLL 224
                      M   SF  P++GM G +   RIFG  T ++   Y SQ ++
Sbjct:   174 STDLANAVMM---SFLYPVIGMFGDLVYTRIFGTFTNTIAQPYQSQRMM 219




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
UNIPROTKB|Q6R567 RMA1H1 "E3 ubiquitin-protein ligase RMA1H1" [Capsicum annuum (taxid:4072)] Back     alignment and assigned GO terms
TAIR|locus:2123663 RMA2 "RING membrane-anchor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016437 AT1G19310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128746 RMA1 "RING membrane-anchor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049023 AT2G23780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037294 AT1G74990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00004381 rnf-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q09463 rnf-5 "RING finger protein 5" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2095833 AT3G58030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GUK7RMA3_ARATH6, ., 3, ., 2, ., -0.44260.85380.9135yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.107.139.1
hypothetical protein (228 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
PLN03208193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 1e-39
cd0016245 cd00162, RING, RING-finger (Really Interesting New 6e-11
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 3e-10
smart0018440 smart00184, RING, Ring finger 2e-08
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-08
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 8e-08
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 5e-06
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 1e-04
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 1e-04
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 2e-04
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 3e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 0.003
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 0.004
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
 Score =  135 bits (342), Expect = 1e-39
 Identities = 81/229 (35%), Positives = 113/229 (49%), Gaps = 57/229 (24%)

Query: 38  GSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSS------LDADEQQQNCPVCK 91
           G  F+CNICLD  +DPVVTLCGHL+CWPCI+KW +   +S       D   +   CPVCK
Sbjct: 16  GGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCK 75

Query: 92  ANISVASLVPLYGRGGISSASDSKKPNLGEVVPSRPHPSALNTSVTSSSTSTRHQTQQLH 151
           +++S A+LVP+YGRG        K P  G  VPSRP         +      R   Q+L 
Sbjct: 76  SDVSEATLVPIYGRG-------QKAPQSGSNVPSRP---------SGPVYDLRGVGQRLG 119

Query: 152 SDFFQSQAPAFHNPQYFPHHYGSHAALASSSLGGMATISFFNPLMGMLGGMTLERIFGGS 211
               +SQ   +  P                           +P+MG++  M   R+FG S
Sbjct: 120 EG--ESQRYMYRMP---------------------------DPVMGVVCEMVYRRLFGES 150

Query: 212 TTSLFTYPSQSLLVSNNPRIRRQEMELDKSLNRVSLFLFCCLVLCLLLF 260
           ++++  Y         N R RR+ M+ ++SL+RV LFL C + +CL LF
Sbjct: 151 SSNMAPYRDM------NVRSRRRAMQAEESLSRVYLFLLCFMFMCLFLF 193


