Citrus Sinensis ID: 025248

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----

MFWKERERENKELNGGPPTGQVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADVAAKEGTRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFRMLIRRRYFSDEMPAPNPWSISPTHKPIQRLDENSSDDDKFYSSGYSSDPYNMLPPLPAQRNLTPPPTLYPQQPVSVQENYNLPRFSLTGSQEISSSARSKRTDINV

ccHHHHHHHHHccccccccccEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccc

ccHHHHHHHHHHHcccccccEEEEEEEcccEEEEEEccccHccHHHHHHHHHHHHHccccEccccccccccccccEEEEEccccEcccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccc

mfwkererenkelnggpptgqVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATsgtfsaplasggpgglpvpyvVIGNKAdvaakegtrgssgnlVDAARQWVEkqgllpsseelpltesfpgggglIAAAKEARYDKEAVMKFFRMLIRRryfsdempapnpwsispthkpiqrldenssdddkfyssgyssdpynmlpplpaqrnltppptlypqqpvsvqenynlprfsltgsqeisssarskrtdinv

mfwkererenkelnggpptgqvRVLVVGDSGVIFvhdlsqrrtktsLQKWAVEIATSGtfsaplasggpgGLPVPYVVIGNKADVAAkegtrgssgnlvDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFRMLIRRRYFSDEMPAPNPWSISPTHKPIQRLDENSSDDDKFYSSGYSSDPYNMLPPLPAQRNLTPPPTLYPQQPVSVQENYNLPRFsltgsqeisssarskrtdinv

MFWKERERENKELNGGPPTGQVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATSGTFsaplasggpgglpvpyvvigNKADVAAKEGTRGSSGNLVDAARQWVEKQGllpsseelpltesfpGGGGLIAAAKEARYDKEAVMKFFRMLIRRRYFSDEMPAPNPWSISPTHKPIQRLDENSSDDDKFYSSGYSSDPYNMLPPLPAQRNltppptlypqqpVSVQENYNLPRFSLTGSQEISSSARSKRTDINV

********************QVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADVA*****************QWV*******************GGGGLIAAAKEARYDKEAVMKFFRMLIRRRYFS*************************************************************************************************

******************TGQVRVLVVGDSGVIFVHDLSQRR******KWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADV**************DAARQWVEKQG*LP**EELPLTESFPGGG************KEAVMKFFRMLIRRRYFSDEMP**********************************DPYNMLPPLPAQRNLTPPPTLYP**PVSVQENYNL************************

*************NGGPPTGQVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADVAAKEGTRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFRMLIRRRYFSDEMPAPNPWSISPTHKPIQRLDENSSDDDKFYSSGYSSDPYNMLPPLPAQRNLTPPPTLYPQQPVSVQENYNLPRFSLTG*****************

MFWKERERENKELNGGPPTGQVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADVAAKE****SSGNLVDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFRMLIRRRYFSDEMPAPNPW*****************DDDKFYSSGYSSDPYNMLPPLPAQRNLTPPPTLYPQQPVSVQENYN*************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		255	2.2.26 [Sep-21-2011]
Q9C5J9		342	Uncharacterized GTP-bindi	yes	no	0.886	0.660	0.756	7e-96

>sp\|Q9C5J9\|Y5483_ARATH Uncharacterized GTP-binding protein At5g64813 OS=Arabidopsis thaliana GN=At5g64813 PE=1 SV=1	Back alignment and function desciption

 Score =  350 bits (897), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 177/234 (75%), Positives = 199/234 (85%), Gaps = 8/234 (3%)

Query: 30  SGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADVAAKE 89
           +GVIFVHDLSQRRTKTSLQKWA E+A +GTFSAPL SGGPGGLPVPY+V+GNKAD+AAKE
Sbjct: 109 NGVIFVHDLSQRRTKTSLQKWASEVAATGTFSAPLPSGGPGGLPVPYIVVGNKADIAAKE 168

Query: 90  GTRGSSGNLVDAARQWVEKQGLLP-SSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFF 148
           GT+GSSGNLVDAAR WVEKQGLLP SSE+LPL ESFPG GGLIAAAKE RYDKEA+ KFF
Sbjct: 169 GTKGSSGNLVDAARHWVEKQGLLPSSSEDLPLFESFPGNGGLIAAAKETRYDKEALNKFF 228

Query: 149 RMLIRRRYFSDEMPAPNPWSISPT-HKPIQRLDENSSDDDKFYS-SGYSSDPY---NMLP 203
           RMLIRRRYFSDE+PA +PWSISP      QRLDE +SDDD+FY  + +  DPY   N +P
Sbjct: 229 RMLIRRRYFSDELPAASPWSISPVPTSSSQRLDEITSDDDQFYKRTSFHGDPYKYNNTIP 288

Query: 204 PLPAQRNLTPPPTLYPQQPVSVQENYNLPRFSLTGSQEISS--SARSKRTDINV 255
           PLPAQRNLTPPPTLYPQQPVS  +NY +PR+SL+  QE ++  SARSKR DINV
Sbjct: 289 PLPAQRNLTPPPTLYPQQPVSTPDNYTIPRYSLSSVQETTNNGSARSKRMDINV 342

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		255
255585889		336	GTP-binding protein yptv3, putative [Ric	0.886	0.672	0.825	1e-106
224096339		336	predicted protein [Populus trichocarpa]	0.886	0.672	0.816	1e-104
224083815		336	predicted protein [Populus trichocarpa]	0.886	0.672	0.807	1e-103
291191425		338	unknown [Dimocarpus longan]	0.886	0.668	0.834	3e-99
225438537		336	PREDICTED: uncharacterized GTP-binding p	0.882	0.669	0.781	5e-98
18424871		342	Ras-related small GTP-binding family pro	0.886	0.660	0.756	4e-94
356512750		336	PREDICTED: uncharacterized GTP-binding p	0.886	0.672	0.803	3e-93
297794079		342	hypothetical protein ARALYDRAFT_496698 [	0.886	0.660	0.739	3e-90
356525537		333	PREDICTED: uncharacterized GTP-binding p	0.874	0.669	0.786	6e-89
449461441		336	PREDICTED: uncharacterized GTP-binding p	0.886	0.672	0.768	4e-88

>gi\|255585889\|ref\|XP_002533618.1\| GTP-binding protein yptv3, putative [Ricinus communis] gi\|223526492\|gb\|EEF28762.1\| GTP-binding protein yptv3, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/229 (82%), Positives = 209/229 (91%), Gaps = 3/229 (1%)

Query: 30  SGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADVAAKE 89
           +GVIFVHDLSQRRTKTSLQKWA EIA +GTFSAPL SGGP G+PVPY+VIGNKADVAAKE
Sbjct: 108 NGVIFVHDLSQRRTKTSLQKWASEIAATGTFSAPLGSGGPCGIPVPYIVIGNKADVAAKE 167

Query: 90  GTRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFR 149
           GTRGSSGNLVD ARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEA++KFFR
Sbjct: 168 GTRGSSGNLVDVARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEALLKFFR 227

Query: 150 MLIRRRYFSDEMPAPNPWSISPTHKPIQRLDENSSDDDKFYSSG-YSSDP--YNMLPPLP 206
           MLIRRRYFSDE+ AP+PW++SP  + +QRLDENSSDDD+FY S   + DP  YNMLPPLP
Sbjct: 228 MLIRRRYFSDELTAPSPWTVSPAQRSVQRLDENSSDDDQFYKSKRLTGDPYKYNMLPPLP 287

Query: 207 AQRNLTPPPTLYPQQPVSVQENYNLPRFSLTGSQEISSSARSKRTDINV 255
           AQRNLTPPPTLYPQQPVSV ENY+ PRFSL+ +QE+S++ARSKR DINV
Sbjct: 288 AQRNLTPPPTLYPQQPVSVTENYSFPRFSLSDAQELSNTARSKRLDINV 336

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224096339\|ref\|XP_002310606.1\| predicted protein [Populus trichocarpa] gi\|222853509\|gb\|EEE91056.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224083815\|ref\|XP_002307133.1\| predicted protein [Populus trichocarpa] gi\|222856582\|gb\|EEE94129.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|291191425\|gb\|ACS66798.2\| unknown [Dimocarpus longan]	Back alignment and taxonomy information

>gi\|225438537\|ref\|XP_002279569.1\| PREDICTED: uncharacterized GTP-binding protein At5g64813 [Vitis vinifera] gi\|147843269\|emb\|CAN80534.1\| hypothetical protein VITISV_035973 [Vitis vinifera] gi\|296082516\|emb\|CBI21521.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi|18424871|ref|NP_568996.1| Ras-related small GTP-binding family protein [Arabidopsis thaliana] gi|29839609|sp|Q9C5J9.1|Y5483_ARATH RecName: Full=Uncharacterized GTP-binding protein At5g64813 gi|13430582|gb|AAK25913.1|AF360203_1 unknown protein [Arabidopsis thaliana] gi|14532852|gb|AAK64108.1| unknown protein [Arabidopsis thaliana] gi|332010571|gb|AED97954.1| Ras-related small GTP-binding family protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356512750\|ref\|XP_003525079.1\| PREDICTED: uncharacterized GTP-binding protein At5g64813-like [Glycine max]	Back alignment and taxonomy information