Length = 193

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 260
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 100.0
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.25
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.24
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.2
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.14
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.1
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 99.08
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.03
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.03
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.02
PHA02929238 N1R/p28-like protein; Provisional 99.01
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.99
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.91
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.84
PHA02926242 zinc finger-like protein; Provisional 98.79
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.77
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.76
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.73
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.72
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.7
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.62
PF1463444 zf-RING_5: zinc-RING finger domain 98.6
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.56
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.53
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.42
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.4
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.4
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.28
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.27
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.17
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.03
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.93
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.79
COG5152259 Uncharacterized conserved protein, contains RING a 97.77
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.7
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.67
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.61
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.6
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.59
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.59
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.52
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.43
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.41
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.36
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.27
COG5222427 Uncharacterized conserved protein, contains RING Z 97.21
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.14
KOG2660 331 consensus Locus-specific chromosome binding protei 97.12
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.11
COG52191525 Uncharacterized conserved protein, contains RING Z 97.11
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.09
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 97.0
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.97
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.96
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.96
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.95
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.84
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.7
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.56
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.42
KOG1001674 consensus Helicase-like transcription factor HLTF/ 96.24
KOG4367 699 consensus Predicted Zn-finger protein [Function un 96.11
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.0
PF04641260 Rtf2: Rtf2 RING-finger 95.85
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 95.59
KOG4739233 consensus Uncharacterized protein involved in syna 95.54
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.44
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.37
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.04
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.66
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.58
KOG1941518 consensus Acetylcholine receptor-associated protei 94.51
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.32
KOG3002299 consensus Zn finger protein [General function pred 93.88
PHA03096284 p28-like protein; Provisional 93.74
KOG4445368 consensus Uncharacterized conserved protein, conta 93.64
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 93.53
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.42
KOG02981394 consensus DEAD box-containing helicase-like transc 93.16
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 92.92
KOG3039303 consensus Uncharacterized conserved protein [Funct 92.8
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 92.49
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 92.42
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.83
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 91.68
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 91.61
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 91.55
PHA02825162 LAP/PHD finger-like protein; Provisional 91.23
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 91.23
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 90.87
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 90.38
PHA02862156 5L protein; Provisional 90.06
PF10272358 Tmpp129: Putative transmembrane protein precursor; 89.41
COG5109396 Uncharacterized conserved protein, contains RING Z 89.11
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 88.44
COG5175 480 MOT2 Transcriptional repressor [Transcription] 87.93
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 87.85
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 87.5
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 86.93
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 82.68
KOG1940276 consensus Zn-finger protein [General function pred 82.66
KOG3899381 consensus Uncharacterized conserved protein [Funct 81.5
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.5e-50  Score=341.85  Aligned_cols=173  Identities=45%  Similarity=0.930  Sum_probs=139.3

Q ss_pred             CCCCcccccccccCCCCcEEccCCCccCHHHHHHhhhhhcCCcc-------ccccCcCCCCcccccccccccccccCCCC
Q 024938           36 KDGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLD-------ADEQQQNCPVCKANISVASLVPLYGRGGI  108 (260)
Q Consensus        36 ~~~~~~~C~ICld~~~~Pvvt~CGH~fC~~Ci~~wl~~~~~s~~-------~~~~~~~CPvCr~~v~~~~l~p~~~~~~~  108 (260)
                      +..+.++|+||++.+.+|++|+|||.|||.||.+|+...+.+.+       ..+.. .||+||..+...+++|+|+++..
T Consensus        14 ~~~~~~~CpICld~~~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~-~CPvCR~~Is~~~LvPiygrg~~   92 (193)
T PLN03208         14 DSGGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPP-KCPVCKSDVSEATLVPIYGRGQK   92 (193)
T ss_pred             cCCCccCCccCCCcCCCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCC-cCCCCCCcCChhcEEEeeccCCC
Confidence            44567999999999999999999999999999999986433221       11234 89999999999999999999874


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCccccccccCCCCCCCCCCCCCCCCCCCCccccccCCCCccc
Q 024938          109 SSASDSKKPNLGEVVPSRPHPSALNTSVTSSSTSTRHQTQQLHSDFFQSQAPAFHNPQYFPHHYGSHAALASSSLGGMAT  188 (260)
Q Consensus       109 ~~~~~~~~~~~~~~ip~RP~~~~~~~~~~~~s~s~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~  188 (260)
                      .       .+.+..+|+||.+++.+.         ++.++++.      ++   +++.|.                   +
T Consensus        93 ~-------~~~~~~iP~rp~~~~~~~---------~~~~~~~~------~~---~~~~~~-------------------~  128 (193)
T PLN03208         93 A-------PQSGSNVPSRPSGPVYDL---------RGVGQRLG------EG---ESQRYM-------------------Y  128 (193)
T ss_pred             C-------CCCCCCCCcCCCCCccCC---------CCcccccc------cc---ccceee-------------------e
Confidence            3       344566999998876552         22223331      11   111111                   1


Q ss_pred             hhcccccccccccceeecccCCCCCCCCCCCCCCCCCCCChhhHhHHhHHHHHhHHHHHHHHHHHHHHHhhC
Q 024938          189 ISFFNPLMGMLGGMTLERIFGGSTTSLFTYPSQSLLVSNNPRIRRQEMELDKSLNRVSLFLFCCLVLCLLLF  260 (260)
Q Consensus       189 ~~~~~~~~g~f~~~v~~~~fg~~~~~~~~~~~~~~~~~~~pr~r~~~~~~~~~l~ri~~fl~~~~~lcll~f  260 (260)
                       ++++|++||||||||+||||++.+|+|+|||+      +||||||+||+|||||||+|||||||+||||||
T Consensus       129 -~~~~p~~g~~~~~~~~r~fg~~~~~~~~~~~~------~~r~r~~~~q~~~sl~r~~~f~~c~~~~~~~~f  193 (193)
T PLN03208        129 -RMPDPVMGVVCEMVYRRLFGESSSNMAPYRDM------NVRSRRRAMQAEESLSRVYLFLLCFMFMCLFLF  193 (193)
T ss_pred             -ccCCccccchhhhhhhhhhCCccccccccccC------chHHHHHHHHHhhhhhHHHHHHHHHHHHHHHhC
Confidence             37889999999999999999999999999996      899999999999999999999999999999998



>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
1jm7_A112 Solution Structure Of The Brca1/bard1 Ring-domain H 2e-04
>pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 7/68 (10%) Query: 32 NVPEKDGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCK 91 NV EC ICL+ ++PV T C H++C C+ K L+ + CP+CK Sbjct: 13 NVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGP-------SQCPLCK 65 Query: 92 ANISVASL 99 +I+ SL Sbjct: 66 NDITKRSL 73

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 7e-19
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-18
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 4e-18
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-17
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-17
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-16
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-13
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 5e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 7e-13
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 1e-12
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-12
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 5e-12
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-11
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-11
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 4e-11
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 5e-11
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-10
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-10
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 1e-09
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 2e-09
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-09
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-09
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-09
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-09
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 4e-09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-07
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-08
2ysj_A63 Tripartite motif-containing protein 31; ring-type 2e-08
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 3e-08
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 4e-08
2ect_A78 Ring finger protein 126; metal binding protein, st 6e-08
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 8e-08
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-07
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-07
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-07
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-07
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 1e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-06
2ecm_A55 Ring finger and CHY zinc finger domain- containing 1e-06
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 5e-06
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 7e-06
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-05
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-05
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 3e-05
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 4e-05
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 6e-05
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 7e-05
2f42_A179 STIP1 homology and U-box containing protein 1; cha 9e-05
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 3e-04
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 3e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 6e-04
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
 Score = 78.4 bits (193), Expect = 7e-19
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 10/73 (13%)

Query: 32  NVPEKDGSFFECNICLDSAQDPVV-TLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVC 90
              E     F C IC++  +D  +   C  L C+ CI +WL          EQ+  CP C
Sbjct: 14  QSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLT---------EQRAQCPHC 64

Query: 91  KANISVASLVPLY 103
           +A + +  LV   
Sbjct: 65  RAPLQLRELVNCR 77


>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.54
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.5
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.48
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.47
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.46
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.46
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.46
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.46
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.45
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.45
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.45
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.44
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.44
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.43
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.42
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.42
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.41
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.41
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.4
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.38
2ect_A78 Ring finger protein 126; metal binding protein, st 99.38
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.37
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.36
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.35
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.34
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.34
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.33
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.32
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.32
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.31
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.3
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.3
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.29
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.28
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.27
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.27
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.27
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.26
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.25
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.25
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.25
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.24
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.24
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.24
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.23
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.2
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.18
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.17
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.17
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.15
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.15
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.12
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.09
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.09
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.03
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.03
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.99
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.95
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.93
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.9
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.89
2ea5_A68 Cell growth regulator with ring finger domain prot 98.8
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.8
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.75
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.69
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.68
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.57
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.38
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.16
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.11
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.78
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 96.59
3nw0_A238 Non-structural maintenance of chromosomes element 96.56
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.28
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 93.47
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 90.85
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 89.15
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 88.72
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 85.55
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 82.97
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.54  E-value=1.2e-14  Score=104.66  Aligned_cols=63  Identities=19%  Similarity=0.433  Sum_probs=53.7