>gi\|297794079\|ref\|XP_002864924.1\| hypothetical protein ARALYDRAFT_496698 [Arabidopsis lyrata subsp. lyrata] gi\|297310759\|gb\|EFH41183.1\| hypothetical protein ARALYDRAFT_496698 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356525537\|ref\|XP_003531381.1\| PREDICTED: uncharacterized GTP-binding protein At5g64813-like [Glycine max]	Back alignment and taxonomy information

>gi\|449461441\|ref\|XP_004148450.1\| PREDICTED: uncharacterized GTP-binding protein At5g64813-like [Cucumis sativus] gi\|449529012\|ref\|XP_004171495.1\| PREDICTED: uncharacterized GTP-binding protein At5g64813-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		255
TAIR\|locus:505006713		342	LIP1 "Light Insensitive Period	0.886	0.660	0.576	6.8e-71
TAIR\|locus:2178148		333	AT5G09910 [Arabidopsis thalian	0.858	0.657	0.504	8.8e-57

TAIR\|locus:505006713 LIP1 "Light Insensitive Period1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 620 (223.3 bits), Expect = 6.8e-71, Sum P(2) = 6.8e-71
 Identities = 135/234 (57%), Positives = 154/234 (65%)

Query:    30 SGVIFVHDLSQRRTKTSLQKWAVEIATSGTFXXXXXXXXXXXXXXXXXXXXNKADVAAKE 89
             +GVIFVHDLSQRRTKTSLQKWA E+A +GTF                    NKAD+AAKE
Sbjct:   109 NGVIFVHDLSQRRTKTSLQKWASEVAATGTFSAPLPSGGPGGLPVPYIVVGNKADIAAKE 168

Query:    90 GTRGSSGNLVDAARQWVEKQGXXXXXXXXXXXXXXX-GGGGLIAAAKEARYDKEAVMKFF 148
             GT+GSSGNLVDAAR WVEKQG                G GGLIAAAKE RYDKEA+ KFF
Sbjct:   169 GTKGSSGNLVDAARHWVEKQGLLPSSSEDLPLFESFPGNGGLIAAAKETRYDKEALNKFF 228

Query:   149 RMLIRRRYFSDEMPAPNPWSISPTH-KPIQRLDENSSDDDKFYS-SGYSSDPY---NMLP 203
             RMLIRRRYFSDE+PA +PWSISP      QRLDE +SDDD+FY  + +  DPY   N +P
Sbjct:   229 RMLIRRRYFSDELPAASPWSISPVPTSSSQRLDEITSDDDQFYKRTSFHGDPYKYNNTIP 288

Query:   204 PLPAQRNXXXXXXXXXXXXVSVQENYNLPRFSLTGSQEISS--SARSKRTDINV 255
             PLPAQRN            VS  +NY +PR+SL+  QE ++  SARSKR DINV
Sbjct:   289 PLPAQRNLTPPPTLYPQQPVSTPDNYTIPRYSLSSVQETTNNGSARSKRMDINV 342

GO:0005524 "ATP binding" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0008134 "transcription factor binding" evidence=IEA

GO:0003924 "GTPase activity" evidence=IDA

GO:0005737 "cytoplasm" evidence=IDA

GO:0009640 "photomorphogenesis" evidence=IMP

GO:0032922 "circadian regulation of gene expression" evidence=IMP

TAIR\|locus:2178148 AT5G09910 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9C5J9	Y5483_ARATH	No assigned EC number	0.7564	0.8862	0.6608	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		255
PLN00023		334	PLN00023, PLN00023, GTP-binding protein; Provision	1e-142
cd04102		204	cd04102, RabL3, Rab GTPase-like family 3 (Rab-like	9e-45
PLN00023		334	PLN00023, PLN00023, GTP-binding protein; Provision	5e-13
cd04119		168	cd04119, RJL, Rab GTPase family J-like (RabJ-like)	1e-06
cd00154		159	cd00154, Rab, Ras-related in brain (Rab) family of	0.001
cd01863		161	cd01863, Rab18, Rab GTPase family 18 (Rab18)	0.002
smart00175		164	smart00175, RAB, Rab subfamily of small GTPases	0.002

>gnl\|CDD\|177661 PLN00023, PLN00023, GTP-binding protein; Provisional	Back alignment and domain information

 Score =  401 bits (1033), Expect = e-142
 Identities = 186/228 (81%), Positives = 203/228 (89%), Gaps = 5/228 (2%)

Query: 31  GVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADVAAKEG 90
           GVIFVHDLSQRRTKTSLQKWA E+A +GTFSAPL SGGPGGLPVPY+VIGNKAD+A KEG
Sbjct: 109 GVIFVHDLSQRRTKTSLQKWASEVAATGTFSAPLGSGGPGGLPVPYIVIGNKADIAPKEG 168

Query: 91  TRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFRM 150
           TRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPG GGLIAAAKEARYDKEA++KFFRM
Sbjct: 169 TRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGNGGLIAAAKEARYDKEALIKFFRM 228

Query: 151 LIRRRYFSDEMPAPNPWSISPTHKPIQRLDENSSDDDKFY-SSGYSSDP--YNMLPPLPA 207
           LIRRRYFSDE+PAP+PWS+SP  +  QRLDEN+SDDD+FY  +  + DP  YN LPPLPA
Sbjct: 229 LIRRRYFSDELPAPSPWSLSPQ-RSSQRLDENTSDDDQFYKRTSLAGDPYKYNTLPPLPA 287

Query: 208 QRNLTPPPTLYPQQPVSVQENYNLPRFSLTGSQEISSSARSKRTDINV 255
           QRNLTPPPTLYPQQPVS  ENY +PRFSL+ S E  S+ARSKR DINV
Sbjct: 288 QRNLTPPPTLYPQQPVSSSENYRIPRFSLSSSPES-SNARSKRMDINV 334

Length = 334

>gnl\|CDD\|206689 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like3)	Back alignment and domain information

>gnl\|CDD\|177661 PLN00023, PLN00023, GTP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like)	Back alignment and domain information

>gnl\|CDD\|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18)	Back alignment and domain information

>gnl\|CDD\|197555 smart00175, RAB, Rab subfamily of small GTPases	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		255
PLN00023		334	GTP-binding protein; Provisional	100.0
KOG0084		205	consensus GTPase Rab1/YPT1, small G protein superf	99.91
KOG0078		207	consensus GTP-binding protein SEC4, small G protei	99.91
KOG0092		200	consensus GTPase Rab5/YPT51 and related small G pr	99.91
KOG0098		216	consensus GTPase Rab2, small G protein superfamily	99.9
KOG0087		222	consensus GTPase Rab11/YPT3, small G protein super	99.89
KOG0088		218	consensus GTPase Rab21, small G protein superfamil	99.88
KOG0394		210	consensus Ras-related GTPase [General function pre	99.88
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.87
KOG0093		193	consensus GTPase Rab3, small G protein superfamily	99.87
KOG0080		209	consensus GTPase Rab18, small G protein superfamil	99.86
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.86
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	99.86
KOG0091		213	consensus GTPase Rab39, small G protein superfamil	99.86
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.85
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.85
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.84
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.84
KOG0079		198	consensus GTP-binding protein H-ray, small G prote	99.84
PTZ00099		176	rab6; Provisional	99.84
KOG0086		214	consensus GTPase Rab4, small G protein superfamily	99.83
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.83
KOG0083		192	consensus GTPase Rab26/Rab37, small G protein supe	99.83
KOG0094		221	consensus GTPase Rab6/YPT6/Ryh1, small G protein s	99.83
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	99.82
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.82
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.82
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.81
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.81
KOG0081		219	consensus GTPase Rab27, small G protein superfamil	99.81
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.8
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	99.8
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.79
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.79
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	99.79
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	99.79
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.79
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	99.78
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.78
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	99.78
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	99.78
KOG0097		215	consensus GTPase Rab14, small G protein superfamil	99.78
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.77
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.77
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	99.77
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.76
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.76
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.76
PTZ00369		189	Ras-like protein; Provisional	99.75
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.75
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	99.75
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	99.75
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.75
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.75
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	99.75
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	99.75
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	99.75
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.74
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	99.74
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.74
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.74
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.74
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	99.74
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	99.73
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	99.73
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.73
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.73
KOG0395		196	consensus Ras-related GTPase [General function pre	99.73
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	99.73
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	99.72
PLN03108		210	Rab family protein; Provisional	99.72
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.72
KOG0095		213	consensus GTPase Rab30, small G protein superfamil	99.72
KOG0393		198	consensus Ras-related small GTPase, Rho type [Gene	99.72
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	99.72
PLN03110		216	Rab GTPase; Provisional	99.72
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	99.71
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	99.71
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	99.71
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	99.71
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.71
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	99.7
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	99.7
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	99.7
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	99.7
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	99.69
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	99.69
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	99.69
PLN00223		181	ADP-ribosylation factor; Provisional	99.68
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	99.68
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	99.67
PLN03118		211	Rab family protein; Provisional	99.66
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	99.65
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	99.65
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	99.65
KOG4252		246	consensus GTP-binding protein [Signal transduction	99.64
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	99.64
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	99.64
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	99.63
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.63
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	99.63
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	99.63
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	99.63
PTZ00133		182	ADP-ribosylation factor; Provisional	99.63
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	99.62
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	99.61
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	99.6
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	99.58
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.58
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	99.57
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.55
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	99.54
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	99.54
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	99.54
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.53
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.53
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	99.52
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	99.52
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.5
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.49
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.48
KOG4423		229	consensus GTP-binding protein-like, RAS superfamil	99.46
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.45
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.45
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.44
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.43
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.41
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.37
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.36
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	99.34
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	99.33
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.33
PRK12299		335	obgE GTPase CgtA; Reviewed	99.32
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	99.28
cd01881		176	Obg_like The Obg-like subfamily consists of five w	99.22
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.22
KOG3883		198	consensus Ras family small GTPase [Signal transduc	99.22
COG1100		219	GTPase SAR1 and related small G proteins [General	99.2
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.2
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	99.18
KOG0076		197	consensus GTP-binding ADP-ribosylation factor-like	99.17
KOG0070		181	consensus GTP-binding ADP-ribosylation factor Arf1	99.16
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.16
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	99.13
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.1
KOG0073		185	consensus GTP-binding ADP-ribosylation factor-like	99.1
PRK15467		158	ethanolamine utilization protein EutP; Provisional	99.09
KOG0096		216	consensus GTPase Ran/TC4/GSP1 (nuclear protein tra	99.08
PRK03003		472	GTP-binding protein Der; Reviewed	99.07
PRK03003		472	GTP-binding protein Der; Reviewed	99.04
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	99.02
PRK12297		424	obgE GTPase CgtA; Reviewed	99.0
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.0
PRK04213		201	GTP-binding protein; Provisional	98.98
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	98.98
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	98.95
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	98.94
PRK15494		339	era GTPase Era; Provisional	98.93
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	98.93
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	98.93
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	98.92
PRK11058		426	GTPase HflX; Provisional	98.92
cd00881		189	GTP_translation_factor GTP translation factor fami	98.91
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	98.86
KOG0075		186	consensus GTP-binding ADP-ribosylation factor-like	98.85
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	98.84
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	98.82
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	98.81
PRK12298		390	obgE GTPase CgtA; Reviewed	98.79
KOG0071		180	consensus GTP-binding ADP-ribosylation factor Arf6	98.79
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	98.76
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	98.76
PRK05433		600	GTP-binding protein LepA; Provisional	98.74
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	98.74
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	98.73
PRK12296		500	obgE GTPase CgtA; Reviewed	98.73
PRK00093		435	GTP-binding protein Der; Reviewed	98.72
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	98.71
KOG1673		205	consensus Ras GTPases [General function prediction	98.71
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	98.71
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	98.7
cd01896		233	DRG The developmentally regulated GTP-binding prot	98.69
PRK00089		292	era GTPase Era; Reviewed	98.68
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	98.65
PRK12289		352	GTPase RsgA; Reviewed	98.64
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	98.63
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	98.62
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	98.62
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	98.62
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	98.6
PRK00098		298	GTPase RsgA; Reviewed	98.59
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	98.57
KOG0072		182	consensus GTP-binding ADP-ribosylation factor-like	98.54
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	98.53
PRK00093		435	GTP-binding protein Der; Reviewed	98.53
cd04105		203	SR_beta Signal recognition particle receptor, beta	98.52
CHL00189		742	infB translation initiation factor 2; Provisional	98.49
PRK12288		347	GTPase RsgA; Reviewed	98.48
PRK12317		425	elongation factor 1-alpha; Reviewed	98.47
PRK05306		787	infB translation initiation factor IF-2; Validated	98.46
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	98.46
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	98.46
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	98.41
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	98.39
smart00010		124	small_GTPase Small GTPase of the Ras superfamily;	98.38
KOG0074		185	consensus GTP-binding ADP-ribosylation factor-like	98.35
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	98.34
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	98.3
PRK04004		586	translation initiation factor IF-2; Validated	98.28
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	98.28
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	98.28
PRK04000		411	translation initiation factor IF-2 subunit gamma;	98.26
PRK10218		607	GTP-binding protein; Provisional	98.24
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	98.23
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	98.23
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	98.22
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	98.2
PRK14845		1049	translation initiation factor IF-2; Provisional	98.14
KOG0462		650	consensus Elongation factor-type GTP-binding prote	98.1
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.1
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	98.1
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	98.04
COG2229		187	Predicted GTPase [General function prediction only	98.03
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	98.01
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	97.96
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	97.93
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	97.88
PLN00043		447	elongation factor 1-alpha; Provisional	97.87
PRK13796		365	GTPase YqeH; Provisional	97.83
PRK13351		687	elongation factor G; Reviewed	97.78
cd00066		317	G-alpha G protein alpha subunit. The alpha subunit	97.74
TIGR00101		199	ureG urease accessory protein UreG. This model rep	97.72
KOG1489		366	consensus Predicted GTP-binding protein (ODN super	97.71
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	97.7
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	97.62
KOG0705		749	consensus GTPase-activating protein Centaurin gamm	97.59
PRK13768		253	GTPase; Provisional	97.58
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	97.58
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	97.56
TIGR00485		394	EF-Tu translation elongation factor TU. This align	97.54
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	97.53
smart00275		342	G_alpha G protein alpha subunit. Subunit of G prot	97.51
KOG0077		193	consensus Vesicle coat complex COPII, GTPase subun	97.45
COG2262		411	HflX GTPases [General function prediction only]	97.41
PRK12736		394	elongation factor Tu; Reviewed	97.41
COG1159		298	Era GTPase [General function prediction only]	97.38
PRK09866		741	hypothetical protein; Provisional	97.38
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	97.35
PRK12740		668	elongation factor G; Reviewed	97.35
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	97.35
PRK12735		396	elongation factor Tu; Reviewed	97.31
PF04670		232	Gtr1_RagA: Gtr1/RagA G protein conserved region; I	97.31
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	97.3
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	97.3
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	97.3
PRK09563		287	rbgA GTPase YlqF; Reviewed	97.28
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	97.26
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	97.26
PRK01889		356	GTPase RsgA; Reviewed	97.23
COG0536		369	Obg Predicted GTPase [General function prediction	97.23
COG1160		444	Predicted GTPases [General function prediction onl	97.13
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	97.1
PRK00741		526	prfC peptide chain release factor 3; Provisional	97.05
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	97.03
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	96.88
TIGR00503		527	prfC peptide chain release factor 3. This translat	96.82
COG1160		444	Predicted GTPases [General function prediction onl	96.81
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	96.7
PLN03126		478	Elongation factor Tu; Provisional	96.67
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	96.61
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	96.56
COG0486		454	ThdF Predicted GTPase [General function prediction	96.49
KOG3905		473	consensus Dynein light intermediate chain [Cell mo	96.31
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	96.29
PF09439		181	SRPRB: Signal recognition particle receptor beta s	96.17
PRK09435		332	membrane ATPase/protein kinase; Provisional	96.15
KOG1423		379	consensus Ras-like GTPase ERA [Cell cycle control,	96.15
COG1163		365	DRG Predicted GTPase [General function prediction	96.03
CHL00071		409	tufA elongation factor Tu	96.03
COG1084		346	Predicted GTPase [General function prediction only	96.01
PRK00049		396	elongation factor Tu; Reviewed	95.95
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	95.88
KOG1145		683	consensus Mitochondrial translation initiation fac	95.66
PLN00023		334	GTP-binding protein; Provisional	95.56
PF06858		58	NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte	95.52
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	95.44
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	95.43
COG1162		301	Predicted GTPases [General function prediction onl	95.34
COG0218		200	Predicted GTPase [General function prediction only	95.28
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	95.26
PRK12739		691	elongation factor G; Reviewed	95.15
PLN03127		447	Elongation factor Tu; Provisional	95.14
PTZ00141		446	elongation factor 1- alpha; Provisional	94.97
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	94.73
KOG4273		418	consensus Uncharacterized conserved protein [Funct	94.56
COG5257		415	GCD11 Translation initiation factor 2, gamma subun	94.44
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	94.44
PF05783		472	DLIC: Dynein light intermediate chain (DLIC); Inte	94.29
cd03110		179	Fer4_NifH_child This protein family's function is	93.54
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	93.53
KOG0461		522	consensus Selenocysteine-specific elongation facto	93.43
KOG0090		238	consensus Signal recognition particle receptor, be	92.71
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	92.49
KOG0082		354	consensus G-protein alpha subunit (small G protein	92.38
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	92.18
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	91.95
COG5258		527	GTPBP1 GTPase [General function prediction only]	91.9
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	91.81
PRK00007		693	elongation factor G; Reviewed	91.65
KOG1490		620	consensus GTP-binding protein CRFG/NOG1 (ODN super	91.47
KOG1144		1064	consensus Translation initiation factor 5B (eIF-5B	91.44
PF00503		389	G-alpha: G-protein alpha subunit; InterPro: IPR001	91.44
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	91.38
PF14331		266	ImcF-related_N: ImcF-related N-terminal domain	91.37
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	90.68
COG3276		447	SelB Selenocysteine-specific translation elongatio	90.15
KOG3886		295	consensus GTP-binding protein [Signal transduction	89.39
PLN00116		843	translation elongation factor EF-2 subunit; Provis	88.28
COG1161		322	Predicted GTPases [General function prediction onl	88.23
KOG1191		531	consensus Mitochondrial GTPase [Translation, ribos	88.12
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	87.8
PRK07560		731	elongation factor EF-2; Reviewed	87.43
TIGR03348		1169	VI_IcmF type VI secretion protein IcmF. Members of	87.21
PTZ00416		836	elongation factor 2; Provisional	86.96
COG1217		603	TypA Predicted membrane GTPase involved in stress	86.63
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	85.38
COG3596		296	Predicted GTPase [General function prediction only	85.33
KOG0458		603	consensus Elongation factor 1 alpha [Translation,	84.64
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	84.18
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	84.11
TIGR02836		492	spore_IV_A stage IV sporulation protein A. A compa	84.08
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	83.12
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	82.58
PRK09602		396	translation-associated GTPase; Reviewed	81.79
PF11111		176	CENP-M: Centromere protein M (CENP-M); InterPro: I	81.01

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

Probab=100.00  E-value=1.4e-62  Score=457.44  Aligned_cols=245  Identities=75%  Similarity=1.198  Sum_probs=213.0

Q ss_pred             CcccccccccccCCCCCCCcccccccCCcEEEEEEECCChhhHHHHHHHHHHHHHhCCCCCCCCCCCCCCCCCcEEEEEe
Q 025248            2 FWKERERENKELNGGPPTGQVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGN   81 (255)
Q Consensus         2 ~w~~~~~~~~~~~g~~~~gq~r~Yyr~adgvIlVyDvT~~~Sfe~l~~Wl~ei~~~~~~s~~~~s~~~~~~~iPiiLVGN   81 (255)
                      +||..|++.+.       ...+.||++++|+|+|||+++++||++|.+|+++|..+..+++|..++.+++.++|+|||||
T Consensus        87 IWDTAGqErfr-------sL~~~yyr~AdgiILVyDITdr~SFenL~kWl~eI~~~~~~s~p~~s~~~~~~~ipIILVGN  159 (334)
T PLN00023         87 LWDVSGHERYK-------DCRSLFYSQINGVIFVHDLSQRRTKTSLQKWASEVAATGTFSAPLGSGGPGGLPVPYIVIGN  159 (334)
T ss_pred             EEECCCChhhh-------hhhHHhccCCCEEEEEEeCCCHHHHHHHHHHHHHHHHhcccccccccccccCCCCcEEEEEE
Confidence            56666665443       23457999999999999999999999999999999987655544444444445799999999


Q ss_pred             CCCCCCCCCCccCCccHHHHHHHHHHHcCCCCeeecCCCCCCCCCCCCcceeeecCCCHHHHHHHHHHHHHHHhccCCCC
Q 025248           82 KADVAAKEGTRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFRMLIRRRYFSDEM  161 (255)
Q Consensus        82 K~DL~~~~~r~Vs~~~l~e~a~~~a~~~gl~~~~Ee~p~~e~~~~~~~~~tSAk~g~nv~e~f~~l~~~li~~~~~s~~~  161 (255)
                      |+||..+.++.+..+...+++++||+++|++++.+|+|++|+|||+||+.++||+++..+|++.++|++|++++||+++.
T Consensus       160 K~DL~~~~~~r~~s~~~~e~a~~~A~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  239 (334)
T PLN00023        160 KADIAPKEGTRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGNGGLIAAAKEARYDKEALIKFFRMLIRRRYFSDEL  239 (334)
T ss_pred             CccccccccccccccccHHHHHHHHHHcCCCccccccccccccCCCccHhhhhhhhcccHHHHHHHHHHHHHHHhhcccC
Confidence            99997653222222234489999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCcccCCCCCCCCccccc-cCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCcccccCCccCCcCCCC
Q 025248          162 PAPNPWSISPTHKPIQRLDENSSDDDKFYS-SGYSSDP--YNMLPPLPAQRNLTPPPTLYPQQPVSVQENYNLPRFSLTG  238 (255)
Q Consensus       162 ~~p~~~s~sp~~~~~~~~~~~~~d~d~~~~-~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  238 (255)
                      ++|+|||++|++.++.++ ++.+|+|+||+ ++|+|++  ||+|+|||||||+||||++|||||||+.|||+|||||+++
T Consensus       240 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  318 (334)
T PLN00023        240 PAPSPWSLSPQRSSQRLD-ENTSDDDQFYKRTSLAGDPYKYNTLPPLPAQRNLTPPPTLYPQQPVSSSENYRIPRFSLSS  318 (334)
T ss_pred             CCCCCcccCCCCcccccc-ccccchhhhhhhccccCCcccccCCCCCcccccCCCCCccccCCCCCchhccccccccccC
Confidence            999999999988866666 56666666666 9999999  9999999999999999999999999999999999999999


Q ss_pred             CccccccccccccCCCC
Q 025248          239 SQEISSSARSKRTDINV  255 (255)
Q Consensus       239 ~~~~~~~~~~~~~~~~~  255 (255)
                      ++++++ +|++|+||||
T Consensus       319 ~~~~~~-~~~~~~~~~~  334 (334)
T PLN00023        319 SPESSN-ARSKRMDINV  334 (334)
T ss_pred             Cccccc-ccccccccCC
Confidence            999999 9999999997

>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only]	Back alignment and domain information

>KOG0394 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only]	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only]	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only]	Back alignment and domain information

>PTZ00099 rab6; Provisional	Back alignment and domain information

>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only]	Back alignment and domain information

>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>KOG0395 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only]	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms]	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms]	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only]	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>KOG1673 consensus Ras GTPases [General function prediction only]	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily	Back alignment and domain information

>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only]	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>cd00066 G-alpha G protein alpha subunit	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>smart00275 G_alpha G protein alpha subunit	Back alignment and domain information

>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG3905 consensus Dynein light intermediate chain [Cell motility]	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1)	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG4273 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG5258 GTPBP1 GTPase [General function prediction only]	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only]	Back alignment and domain information

>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) []	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PF14331 ImcF-related_N: ImcF-related N-terminal domain	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>TIGR03348 VI_IcmF type VI secretion protein IcmF	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>TIGR02836 spore_IV_A stage IV sporulation protein A	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>PF11111 CENP-M: Centromere protein M (CENP-M); InterPro: IPR020987 The prime candidate for specifying centromere identity is the array of nucleosomes assembles associated with CENP-A []	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		255
1wms_A		177	RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p	6e-05
1ky3_A		182	GTP-binding protein YPT7P; vesicular traffic, GTP	1e-04
2yc2_C		208	IFT27, small RAB-related GTPase; transport protein	7e-04

>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177	Back alignment and structure

 Score = 41.3 bits (98), Expect = 6e-05
 Identities = 14/83 (16%), Positives = 30/83 (36%), Gaps = 15/83 (18%)

Query: 31  GVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGNKADVAAKEG 90
             +    +   ++  +L  W  E         P +         P+V++GNK D++ ++ 
Sbjct: 82  CCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPES--------FPFVILGNKIDISERQV 133

Query: 91  TRGSSGNLVDAARQWVEKQGLLP 113
           +        + A+ W    G  P
Sbjct: 134 ST-------EEAQAWCRDNGDYP 149

PyMOL of 1wms

>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182	Back alignment and structure

>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		255
4dkx_A		216	RAS-related protein RAB-6A; GTP binding fold, memb	99.88
3ihw_A		184	Centg3; RAS, centaurin, GTPase, structural genomic	99.8
3q72_A		166	GTP-binding protein RAD; G-domain, CAV2 beta, sign	99.8
2fu5_C		183	RAS-related protein RAB-8A; MSS4:RAB8 protein comp	99.79
2iwr_A		178	Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi	99.79
2nzj_A		175	GTP-binding protein REM 1; GDP/GTP binding, GTP hy	99.78
3q85_A		169	GTP-binding protein REM 2; G-domain, CAV2 beta, si	99.78
3reg_A		194	RHO-like small GTPase; cytoskeleton, nucleotide-bi	99.78
2hup_A		201	RAS-related protein RAB-43; G-protein, GDP, struct	99.77
3cbq_A		195	GTP-binding protein REM 2; FLJ38964A, structural g	99.77
2g3y_A		211	GTP-binding protein GEM; small GTPase, GDP, inacti	99.77
3kkq_A		183	RAS-related protein M-RAS; GTP-binding, GTPase, si	99.77
3t5g_A		181	GTP-binding protein RHEB; immunoglobulin-like beta	99.77
3tw8_B		181	RAS-related protein RAB-35; longin domain, RAB GTP	99.76
2a5j_A		191	RAS-related protein RAB-2B; GTPase, signal transdu	99.76
3tkl_A		196	RAS-related protein RAB-1A; vesicle trafficking, p	99.76
3dz8_A		191	RAS-related protein RAB-3B; GDP, GTPase, structura	99.76
2atx_A		194	Small GTP binding protein TC10; GTPase, P-loop, al	99.76
3q3j_B		214	RHO-related GTP-binding protein RHO6; RAS-binding	99.76
2ew1_A		201	RAS-related protein RAB-30; G-protein, GTP analogu	99.76
1z08_A		170	RAS-related protein RAB-21; RAB GTPase, vesicular	99.75
2g6b_A		180	RAS-related protein RAB-26; G-protein, GTP analogu	99.75
1z0f_A		179	RAB14, member RAS oncogene family; RAB GTPase, ves	99.75
2gf9_A		189	RAS-related protein RAB-3D; G-protein, structural	99.75
2bme_A		186	RAB4A, RAS-related protein RAB4A; GTP-binding prot	99.75
2cjw_A		192	GTP-binding protein GEM; nucleotide-binding, small	99.75
2q3h_A		201	RAS homolog gene family, member U; GTPase, structu	99.75
2bcg_Y		206	Protein YP2, GTP-binding protein YPT1; RABGTPase,	99.75
1zbd_A		203	Rabphilin-3A; G protein, effector, RABCDR, synapti	99.75
3oes_A		201	GTPase rhebl1; small GTPase, structural genomics,	99.74
2o52_A		200	RAS-related protein RAB-4B; G-protein, GDP, struct	99.74
1m7b_A		184	RND3/RHOE small GTP-binding protein; small GTPase,	99.74
3t1o_A		198	Gliding protein MGLA; G domain containing protein,	99.74
3c5c_A		187	RAS-like protein 12; GDP, GTPase, structural genom	99.74
1r2q_A		170	RAS-related protein RAB-5A; GTPase, GNP, atomic re	99.74
1g16_A		170	RAS-related protein SEC4; G protein RAB, signaling	99.74
2efe_B		181	Small GTP-binding protein-like; GEF, GTPase, VPS9,	99.74
3bwd_D		182	RAC-like GTP-binding protein ARAC6; G domain, cyto	99.74
2hxs_A		178	RAB-26, RAS-related protein RAB-28; GTPase, signal	99.74
2yc2_C		208	IFT27, small RAB-related GTPase; transport protein	99.74
2fn4_A		181	P23, RAS-related protein R-RAS; GDP/GTP binding, G	99.73
3cpj_B		223	GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl	99.73
1u8z_A		168	RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH	99.73
2atv_A		196	RERG, RAS-like estrogen-regulated growth inhibitor	99.73
2j0v_A		212	RAC-like GTP-binding protein ARAC7; nucleotide-bin	99.73
2a9k_A		187	RAS-related protein RAL-A; bacterial ADP-ribosyltr	99.73
1z2a_A		168	RAS-related protein RAB-23; RAB GTPase, vesicular	99.73
3bc1_A		195	RAS-related protein RAB-27A; RAB27, GTPase, RAB, s	99.73
1ky3_A		182	GTP-binding protein YPT7P; vesicular traffic, GTP	99.73
1z0j_A		170	RAB-22, RAS-related protein RAB-22A; RAB GTPase, R	99.73
1gwn_A		205	RHO-related GTP-binding protein RHOE; GTPase, inac	99.73
2oil_A		193	CATX-8, RAS-related protein RAB-25; G-protein, GDP	99.73
2j1l_A		214	RHO-related GTP-binding protein RHOD; GTPase, memb	99.72
2bov_A		206	RAla, RAS-related protein RAL-A; C3BOT, exoenzyme,	99.72
2il1_A		192	RAB12; G-protein, GDP, GTPase, predicted, structur	99.72
2fg5_A		192	RAB-22B, RAS-related protein RAB-31; G-protein, GT	99.72
1c1y_A		167	RAS-related protein RAP-1A; GTP-binding proteins,	99.72
1ek0_A		170	Protein (GTP-binding protein YPT51); vesicular tra	99.72
1z06_A		189	RAS-related protein RAB-33B; RAB GTPase, RAB33B GT	99.71
1x3s_A		195	RAS-related protein RAB-18; GTPase, GNP, structura	99.71
2p5s_A		199	RAS and EF-hand domain containing; G-protein, RAB,	99.71
2f7s_A		217	C25KG, RAS-related protein RAB-27B; G-protein, str	99.71
1kao_A		167	RAP2A; GTP-binding protein, small G protein, GDP,	99.71
1mh1_A		186	RAC1; GTP-binding, GTPase, small G-protein, RHO fa	99.71
4dsu_A		189	GTPase KRAS, isoform 2B; small G-protein, signalin	99.71
3cph_A		213	RAS-related protein SEC4; RAB GTPase, prenylation,	99.71
4gzl_A		204	RAS-related C3 botulinum toxin substrate 1; rossma	99.71
2y8e_A		179	RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti	99.7
3clv_A		208	RAB5 protein, putative; malaria, GTPase, structura	99.7
1wms_A		177	RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p	99.7
2gco_A		201	H9, RHO-related GTP-binding protein RHOC; GTPase,s	99.7
3l0i_B		199	RAS-related protein RAB-1A; GEF-GDF-RAB complex, G	99.7
2fv8_A		207	H6, RHO-related GTP-binding protein RHOB; GDP/GTP	99.7
4djt_A		218	GTP-binding nuclear protein GSP1; structural genom	99.69
1vg8_A		207	RAS-related protein RAB-7; GTP-binding protein, pr	99.69
3con_A		190	GTPase NRAS; structural genomics consortium, SGC,	99.68
3llu_A		196	RAS-related GTP-binding protein C; structural geno	99.68
2erx_A		172	GTP-binding protein DI-RAS2; GTP hydrolysis, trans	99.67
3gj0_A		221	GTP-binding nuclear protein RAN; G protein, GDP, a	99.67
2ce2_X		166	GTPase HRAS; signaling protein, guanine nucleotide	99.67
4bas_A		199	ADP-ribosylation factor, putative (small GTPase, p	99.66
1r8s_A		164	ADP-ribosylation factor 1; protein transport/excha	99.66
1f6b_A		198	SAR1; gtpases, N-terminal helix, Mg-containing com	99.65
2wkq_A		332	NPH1-1, RAS-related C3 botulinum toxin substrate 1	99.65
1fzq_A		181	ADP-ribosylation factor-like protein 3; protein-GD	99.64
1upt_A		171	ARL1, ADP-ribosylation factor-like protein 1; hydr	99.64
3th5_A		204	RAS-related C3 botulinum toxin substrate 1; rossma	99.44
1m2o_B		190	GTP-binding protein SAR1, GTP binding protein; zin	99.63
2x77_A		189	ADP-ribosylation factor; GTP-binding protein, smal	99.63
1ksh_A		186	ARF-like protein 2; small GTPase, small GTP-bindin	99.63
1moz_A		183	ARL1, ADP-ribosylation factor-like protein 1; GTP-	99.63
2b6h_A		192	ADP-ribosylation factor 5; membrane trafficking, G	99.62
2gf0_A		199	GTP-binding protein DI-RAS1; GDP/GTP binding, GTP	99.62
2h57_A		190	ADP-ribosylation factor-like protein 6; GTP, GTPas	99.62
1zd9_A		188	ADP-ribosylation factor-like 10B; transport protei	99.61
1zj6_A		187	ADP-ribosylation factor-like protein 5; ARL, GTP-b	99.61
2h17_A		181	ADP-ribosylation factor-like protein 5A; GDP, GTPa	99.61
3r7w_B		331	Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT	99.6
2zej_A		184	Dardarin, leucine-rich repeat kinase 2; parkinson'	99.59
3c5h_A		255	Glucocorticoid receptor DNA-binding factor 1; RAS,	99.56
1cip_A		353	Protein (guanine nucleotide-binding protein alpha-	99.56
2xtz_A		354	Guanine nucleotide-binding protein alpha-1 subuni;	99.56
2f9l_A		199	RAB11B, member RAS oncogene family; RAB11B GTPase,	99.55
3o47_A		329	ADP-ribosylation factor GTPase-activating protein	99.54
1azs_C		402	GS-alpha; complex (lyase/hydrolase), hydrolase, si	99.52
2qu8_A		228	Putative nucleolar GTP-binding protein 1; GTPase,	99.5
3r7w_A		307	Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT	99.5
3ohm_A		327	Guanine nucleotide-binding protein G(Q) subunit A;	99.5
3lvq_E		497	ARF-GAP with SH3 domain, ANK repeat and PH domain	99.5
2wji_A		165	Ferrous iron transport protein B homolog; membrane	99.49
1oix_A		191	RAS-related protein RAB-11A; small G protein, intr	99.49
1zcb_A		362	G alpha I/13; GTP-binding, lipoprotein, membrane,	99.49
1u0l_A		301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	99.49
2fh5_B		214	SR-beta, signal recognition particle receptor beta	99.43
2cxx_A		190	Probable GTP-binding protein ENGB; structural geno	99.42
2dyk_A		161	GTP-binding protein; GTPase, ribosome-binding prot	99.41
2lkc_A		178	Translation initiation factor IF-2; NMR {Geobacill	99.39
4fid_A		340	G protein alpha subunit; RAS-like domain, all-heli	99.38
2gj8_A		172	MNME, tRNA modification GTPase TRME; G-domain dime	99.36
3pqc_A		195	Probable GTP-binding protein ENGB; rossmann fold,	99.33
2wjg_A		188	FEOB, ferrous iron transport protein B homolog; me	99.33
3dpu_A		535	RAB family protein; roccor, G-domain, COR, GTP-bin	99.29
1svi_A		195	GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro	99.24
3iev_A		308	GTP-binding protein ERA; ERA, GTPase, KH domain, a	99.24
1nrj_B		218	SR-beta, signal recognition particle receptor beta	99.24
2yv5_A		302	YJEQ protein; hydrolase, GTPase, permutation, stru	99.24
2hjg_A		436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	99.19
1lnz_A		342	SPO0B-associated GTP-binding protein; GTPase, OBG,	99.18
3b1v_A		272	Ferrous iron uptake transporter protein B; G prote	99.18
3a1s_A		258	Iron(II) transport protein B; FEOB, iron transport	99.16
4dcu_A		456	GTP-binding protein ENGA; GTPase, GDP, protein bin	99.14
3qq5_A		423	Small GTP-binding protein; hydrogenase, H-cluster,	99.13
3gee_A		476	MNME, tRNA modification GTPase MNME; G protein, cy	99.12
2e87_A		357	Hypothetical protein PH1320; GTP-binding, GTPase,	99.1
3iby_A		256	Ferrous iron transport protein B; G protein, G dom	99.08
4dhe_A		223	Probable GTP-binding protein ENGB; melioidosis, RA	99.07
3l82_B		227	F-box only protein 4; TRFH domain, helix, GTPase d	99.03
3i8s_A		274	Ferrous iron transport protein B; GTPase, GPCR, ir	99.02
1mky_A		439	Probable GTP-binding protein ENGA; GTPase, DER, KH	99.0
3k53_A		271	Ferrous iron transport protein B; GTPase fold, hel	98.99
1wf3_A		301	GTP-binding protein; GTPase, riken structural geno	98.98
1xzp_A		482	Probable tRNA modification GTPase TRME; GTP-bindin	98.94
3sjy_A		403	Translation initiation factor 2 subunit gamma; zin	98.91
3cb4_D		599	GTP-binding protein LEPA; GTPase, OB-fold, membran	98.9
2hjg_A		436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	98.89
3geh_A		462	MNME, tRNA modification GTPase MNME; G protein, U3	98.88
2ged_A		193	SR-beta, signal recognition particle receptor beta	98.87
2ywe_A		600	GTP-binding protein LEPA; G domain, beta-barrel, f	98.85
1mky_A		439	Probable GTP-binding protein ENGA; GTPase, DER, KH	98.85
3l2o_B		312	F-box only protein 4; small G protein fold, UBL co	98.83
1ega_A		301	Protein (GTP-binding protein ERA); GTPase, RNA-bin	98.83
3p26_A		483	Elongation factor 1 alpha-like protein; GTP/GDP bi	98.8
2qag_A		361	Septin-2, protein NEDD5; cell cycle, cell division	98.77
1s0u_A		408	EIF-2-gamma, translation initiation factor 2 gamma	98.77
1jny_A		435	EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-	98.76
3izy_P		537	Translation initiation factor IF-2, mitochondrial;	98.74
1wb1_A		482	Translation elongation factor SELB; selenocysteine	98.72
1g7s_A		594	Translation initiation factor IF2/EIF5B; translati	98.72
2c78_A		405	Elongation factor TU-A; hydrolase, GTPase, transla	98.71
3h2y_A		368	GTPase family protein; GTP-binding protein YQEH, p	98.7
1d2e_A		397	Elongation factor TU (EF-TU); G-protein, beta-barr	98.69
1zun_B		434	Sulfate adenylate transferase, subunit 1/adenylyls	98.68
3j2k_7		439	ERF3, eukaryotic polypeptide chain release factor	98.66
2aka_B		299	Dynamin-1; fusion protein, GTPase domain, myosin,	98.65
1r5b_A		467	Eukaryotic peptide chain release factor GTP-bindi	98.63
3tr5_A		528	RF-3, peptide chain release factor 3; protein synt	98.62
1f60_A		458	Elongation factor EEF1A; protein-protein complex,	98.61
2xtp_A		260	GTPase IMAP family member 2; immune system, G prot	98.59
4dcu_A		456	GTP-binding protein ENGA; GTPase, GDP, protein bin	98.59
2qtf_A		364	Protein HFLX, GTP-binding protein; beta-alpha-barr	98.57
1kk1_A		410	EIF2gamma; initiation of translation; HET: GNP; 1.	98.53
3t34_A		360	Dynamin-related protein 1A, linker, dynamin-relat	98.52
1zo1_I		501	IF2, translation initiation factor 2; E. coli, rib	98.51
3izq_1		611	HBS1P, elongation factor 1 alpha-like protein; NO-	98.49
3lxx_A		239	GTPase IMAP family member 4; structural genomics c	98.46
3ec1_A		369	YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase	98.46
3avx_A		1289	Elongation factor TS, elongation factor TU, linke	98.38
2elf_A		370	Protein translation elongation factor 1A; tRNA, py	98.36
2j69_A		695	Bacterial dynamin-like protein; FZO, FZL, GTPase,	98.28
3mca_A		592	HBS1, elongation factor 1 alpha-like protein; prot	98.28
1udx_A		416	The GTP-binding protein OBG; TGS domain, riken str	98.27
3lxw_A		247	GTPase IMAP family member 1; immunity, structural	98.24
2qnr_A		301	Septin-2, protein NEDD5; structural genomics conso	98.22
3t5d_A		274	Septin-7; GTP-binding protein, cytoskeleton, signa	98.22
1dar_A		691	EF-G, elongation factor G; ribosomal translocase,	98.19
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	98.19
2dy1_A		665	Elongation factor G; translocation, GTP complex, s	98.17
2qag_C		418	Septin-7; cell cycle, cell division, GTP-binding,	98.16
1pui_A		210	ENGB, probable GTP-binding protein ENGB; structura	98.13
2rdo_7		704	EF-G, elongation factor G; elongation factor G, EF	98.09
1puj_A		282	YLQF, conserved hypothetical protein YLQF; structu	98.04
2xex_A		693	Elongation factor G; GTPase, translation, biosynth	97.94
1wxq_A		397	GTP-binding protein; structural genomics, riken st	97.92
1h65_A		270	Chloroplast outer envelope protein OEP34; GTPase,	97.89
1jwy_B		315	Dynamin A GTPase domain; dynamin, GTPase, GDP, myo	97.87
2x2e_A		353	Dynamin-1; nitration, hydrolase, membrane fission,	97.85
3def_A		262	T7I23.11 protein; chloroplast, TOC33, GTPase, hydr	97.85
2hf9_A		226	Probable hydrogenase nickel incorporation protein	97.79
2h5e_A		529	Peptide chain release factor RF-3; beta barrel, tr	97.79
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	97.76
1n0u_A		842	EF-2, elongation factor 2; G-protein, CIS-proline,	97.72
1yrb_A		262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	97.66
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	97.48
2p67_A		341	LAO/AO transport system kinase; ARGK, structural G	97.46
3cnl_A		262	YLQF, putative uncharacterized protein; circular p	97.46
2dby_A		368	GTP-binding protein; GDP, structural genomics, NPP	97.26
2www_A		349	Methylmalonic aciduria type A protein, mitochondri	97.1
1jal_A		363	YCHF protein; nucleotide-binding fold, structural	97.1
1t9h_A		307	YLOQ, probable GTPase ENGC; N-terminal beta-barrel	97.03
2rcn_A		358	Probable GTPase ENGC; YJEQ, circularly permuted, G	96.84
3j25_A		638	Tetracycline resistance protein TETM; antibiotic r	95.85
3vqt_A		548	RF-3, peptide chain release factor 3; translation,	95.85
3zvr_A		772	Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito	95.77
2qm8_A		337	GTPase/ATPase; G protein, G3E, metallochaperone, c	95.52
4fn5_A		709	EF-G 1, elongation factor G 1; translation, transl	93.87
3end_A		307	Light-independent protochlorophyllide reductase ir	86.65
2ohf_A		396	Protein OLA1, GTP-binding protein 9; ATPase, GTPas	83.38
3k9g_A		267	PF-32 protein; ssgcid, SBRI, decode biostructures,	82.17

>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A*	Back alignment and structure

Probab=99.88  E-value=5.1e-23  Score=179.04  Aligned_cols=112  Identities=19%  Similarity=0.256  Sum_probs=97.5

Q ss_pred             CcccccccccccCCCCCCCcccccccCCcEEEEEEECCChhhHHHHHHHHHHHHHhCCCCCCCCCCCCCCCCCcEEEEEe
Q 025248            2 FWKERERENKELNGGPPTGQVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGN   81 (255)
Q Consensus         2 ~w~~~~~~~~~~~g~~~~gq~r~Yyr~adgvIlVyDvT~~~Sfe~l~~Wl~ei~~~~~~s~~~~s~~~~~~~iPiiLVGN   81 (255)
                      +||++|++.+.       ...+.||++++++|+|||+++++||+++..|+.++..+.            ..++|+|||||
T Consensus        66 iwDtaGqe~~~-------~l~~~~~~~a~~~ilv~di~~~~Sf~~i~~~~~~i~~~~------------~~~~piilVgN  126 (216)
T 4dkx_A           66 LWDTAGLERFR-------SLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTER------------GSDVIIMLVGN  126 (216)
T ss_dssp             EECCSCTTTCG-------GGHHHHHTTCSEEEEEEETTCHHHHHTHHHHHHHHHHHH------------TTSSEEEEEEE
T ss_pred             EEECCCchhhh-------hHHHHHhccccEEEEEeecchhHHHHHHHHHHHHHHHhc------------CCCCeEEEEee
Confidence            68888877554       245689999999999999999999999999999998753            34599999999


Q ss_pred             CCCCCCCCCCccCCccHHHHHHHHHHHcCCCCeeecCCCCCCCCCCCCcceeeecCCCHHHHHHHHHHHHHHH
Q 025248           82 KADVAAKEGTRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFRMLIRR  154 (255)
Q Consensus        82 K~DL~~~~~r~Vs~~~l~e~a~~~a~~~gl~~~~Ee~p~~e~~~~~~~~~tSAk~g~nv~e~f~~l~~~li~~  154 (255)
                      |+||...  |.|+.    +++.++|+++++ .|+|               ||||+|.||+++|+.|++.|.+.
T Consensus       127 K~Dl~~~--r~V~~----~e~~~~a~~~~~-~~~e---------------~SAktg~nV~e~F~~i~~~i~~~  177 (216)
T 4dkx_A          127 KTDLADK--RQVSI----EEGERKAKELNV-MFIE---------------TSAKAGYNVKQLFRRVAAALPGM  177 (216)
T ss_dssp             CTTCGGG--CCSCH----HHHHHHHHHHTC-EEEE---------------EBTTTTBSHHHHHHHHHHHC---
T ss_pred             ccchHhc--CcccH----HHHhhHHHHhCC-eeEE---------------EeCCCCcCHHHHHHHHHHHHHhh
Confidence            9999987  89998    999999999997 8999               99999999999999999887654

PyMOL of 4dkx

>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A*	Back alignment and structure

>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A*	Back alignment and structure

>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A	Back alignment and structure

>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens}	Back alignment and structure

>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A*	Back alignment and structure

>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A*	Back alignment and structure

>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens}	Back alignment and structure

>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens}	Back alignment and structure

>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A*	Back alignment and structure

>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A*	Back alignment and structure

>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens}	Back alignment and structure

>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A*	Back alignment and structure

>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens}	Back alignment and structure

>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A*	Back alignment and structure

>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A*	Back alignment and structure

>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A*	Back alignment and structure

>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A*	Back alignment and structure

>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A*	Back alignment and structure

>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A*	Back alignment and structure

>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens}	Back alignment and structure

>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A*	Back alignment and structure

>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8	Back alignment and structure

>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens}	Back alignment and structure

>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens}	Back alignment and structure

>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B*	Back alignment and structure

>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A*	Back alignment and structure

>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens}	Back alignment and structure

>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A*	Back alignment and structure

>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A	Back alignment and structure

>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B*	Back alignment and structure

>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C	Back alignment and structure

>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A*	Back alignment and structure

>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C	Back alignment and structure

>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A*	Back alignment and structure

>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae}	Back alignment and structure

>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A*	Back alignment and structure

>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana}	Back alignment and structure

>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A*	Back alignment and structure

>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A*	Back alignment and structure

>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A*	Back alignment and structure

>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A*	Back alignment and structure

>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A*	Back alignment and structure

>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8	Back alignment and structure

>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens}	Back alignment and structure

>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens}	Back alignment and structure

>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens}	Back alignment and structure

>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens}	Back alignment and structure

>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D*	Back alignment and structure

>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B*	Back alignment and structure

>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens}	Back alignment and structure

>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A*	Back alignment and structure

>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R*	Back alignment and structure

>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ...	Back alignment and structure

>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A*	Back alignment and structure

>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A*	Back alignment and structure

>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A*	Back alignment and structure

>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum}	Back alignment and structure

>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A*	Back alignment and structure

>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ...	Back alignment and structure

>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens}	Back alignment and structure

>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi}	Back alignment and structure

>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B*	Back alignment and structure

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*	Back alignment and structure

>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A*	Back alignment and structure

>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ...	Back alignment and structure

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...	Back alignment and structure

>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927}	Back alignment and structure

>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ...	Back alignment and structure

>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A*	Back alignment and structure

>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A*	Back alignment and structure

>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A*	Back alignment and structure

>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A*	Back alignment and structure

>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens}	Back alignment and structure

>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B*	Back alignment and structure

>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major}	Back alignment and structure

>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A*	Back alignment and structure

>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A*	Back alignment and structure

>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens}	Back alignment and structure

>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A*	Back alignment and structure

>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A*	Back alignment and structure

>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B*	Back alignment and structure

>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B*	Back alignment and structure

>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens}	Back alignment and structure

>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ...	Back alignment and structure

>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana}	Back alignment and structure

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*	Back alignment and structure

>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens}	Back alignment and structure

>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A*	Back alignment and structure

>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum}	Back alignment and structure

>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A*	Back alignment and structure

>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A*	Back alignment and structure

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*	Back alignment and structure

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*	Back alignment and structure

>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A*	Back alignment and structure

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2	Back alignment and structure

>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8	Back alignment and structure

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}	Back alignment and structure

>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A*	Back alignment and structure

>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica}	Back alignment and structure

>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A	Back alignment and structure

>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A	Back alignment and structure

>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}	Back alignment and structure

>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum}	Back alignment and structure

>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*	Back alignment and structure

>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A*	Back alignment and structure

>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}	Back alignment and structure

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}	Back alignment and structure

>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8	Back alignment and structure

>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A*	Back alignment and structure

>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A	Back alignment and structure

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*	Back alignment and structure

>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana}	Back alignment and structure

>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A*	Back alignment and structure

>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii}	Back alignment and structure

>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila}	Back alignment and structure

>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis}	Back alignment and structure

>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens}	Back alignment and structure

>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A*	Back alignment and structure

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1	Back alignment and structure

>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus}	Back alignment and structure

>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1	Back alignment and structure

>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B*	Back alignment and structure

>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A*	Back alignment and structure

>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C*	Back alignment and structure

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}	Back alignment and structure

>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP}	Back alignment and structure

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A*	Back alignment and structure

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1	Back alignment and structure

>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens}	Back alignment and structure

>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X	Back alignment and structure

>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A*	Back alignment and structure

>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8	Back alignment and structure

>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A*	Back alignment and structure

>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus}	Back alignment and structure

>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A*	Back alignment and structure

>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A*	Back alignment and structure

>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ...	Back alignment and structure

>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str}	Back alignment and structure

>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A*	Back alignment and structure

>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8	Back alignment and structure

>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus}	Back alignment and structure

>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A*	Back alignment and structure

>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A	Back alignment and structure

>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii}	Back alignment and structure

>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A	Back alignment and structure

>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A	Back alignment and structure

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*	Back alignment and structure

>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A	Back alignment and structure

>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A*	Back alignment and structure

>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A*	Back alignment and structure

>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli}	Back alignment and structure

>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens}	Back alignment and structure

>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus}	Back alignment and structure

>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B	Back alignment and structure

>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei}	Back alignment and structure

>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A*	Back alignment and structure

>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe}	Back alignment and structure

>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1	Back alignment and structure

>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A*	Back alignment and structure

>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A*	Back alignment and structure

>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ...	Back alignment and structure

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A*	Back alignment and structure

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8	Back alignment and structure

>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H	Back alignment and structure

>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8	Back alignment and structure

>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus}	Back alignment and structure

>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2	Back alignment and structure

>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A*	Back alignment and structure

>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B*	Back alignment and structure

>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A	Back alignment and structure

>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A*	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W*	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A*	Back alignment and structure

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10	Back alignment and structure

>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A*	Back alignment and structure

>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A	Back alignment and structure

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}	Back alignment and structure

>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2	Back alignment and structure

>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V	Back alignment and structure

>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis}	Back alignment and structure

>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A*	Back alignment and structure

>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A	Back alignment and structure

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*	Back alignment and structure

>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa}	Back alignment and structure

>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens}	Back alignment and structure

>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		255
d2gjsa1		168	Rad {Human (Homo sapiens) [TaxId: 9606]}	99.87
d1x1ra1		169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	99.86
d2g3ya1		172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	99.85
d1z2aa1		164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	99.85
d1xtqa1		167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	99.84
d1z08a1		167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	99.84
d2atva1		168	Ras-like estrogen-regulated growth inhibitor, RERG	99.84
d1kmqa_		177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	99.83
d1ky3a_		175	Rab-related protein ypt7p {Baker's yeast (Saccharo	99.83
d2atxa1		185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	99.83
d2fn4a1		173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	99.83
d1u8za_		168	Ras-related protein RalA {Cotton-top tamarin (Sagu	99.83
d2erxa1		171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	99.83
d1z0ja1		167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	99.83
d2a5ja1		173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	99.83
d1c1ya_		167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	99.83
d2f7sa1		186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	99.82
d2ew1a1		171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	99.82
d3raba_		169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	99.81
d1kaoa_		167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	99.81
d1i2ma_		170	Ran {Human (Homo sapiens) [TaxId: 9606]}	99.81
d1yzqa1		164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	99.81
d2erya1		171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	99.81
d1z06a1		165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	99.8
d1r2qa_		170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	99.8
d2ngra_		191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	99.8
d2bmja1		175	Centaurin gamma 1, G domain {Human (Homo sapiens)	99.8
d1m7ba_		179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	99.8
d1z0fa1		166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	99.79
d1mh1a_		183	Rac {Human (Homo sapiens) [TaxId: 9606]}	99.78
d1ctqa_		166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	99.78
d2fu5c1		173	Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	99.78
d2bmea1		174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	99.78
d2f9la1		175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	99.77
d2g6ba1		170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	99.77
d2bcgy1		194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	99.76
d1wmsa_		174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	99.76
d1ek0a_		170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	99.75
d1vg8a_		184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	99.74
d1x3sa1		177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	99.7
d1g16a_		166	Rab-related protein Sec4 {Baker's yeast (Saccharom	99.69
d1moza_		182	ADP-ribosylation factor {Baker's yeast (Saccharomy	99.66
d1e0sa_		173	ADP-ribosylation factor {Human (Homo sapiens), ARF	99.62
d1fzqa_		176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	99.61
d1ksha_		165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	99.6
d1zd9a1		164	ADP-ribosylation factor {Human (Homo sapiens), ARL	99.58
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	99.45
d1svsa1		195	Transducin (alpha subunit) {Rat (Rattus norvegicus	99.3
d1zj6a1		177	ADP-ribosylation factor {Human (Homo sapiens), ARL	99.28
d2qtvb1		166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	99.21
d2bcjq2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	99.15
d1upta_		169	ADP-ribosylation factor {Human (Homo sapiens), ARL	99.12
d1zcba2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	99.1
d1wf3a1		178	GTPase Era, N-terminal domain {Thermus thermophilu	99.09
d1f6ba_		186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	99.05
d1udxa2		180	Obg GTP-binding protein middle domain {Thermus the	98.99
d2gj8a1		161	Probable tRNA modification GTPase TrmE (MnmE), G d	98.99
d1mkya1		171	Probable GTPase Der, N-terminal and middle domains	98.87
d1xzpa2		160	TrmE GTPase domain {Thermotoga maritima [TaxId: 23	98.79
d1azta2		221	Transducin (alpha subunit) {Cow (Bos taurus) [TaxI	98.66
d1lnza2		185	Obg GTP-binding protein middle domain {Bacillus su	98.65
d1mkya2		186	Probable GTPase Der, N-terminal and middle domains	98.57
d1svia_		195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	98.47
d2fh5b1		207	Signal recognition particle receptor beta-subunit	98.46
d1wb1a4		179	Elongation factor SelB, N-terminal domain {Methano	98.45
d2cxxa1		184	GTP-binding protein engB {Pyrococcus horikoshii [T	98.42
d1g7sa4		227	Initiation factor IF2/eIF5b, N-terminal (G) domain	98.21
d1egaa1		179	GTPase Era, N-terminal domain {Escherichia coli [T	98.04
d2qn6a3		205	Initiation factor eIF2 gamma subunit, N-terminal (	97.95
d1kk1a3		195	Initiation factor eIF2 gamma subunit, N-terminal (	97.78
d1puja_		273	Probable GTPase YlqF {Bacillus subtilis [TaxId: 14	97.37
d1puia_		188	Probable GTPase EngB {Escherichia coli [TaxId: 562	97.21
d1u0la2		225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	97.13
d1d2ea3		196	Elongation factor Tu (EF-Tu), N-terminal (G) domai	97.09
d1nrjb_		209	Signal recognition particle receptor beta-subunit	97.01
d1r5ba3		245	Eukaryotic peptide chain release factor ERF2, G do	96.88
d1zunb3		222	Sulfate adenylate transferase subunit cysN/C, EF-T	96.81
d1t9ha2		231	Probable GTPase EngC (YjeQ), C-terminal domain {Ba	96.7
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	96.66
d2c78a3		204	Elongation factor Tu (EF-Tu), N-terminal (G) domai	96.21
d1jnya3		224	Elongation factor eEF-1alpha, N-terminal (G) domai	95.87
d1f60a3		239	Elongation factor eEF-1alpha, N-terminal (G) domai	95.29
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	95.05
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	93.93
d1n0ua2		341	Elongation factor 2 (eEF-2), N-terminal (G) domain	92.81
d2bv3a2		276	Elongation factor G (EF-G), N-terminal (G) domain	91.37
d2dy1a2		267	Elongation factor G (EF-G), N-terminal (G) domain	91.18

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rad
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=7.7e-23  Score=166.96  Aligned_cols=114  Identities=15%  Similarity=0.135  Sum_probs=94.5

Q ss_pred             CcccccccccccCCCCCCCcccccccCCcEEEEEEECCChhhHHHHHHHHHHHHHhCCCCCCCCCCCCCCCCCcEEEEEe
Q 025248            2 FWKERERENKELNGGPPTGQVRVLVVGDSGVIFVHDLSQRRTKTSLQKWAVEIATSGTFSAPLASGGPGGLPVPYVVIGN   81 (255)
Q Consensus         2 ~w~~~~~~~~~~~g~~~~gq~r~Yyr~adgvIlVyDvT~~~Sfe~l~~Wl~ei~~~~~~s~~~~s~~~~~~~iPiiLVGN   81 (255)
                      +||.+|++.+.       ...+.||+++||+|+|||++++.||+++..|+.++....           ....+|++||||
T Consensus        52 i~D~~g~e~~~-------~~~~~~~~~~d~~ilv~d~t~~~s~~~~~~~~~~i~~~~-----------~~~~~piilvgn  113 (168)
T d2gjsa1          52 VYDIWEQDGGR-------WLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRAR-----------QTDDVPIILVGN  113 (168)
T ss_dssp             EEECC--------------CHHHHHTSCSEEEEEEETTCHHHHHHHHHHHHHHHHHC-----------C--CCCEEEEEE
T ss_pred             eeecccccccc-------eecccchhhhhhhceeccccccccccccccccchhhccc-----------ccccceEEEeec
Confidence            78888876543       234679999999999999999999999999999998742           134589999999


Q ss_pred             CCCCCCCCCCccCCccHHHHHHHHHHHcCCCCeeecCCCCCCCCCCCCcceeeecCCCHHHHHHHHHHHHHHHh
Q 025248           82 KADVAAKEGTRGSSGNLVDAARQWVEKQGLLPSSEELPLTESFPGGGGLIAAAKEARYDKEAVMKFFRMLIRRR  155 (255)
Q Consensus        82 K~DL~~~~~r~Vs~~~l~e~a~~~a~~~gl~~~~Ee~p~~e~~~~~~~~~tSAk~g~nv~e~f~~l~~~li~~~  155 (255)
                      |+||...  +.|+.    ++++++++.+++ +|+|               ||||+|.||+++|+.++++|..++
T Consensus       114 K~Dl~~~--~~v~~----~~~~~~~~~~~~-~~~e---------------~Sak~~~~v~~~f~~l~~~i~~~~  165 (168)
T d2gjsa1         114 KSDLVRS--REVSV----DEGRACAVVFDC-KFIE---------------TSAALHHNVQALFEGVVRQIRLRR  165 (168)
T ss_dssp             CTTCGGG--CCSCH----HHHHHHHHHHTS-EEEE---------------CBTTTTBSHHHHHHHHHHHHHHHH
T ss_pred             ccchhhh--cchhH----HHHHHHHHhcCC-EEEE---------------EeCCCCcCHHHHHHHHHHHHHHHh
Confidence            9999877  78887    889999999997 8999               999999999999999999987764

PyMOL of d2gjsa1

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}	Back information, alignment and structure

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}	Back information, alignment and structure

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}	Back information, alignment and structure

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}	Back information, alignment and structure

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}	Back information, alignment and structure

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}	Back information, alignment and structure

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}	Back information, alignment and structure

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}	Back information, alignment and structure

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}	Back information, alignment and structure

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}	Back information, alignment and structure

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}	Back information, alignment and structure