Q ss_pred             CCCCCCCCcccccccccCCCCcEEc-cCCCccCHHHHHHhhhhhcCCccccccCcCCCCccccccccccccccc
Q 024938           32 NVPEKDGSFFECNICLDSAQDPVVT-LCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLVPLYG  104 (260)
Q Consensus        32 ~~~~~~~~~~~C~ICld~~~~Pvvt-~CGH~fC~~Ci~~wl~~~~~s~~~~~~~~~CPvCr~~v~~~~l~p~~~  104 (260)
                      ...+..++.+.|+||++.+.+|+.+ +|||.||..||.+|+..+         . .||+||..+...++..+..
T Consensus         7 ~~~~~~~~~~~C~IC~~~~~~p~~~~~CgH~fC~~Ci~~~~~~~---------~-~CP~Cr~~~~~~~~~~~~~   70 (72)
T 2djb_A            7 GNLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYS---------N-RCPKCNIVVHQTQPLSGPS   70 (72)
T ss_dssp             CCCCCCCGGGSCTTTSSCCSSCEECSSSCCEECHHHHHHHHHHC---------S-SCTTTCCCCCSSCSCCCCS
T ss_pred             hhHhhcCCCCCCCCCChHHHCcCEECCCCCHHHHHHHHHHHHcC---------C-cCCCcCcccCcccccccCC
Confidence            3445677889999999999999987 999999999999999764         4 9999999998877766543



>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 260
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 8e-14
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-13
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-13
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 9e-12
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-11
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 9e-10
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 1e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 4e-07
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 8e-07
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 4e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 9e-06
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 2e-05
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 4e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 5e-05
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.001
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.5 bits (154), Expect = 8e-14
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 39  SFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVAS 98
              EC ICL+  ++PV T C H++C  C+ K L+ +       +    CP+CK +I+  S
Sbjct: 20  KILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQK-------KGPSQCPLCKNDITKRS 72

Query: 99  LVP 101
           L  
Sbjct: 73  LQE 75


>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.49
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.48
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.48
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.47
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.43
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.3
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.3
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.29
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.29
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.28
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.27
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.24
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.05
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.93
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.82
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.28
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 93.85
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 80.61
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.49  E-value=5.4e-15  Score=109.18  Aligned_cols=55  Identities=35%  Similarity=0.657  Sum_probs=48.0

Q ss_pred             CCCcccccccccCCCCcEEccCCCccCHHHHHHhhhhhcCCccccccCcCCCCccccccccccc
Q 024938           37 DGSFFECNICLDSAQDPVVTLCGHLYCWPCIYKWLHVQTSSLDADEQQQNCPVCKANISVASLV  100 (260)
Q Consensus        37 ~~~~~~C~ICld~~~~Pvvt~CGH~fC~~Ci~~wl~~~~~s~~~~~~~~~CPvCr~~v~~~~l~  100 (260)
                      ..+.+.|+||++.+.+|++++|||.||+.||.+|++.+.        + +||+||.++...++.
T Consensus        20 ~~~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~--------~-~CP~Cr~p~~~~~l~   74 (86)
T d1rmda2          20 FVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMG--------S-YCPSCRYPCFPTDLE   74 (86)
T ss_dssp             HHHHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTC--------S-BCTTTCCBCCGGGCB
T ss_pred             hccCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCC--------C-cCcccCCCCChhhcc
Confidence            345689999999999999999999999999999998653        5 899999998876654



>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure