Citrus Sinensis ID: 025346
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 254 | ||||||
| 225430700 | 435 | PREDICTED: GTPase Era-like [Vitis vinife | 0.681 | 0.397 | 0.855 | 2e-82 | |
| 255561072 | 443 | GTP-binding protein era, putative [Ricin | 0.952 | 0.546 | 0.646 | 9e-79 | |
| 297735123 | 320 | unnamed protein product [Vitis vinifera] | 0.633 | 0.503 | 0.850 | 4e-75 | |
| 22328152 | 427 | GTP-binding protein Era [Arabidopsis tha | 0.909 | 0.540 | 0.589 | 2e-74 | |
| 224097032 | 414 | predicted protein [Populus trichocarpa] | 0.677 | 0.415 | 0.781 | 6e-74 | |
| 449457520 | 433 | PREDICTED: GTPase Era-like [Cucumis sati | 0.696 | 0.408 | 0.757 | 9e-74 | |
| 78499699 | 429 | hypothetical protein [Eutrema halophilum | 0.909 | 0.538 | 0.574 | 4e-72 | |
| 297794363 | 427 | GTP binding protein [Arabidopsis lyrata | 0.692 | 0.412 | 0.732 | 1e-70 | |
| 312190415 | 426 | GTP binding protein [Eutrema parvulum] | 0.866 | 0.516 | 0.589 | 1e-70 | |
| 356502167 | 421 | PREDICTED: GTPase Era-like [Glycine max] | 0.657 | 0.396 | 0.760 | 5e-70 |
| >gi|225430700|ref|XP_002264259.1| PREDICTED: GTPase Era-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 311 bits (797), Expect = 2e-82, Method: Compositional matrix adjust.
Identities = 148/173 (85%), Positives = 161/173 (93%)
Query: 82 SFLSLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLS 141
+FLSLSEKPDRNMA DDYE+EE D+AS+PNH+SGYVAVLGKPNVGKSTLANQMIGQKLS
Sbjct: 104 TFLSLSEKPDRNMALLDDYELEELDFASNPNHRSGYVAVLGKPNVGKSTLANQMIGQKLS 163
Query: 142 IVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVV 201
IVT+KPQTTRHRILGICSGPEYQMILYDTPG+IEKK+H LDSMMMKNVRSA INADC+VV
Sbjct: 164 IVTDKPQTTRHRILGICSGPEYQMILYDTPGVIEKKMHKLDSMMMKNVRSATINADCVVV 223
Query: 202 LVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEVTTCF 254
LVDACK P++IDE+LEEGVG+ KDKLP LLVLNKKDLIKPGEIAKKLE F
Sbjct: 224 LVDACKEPQKIDEVLEEGVGNLKDKLPTLLVLNKKDLIKPGEIAKKLEWYEKF 276
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255561072|ref|XP_002521548.1| GTP-binding protein era, putative [Ricinus communis] gi|223539226|gb|EEF40819.1| GTP-binding protein era, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297735123|emb|CBI17485.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|22328152|ref|NP_201448.2| GTP-binding protein Era [Arabidopsis thaliana] gi|17473914|gb|AAL38371.1| GTP-binding protein-like [Arabidopsis thaliana] gi|20259794|gb|AAM13244.1| GTP-binding protein-like [Arabidopsis thaliana] gi|332010835|gb|AED98218.1| GTP-binding protein Era [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224097032|ref|XP_002310817.1| predicted protein [Populus trichocarpa] gi|222853720|gb|EEE91267.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449457520|ref|XP_004146496.1| PREDICTED: GTPase Era-like [Cucumis sativus] gi|449529894|ref|XP_004171933.1| PREDICTED: GTPase Era-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|78499699|gb|ABB45853.1| hypothetical protein [Eutrema halophilum] | Back alignment and taxonomy information |
|---|
| >gi|297794363|ref|XP_002865066.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297310901|gb|EFH41325.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|312190415|gb|ADQ43214.1| GTP binding protein [Eutrema parvulum] | Back alignment and taxonomy information |
|---|
| >gi|356502167|ref|XP_003519892.1| PREDICTED: GTPase Era-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 254 | ||||||
| TAIR|locus:2154915 | 427 | AT5G66470 [Arabidopsis thalian | 0.665 | 0.395 | 0.751 | 1.7e-66 | |
| TIGR_CMR|BA_4524 | 301 | BA_4524 "GTP-binding protein E | 0.527 | 0.445 | 0.379 | 3.4e-22 | |
| UNIPROTKB|Q74AX3 | 299 | era "GTPase Era" [Geobacter su | 0.515 | 0.438 | 0.411 | 3.9e-21 | |
| TIGR_CMR|GSU_2226 | 299 | GSU_2226 "GTP-binding protein | 0.515 | 0.438 | 0.411 | 3.9e-21 | |
| UNIPROTKB|P37214 | 299 | era "GTPase Era" [Streptococcu | 0.523 | 0.444 | 0.367 | 1.3e-20 | |
| UNIPROTKB|Q9KPB3 | 325 | era "GTPase Era" [Vibrio chole | 0.507 | 0.396 | 0.4 | 5.7e-20 | |
| TIGR_CMR|VC_2460 | 325 | VC_2460 "GTP-binding protein E | 0.507 | 0.396 | 0.4 | 5.7e-20 | |
| TIGR_CMR|SPO_0691 | 301 | SPO_0691 "GTP-binding protein | 0.5 | 0.421 | 0.389 | 1.2e-19 | |
| UNIPROTKB|Q5SM23 | 301 | era "GTPase Era" [Thermus ther | 0.519 | 0.438 | 0.406 | 1.5e-19 | |
| TIGR_CMR|CHY_0430 | 298 | CHY_0430 "GTP-binding protein | 0.531 | 0.453 | 0.361 | 1.5e-19 |
| TAIR|locus:2154915 AT5G66470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 676 (243.0 bits), Expect = 1.7e-66, P = 1.7e-66
Identities = 127/169 (75%), Positives = 149/169 (88%)
Query: 81 SSFLSLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKL 140
+S LSLS KPDRNMA DDYE+EE + + +H+SGYVAV+G PNVGKSTL+NQMIGQK+
Sbjct: 95 ASLLSLSMKPDRNMALLDDYEMEELGHTPNTHHRSGYVAVVGMPNVGKSTLSNQMIGQKI 154
Query: 141 SIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIV 200
SIVT+KPQTTRHRILGICS PEYQMILYDTPG+IEKK+H LD+MMMKNVR A INADC+V
Sbjct: 155 SIVTDKPQTTRHRILGICSSPEYQMILYDTPGVIEKKMHRLDTMMMKNVRDAAINADCVV 214
Query: 201 VLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLE 249
+LVDACK P I+E+L+EG+GD + K P+LLV+NKKDLIKPGEIAKKLE
Sbjct: 215 ILVDACKTPTNIEEVLKEGLGDLEKKPPMLLVMNKKDLIKPGEIAKKLE 263
|
|
| TIGR_CMR|BA_4524 BA_4524 "GTP-binding protein Era" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74AX3 era "GTPase Era" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2226 GSU_2226 "GTP-binding protein Era" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P37214 era "GTPase Era" [Streptococcus mutans UA159 (taxid:210007)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KPB3 era "GTPase Era" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2460 VC_2460 "GTP-binding protein Era" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0691 SPO_0691 "GTP-binding protein Era" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5SM23 era "GTPase Era" [Thermus thermophilus HB8 (taxid:300852)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0430 CHY_0430 "GTP-binding protein Era" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00024895001 | SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (414 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00022142001 | • | • | • | 0.842 | |||||||
| GSVIVG00019235001 | • | • | • | 0.814 | |||||||
| GSVIVG00024616001 | • | • | • | • | 0.809 | ||||||
| rps3 | • | 0.798 | |||||||||
| GSVIVG00019071001 | • | • | 0.797 | ||||||||
| GSVIVG00019077001 | • | 0.784 | |||||||||
| GSVIVG00019865001 | • | • | 0.782 | ||||||||
| GSVIVG00003076001 | • | • | • | 0.752 | |||||||
| GSVIVG00027195001 | • | 0.689 | |||||||||
| GSVIVG00008391001 | • | 0.685 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 254 | |||
| cd04163 | 168 | cd04163, Era, E | 8e-57 | |
| PRK00089 | 292 | PRK00089, era, GTPase Era; Reviewed | 8e-52 | |
| COG1159 | 298 | COG1159, Era, GTPase [General function prediction | 6e-43 | |
| pfam01926 | 117 | pfam01926, MMR_HSR1, 50S ribosome-binding GTPase | 4e-33 | |
| TIGR00436 | 270 | TIGR00436, era, GTP-binding protein Era | 4e-30 | |
| cd00880 | 161 | cd00880, Era_like, E | 1e-24 | |
| cd00882 | 161 | cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s | 9e-23 | |
| cd01894 | 157 | cd01894, EngA1, EngA1 GTPase contains the first do | 3e-21 | |
| TIGR03594 | 429 | TIGR03594, GTPase_EngA, ribosome-associated GTPase | 2e-20 | |
| PRK15494 | 339 | PRK15494, era, GTPase Era; Provisional | 4e-20 | |
| COG1160 | 444 | COG1160, COG1160, Predicted GTPases [General funct | 2e-19 | |
| TIGR00231 | 162 | TIGR00231, small_GTP, small GTP-binding protein do | 7e-19 | |
| PRK00093 | 435 | PRK00093, PRK00093, GTP-binding protein Der; Revie | 1e-18 | |
| cd04164 | 159 | cd04164, trmE, trmE is a tRNA modification GTPase | 1e-17 | |
| TIGR03594 | 429 | TIGR03594, GTPase_EngA, ribosome-associated GTPase | 1e-16 | |
| COG0486 | 454 | COG0486, ThdF, Predicted GTPase [General function | 2e-16 | |
| cd01895 | 174 | cd01895, EngA2, EngA2 GTPase contains the second d | 1e-15 | |
| PRK09518 | 712 | PRK09518, PRK09518, bifunctional cytidylate kinase | 7e-15 | |
| PRK00093 | 435 | PRK00093, PRK00093, GTP-binding protein Der; Revie | 2e-14 | |
| TIGR03918 | 391 | TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster | 3e-14 | |
| PRK05291 | 449 | PRK05291, trmE, tRNA modification GTPase TrmE; Rev | 1e-13 | |
| TIGR00450 | 442 | TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas | 3e-13 | |
| PRK03003 | 472 | PRK03003, PRK03003, GTP-binding protein Der; Revie | 5e-13 | |
| COG1160 | 444 | COG1160, COG1160, Predicted GTPases [General funct | 6e-11 | |
| COG1161 | 322 | COG1161, COG1161, Predicted GTPases [General funct | 1e-10 | |
| cd01856 | 171 | cd01856, YlqF, Circularly permuted YlqF GTPase | 2e-10 | |
| pfam02421 | 190 | pfam02421, FeoB_N, Ferrous iron transport protein | 4e-10 | |
| COG0218 | 200 | COG0218, COG0218, Predicted GTPase [General functi | 7e-10 | |
| COG0370 | 653 | COG0370, FeoB, Fe2+ transport system protein B [In | 1e-09 | |
| cd01879 | 159 | cd01879, FeoB, Ferrous iron transport protein B (F | 2e-09 | |
| COG1163 | 365 | COG1163, DRG, Predicted GTPase [General function p | 2e-09 | |
| TIGR03596 | 276 | TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi | 3e-09 | |
| cd01876 | 170 | cd01876, YihA_EngB, YihA (EngB) GTPase family | 4e-09 | |
| cd01898 | 170 | cd01898, Obg, Obg GTPase | 5e-09 | |
| PRK09563 | 287 | PRK09563, rbgA, GTPase YlqF; Reviewed | 8e-09 | |
| COG1100 | 219 | COG1100, COG1100, GTPase SAR1 and related small G | 3e-08 | |
| cd11383 | 140 | cd11383, YfjP, YfjP GTPase | 4e-08 | |
| TIGR02729 | 329 | TIGR02729, Obg_CgtA, Obg family GTPase CgtA | 5e-08 | |
| COG0536 | 369 | COG0536, Obg, Predicted GTPase [General function p | 7e-08 | |
| PRK09518 | 712 | PRK09518, PRK09518, bifunctional cytidylate kinase | 8e-08 | |
| COG1084 | 346 | COG1084, COG1084, Predicted GTPase [General functi | 2e-07 | |
| cd01896 | 233 | cd01896, DRG, Developmentally Regulated GTP-bindin | 2e-07 | |
| cd09912 | 180 | cd09912, DLP_2, Dynamin-like protein including dyn | 4e-07 | |
| TIGR03598 | 178 | TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi | 7e-07 | |
| PRK03003 | 472 | PRK03003, PRK03003, GTP-binding protein Der; Revie | 1e-06 | |
| TIGR00437 | 591 | TIGR00437, feoB, ferrous iron transporter FeoB | 2e-06 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 3e-06 | |
| COG2262 | 411 | COG2262, HflX, GTPases [General function predictio | 5e-06 | |
| PRK12299 | 335 | PRK12299, obgE, GTPase CgtA; Reviewed | 8e-06 | |
| PRK13796 | 365 | PRK13796, PRK13796, GTPase YqeH; Provisional | 1e-05 | |
| PRK00454 | 196 | PRK00454, engB, GTP-binding protein YsxC; Reviewed | 1e-05 | |
| cd01878 | 204 | cd01878, HflX, HflX GTPase family | 2e-05 | |
| cd00881 | 183 | cd00881, GTP_translation_factor, GTP translation f | 3e-05 | |
| cd04142 | 198 | cd04142, RRP22, Ras-related protein on chromosome | 4e-05 | |
| cd01855 | 191 | cd01855, YqeH, Circularly permuted YqeH GTPase | 4e-05 | |
| TIGR03156 | 351 | TIGR03156, GTP_HflX, GTP-binding protein HflX | 5e-05 | |
| PRK12297 | 424 | PRK12297, obgE, GTPase CgtA; Reviewed | 5e-05 | |
| TIGR03597 | 360 | TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase | 1e-04 | |
| cd00878 | 158 | cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf | 2e-04 | |
| cd01897 | 167 | cd01897, NOG, Nucleolar GTP-binding protein (NOG) | 4e-04 | |
| cd01881 | 167 | cd01881, Obg_like, Obg-like family of GTPases cons | 5e-04 | |
| COG3596 | 296 | COG3596, COG3596, Predicted GTPase [General functi | 8e-04 | |
| cd01857 | 140 | cd01857, HSR1_MMR1, A circularly permuted subfamil | 8e-04 | |
| cd01856 | 171 | cd01856, YlqF, Circularly permuted YlqF GTPase | 0.003 | |
| cd01853 | 248 | cd01853, Toc34_like, Translocon at the Outer-envel | 0.003 | |
| cd01859 | 157 | cd01859, MJ1464, An uncharacterized, circularly pe | 0.003 | |
| COG1161 | 322 | COG1161, COG1161, Predicted GTPases [General funct | 0.004 | |
| cd04155 | 174 | cd04155, Arl3, Arf-like 3 (Arl3) GTPase | 0.004 | |
| PRK04213 | 201 | PRK04213, PRK04213, GTP-binding protein; Provision | 0.004 |
| >gnl|CDD|206726 cd04163, Era, E | Back alignment and domain information |
|---|
Score = 178 bits (455), Expect = 8e-57
Identities = 64/136 (47%), Positives = 88/136 (64%), Gaps = 3/136 (2%)
Query: 113 HKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPG 172
KSG+VA++G+PNVGKSTL N ++GQK+SIV+ KPQTTR+RI GI + + Q+I DTPG
Sbjct: 1 FKSGFVAIIGRPNVGKSTLLNALVGQKISIVSPKPQTTRNRIRGIYTDDDAQIIFVDTPG 60
Query: 173 IIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLV 232
I + K L M+K SA + D ++ +VDA + DE + E + K K P++LV
Sbjct: 61 IHKPK-KKLGERMVKAAWSALKDVDLVLFVVDASEWIGEGDEFILELL--KKSKTPVILV 117
Query: 233 LNKKDLIKPGEIAKKL 248
LNK DL+K E L
Sbjct: 118 LNKIDLVKDKEDLLPL 133
|
coli Ras-like protein (Era) is a multifunctional GTPase. Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria. It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA. It also contacts several assembly elements of the 30S subunit. Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism. Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding. Both domains are important for Era function. Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA. Length = 168 |
| >gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era | Back alignment and domain information |
|---|
| >gnl|CDD|206646 cd00880, Era_like, E | Back alignment and domain information |
|---|
| >gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA | Back alignment and domain information |
|---|
| >gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA | Back alignment and domain information |
|---|
| >gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF | Back alignment and domain information |
|---|
| >gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B | Back alignment and domain information |
|---|
| >gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family | Back alignment and domain information |
|---|
| >gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family | Back alignment and domain information |
|---|
| >gnl|CDD|206685 cd01898, Obg, Obg GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206743 cd11383, YfjP, YfjP GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) | Back alignment and domain information |
|---|
| >gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237511 PRK13796, PRK13796, GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|206666 cd01878, HflX, HflX GTPase family | Back alignment and domain information |
|---|
| >gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors | Back alignment and domain information |
|---|
| >gnl|CDD|133342 cd04142, RRP22, Ras-related protein on chromosome 22 (RRP22) family | Back alignment and domain information |
|---|
| >gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX | Back alignment and domain information |
|---|
| >gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) | Back alignment and domain information |
|---|
| >gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|206652 cd01853, Toc34_like, Translocon at the Outer-envelope membrane of Chloroplasts 34-like (Toc34-like) | Back alignment and domain information |
|---|
| >gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 254 | |||
| COG1084 | 346 | Predicted GTPase [General function prediction only | 99.97 | |
| KOG1490 | 620 | consensus GTP-binding protein CRFG/NOG1 (ODN super | 99.93 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 99.9 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 99.86 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.85 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 99.85 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 99.83 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 99.83 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 99.8 | |
| KOG0084 | 205 | consensus GTPase Rab1/YPT1, small G protein superf | 99.8 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 99.79 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 99.78 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 99.78 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 99.78 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 99.77 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 99.76 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 99.76 | |
| KOG1191 | 531 | consensus Mitochondrial GTPase [Translation, ribos | 99.76 | |
| KOG0094 | 221 | consensus GTPase Rab6/YPT6/Ryh1, small G protein s | 99.76 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.76 | |
| KOG0092 | 200 | consensus GTPase Rab5/YPT51 and related small G pr | 99.75 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 99.75 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 99.75 | |
| KOG0098 | 216 | consensus GTPase Rab2, small G protein superfamily | 99.74 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 99.74 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 99.74 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 99.74 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 99.74 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 99.74 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 99.74 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.74 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 99.74 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 99.73 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 99.73 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 99.73 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.73 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 99.73 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 99.72 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 99.72 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 99.72 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 99.72 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 99.72 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 99.72 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 99.72 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 99.72 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 99.72 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.72 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 99.72 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 99.72 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 99.72 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 99.72 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 99.71 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 99.71 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 99.71 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 99.71 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 99.71 | |
| KOG0078 | 207 | consensus GTP-binding protein SEC4, small G protei | 99.71 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 99.71 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 99.71 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 99.71 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 99.71 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 99.71 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 99.71 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.71 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 99.71 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 99.71 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 99.71 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 99.71 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 99.71 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 99.71 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.71 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 99.71 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 99.71 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 99.71 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 99.71 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 99.7 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 99.7 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 99.7 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 99.7 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 99.7 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 99.7 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 99.7 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 99.7 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.7 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 99.7 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 99.7 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 99.7 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 99.7 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 99.7 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 99.7 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 99.7 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 99.7 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 99.7 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 99.7 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 99.7 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.7 | |
| KOG0087 | 222 | consensus GTPase Rab11/YPT3, small G protein super | 99.69 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 99.69 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 99.69 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 99.69 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 99.69 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 99.69 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 99.69 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 99.69 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 99.69 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 99.69 | |
| PLN03118 | 211 | Rab family protein; Provisional | 99.69 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 99.69 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 99.69 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 99.69 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 99.68 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 99.68 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 99.68 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 99.68 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 99.68 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 99.68 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 99.68 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 99.68 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 99.67 | |
| KOG0095 | 213 | consensus GTPase Rab30, small G protein superfamil | 99.67 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 99.67 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 99.67 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 99.67 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 99.67 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 99.67 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 99.67 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 99.67 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 99.67 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 99.67 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 99.66 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 99.66 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 99.66 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.66 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 99.66 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 99.66 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 99.66 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 99.65 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 99.65 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 99.65 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 99.65 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 99.65 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 99.65 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 99.65 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 99.65 | |
| KOG0394 | 210 | consensus Ras-related GTPase [General function pre | 99.65 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 99.65 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 99.64 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 99.64 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 99.64 | |
| KOG0080 | 209 | consensus GTPase Rab18, small G protein superfamil | 99.64 | |
| PLN03108 | 210 | Rab family protein; Provisional | 99.64 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 99.64 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 99.64 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 99.63 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 99.63 | |
| KOG0093 | 193 | consensus GTPase Rab3, small G protein superfamily | 99.63 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 99.63 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 99.63 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 99.63 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 99.63 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 99.63 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 99.62 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 99.61 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 99.61 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 99.61 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 99.6 | |
| KOG0079 | 198 | consensus GTP-binding protein H-ray, small G prote | 99.6 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 99.6 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 99.6 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 99.6 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 99.6 | |
| KOG0086 | 214 | consensus GTPase Rab4, small G protein superfamily | 99.6 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 99.59 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 99.58 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 99.58 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 99.57 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 99.57 | |
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 99.56 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 99.56 | |
| KOG0088 | 218 | consensus GTPase Rab21, small G protein superfamil | 99.56 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 99.55 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 99.55 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 99.55 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 99.55 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 99.55 | |
| KOG0395 | 196 | consensus Ras-related GTPase [General function pre | 99.54 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 99.53 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 99.53 | |
| KOG1489 | 366 | consensus Predicted GTP-binding protein (ODN super | 99.53 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 99.53 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 99.52 | |
| KOG0073 | 185 | consensus GTP-binding ADP-ribosylation factor-like | 99.52 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 99.52 | |
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 99.52 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 99.51 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 99.51 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 99.51 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 99.51 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 99.51 | |
| CHL00071 | 409 | tufA elongation factor Tu | 99.5 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 99.49 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 99.49 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 99.48 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 99.48 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 99.48 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 99.48 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 99.47 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 99.47 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 99.46 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 99.46 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 99.46 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 99.46 | |
| KOG0091 | 213 | consensus GTPase Rab39, small G protein superfamil | 99.45 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 99.45 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 99.45 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 99.45 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 99.44 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 99.44 | |
| KOG0075 | 186 | consensus GTP-binding ADP-ribosylation factor-like | 99.43 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 99.43 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 99.43 | |
| PF04670 | 232 | Gtr1_RagA: Gtr1/RagA G protein conserved region; I | 99.43 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 99.42 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 99.42 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 99.42 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 99.42 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 99.42 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 99.41 | |
| KOG0097 | 215 | consensus GTPase Rab14, small G protein superfamil | 99.41 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 99.41 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 99.4 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 99.4 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 99.4 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 99.39 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 99.38 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 99.37 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 99.37 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 99.37 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 99.37 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 99.36 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 99.36 | |
| KOG0070 | 181 | consensus GTP-binding ADP-ribosylation factor Arf1 | 99.36 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 99.35 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 99.34 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 99.34 | |
| KOG0393 | 198 | consensus Ras-related small GTPase, Rho type [Gene | 99.34 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 99.33 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 99.32 | |
| KOG0090 | 238 | consensus Signal recognition particle receptor, be | 99.31 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 99.31 | |
| KOG0083 | 192 | consensus GTPase Rab26/Rab37, small G protein supe | 99.3 | |
| KOG3883 | 198 | consensus Ras family small GTPase [Signal transduc | 99.3 | |
| KOG0074 | 185 | consensus GTP-binding ADP-ribosylation factor-like | 99.29 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 99.29 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 99.29 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 99.28 | |
| KOG0081 | 219 | consensus GTPase Rab27, small G protein superfamil | 99.28 | |
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 99.27 | |
| KOG0071 | 180 | consensus GTP-binding ADP-ribosylation factor Arf6 | 99.26 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 99.26 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 99.25 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 99.25 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 99.24 | |
| KOG4252 | 246 | consensus GTP-binding protein [Signal transduction | 99.21 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 99.21 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 99.2 | |
| KOG1954 | 532 | consensus Endocytosis/signaling protein EHD1 [Sign | 99.2 | |
| PTZ00258 | 390 | GTP-binding protein; Provisional | 99.18 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 99.18 | |
| cd01900 | 274 | YchF YchF subfamily. YchF is a member of the Obg f | 99.17 | |
| PRK09601 | 364 | GTP-binding protein YchF; Reviewed | 99.17 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 99.16 | |
| KOG0077 | 193 | consensus Vesicle coat complex COPII, GTPase subun | 99.16 | |
| KOG0076 | 197 | consensus GTP-binding ADP-ribosylation factor-like | 99.13 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 99.13 | |
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 99.11 | |
| KOG1145 | 683 | consensus Mitochondrial translation initiation fac | 99.1 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 99.09 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 99.08 | |
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 99.07 | |
| PTZ00099 | 176 | rab6; Provisional | 99.03 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 99.02 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 99.02 | |
| COG5019 | 373 | CDC3 Septin family protein [Cell division and chro | 99.02 | |
| KOG0462 | 650 | consensus Elongation factor-type GTP-binding prote | 99.0 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 98.98 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 98.97 | |
| PRK13768 | 253 | GTPase; Provisional | 98.96 | |
| KOG2655 | 366 | consensus Septin family protein (P-loop GTPase) [C | 98.96 | |
| KOG0410 | 410 | consensus Predicted GTP binding protein [General f | 98.92 | |
| KOG0096 | 216 | consensus GTPase Ran/TC4/GSP1 (nuclear protein tra | 98.92 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 98.91 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 98.91 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 98.91 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 98.88 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 98.88 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 98.86 | |
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 98.83 | |
| KOG2486 | 320 | consensus Predicted GTPase [General function predi | 98.82 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 98.81 | |
| KOG0468 | 971 | consensus U5 snRNP-specific protein [Translation, | 98.8 | |
| KOG3886 | 295 | consensus GTP-binding protein [Signal transduction | 98.79 | |
| KOG1486 | 364 | consensus GTP-binding protein DRG2 (ODN superfamil | 98.78 | |
| COG0012 | 372 | Predicted GTPase, probable translation factor [Tra | 98.76 | |
| cd01851 | 224 | GBP Guanylate-binding protein (GBP), N-terminal do | 98.74 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 98.73 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 98.72 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 98.71 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 98.69 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 98.69 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 98.69 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 98.69 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 98.68 | |
| KOG1673 | 205 | consensus Ras GTPases [General function prediction | 98.68 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 98.67 | |
| KOG0072 | 182 | consensus GTP-binding ADP-ribosylation factor-like | 98.66 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 98.64 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 98.63 | |
| TIGR00092 | 368 | GTP-binding protein YchF. This predicted GTP-bindi | 98.63 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 98.61 | |
| KOG0458 | 603 | consensus Elongation factor 1 alpha [Translation, | 98.61 | |
| cd00066 | 317 | G-alpha G protein alpha subunit. The alpha subunit | 98.59 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 98.57 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 98.54 | |
| smart00275 | 342 | G_alpha G protein alpha subunit. Subunit of G prot | 98.52 | |
| KOG0461 | 522 | consensus Selenocysteine-specific elongation facto | 98.51 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 98.51 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 98.49 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 98.49 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 98.46 | |
| TIGR03348 | 1169 | VI_IcmF type VI secretion protein IcmF. Members of | 98.45 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 98.44 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 98.43 | |
| KOG1491 | 391 | consensus Predicted GTP-binding protein (ODN super | 98.43 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 98.42 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 98.36 | |
| KOG0464 | 753 | consensus Elongation factor G [Translation, riboso | 98.34 | |
| KOG4423 | 229 | consensus GTP-binding protein-like, RAS superfamil | 98.34 | |
| KOG0447 | 980 | consensus Dynamin-like GTP binding protein [Genera | 98.33 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 98.32 | |
| KOG1424 | 562 | consensus Predicted GTP-binding protein MMR1 [Gene | 98.29 | |
| KOG3887 | 347 | consensus Predicted small GTPase involved in nucle | 98.28 | |
| KOG0448 | 749 | consensus Mitofusin 1 GTPase, involved in mitochon | 98.28 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 98.28 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 98.26 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 98.23 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 98.23 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 98.23 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 98.22 | |
| KOG0467 | 887 | consensus Translation elongation factor 2/ribosome | 98.2 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 98.18 | |
| KOG3859 | 406 | consensus Septins (P-loop GTPases) [Cell cycle con | 98.17 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 98.16 | |
| smart00010 | 124 | small_GTPase Small GTPase of the Ras superfamily; | 98.11 | |
| KOG2485 | 335 | consensus Conserved ATP/GTP binding protein [Gener | 98.09 | |
| KOG0465 | 721 | consensus Mitochondrial elongation factor [Transla | 98.08 | |
| KOG0082 | 354 | consensus G-protein alpha subunit (small G protein | 98.06 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.06 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 98.05 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 98.04 | |
| PF06858 | 58 | NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte | 98.04 | |
| KOG0460 | 449 | consensus Mitochondrial translation elongation fac | 98.04 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 98.04 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 98.03 | |
| KOG1487 | 358 | consensus GTP-binding protein DRG1 (ODN superfamil | 98.03 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 98.02 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 98.01 | |
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 97.98 | |
| COG0523 | 323 | Putative GTPases (G3E family) [General function pr | 97.92 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.91 | |
| KOG2423 | 572 | consensus Nucleolar GTPase [General function predi | 97.9 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 97.85 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.83 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 97.82 | |
| COG3523 | 1188 | IcmF Type VI protein secretion system component Va | 97.79 | |
| PRK11537 | 318 | putative GTP-binding protein YjiA; Provisional | 97.79 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 97.78 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 97.78 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.77 | |
| KOG2484 | 435 | consensus GTPase [General function prediction only | 97.75 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 97.74 | |
| TIGR02475 | 341 | CobW cobalamin biosynthesis protein CobW. A broade | 97.74 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 97.73 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.73 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 97.72 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 97.72 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 97.71 | |
| KOG1534 | 273 | consensus Putative transcription factor FET5 [Tran | 97.7 | |
| KOG2743 | 391 | consensus Cobalamin synthesis protein [Coenzyme tr | 97.67 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.67 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.62 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 97.62 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 97.61 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 97.58 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 97.56 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 97.54 | |
| KOG2484 | 435 | consensus GTPase [General function prediction only | 97.51 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 97.47 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 97.47 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.46 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 97.45 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.44 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.43 | |
| KOG1143 | 591 | consensus Predicted translation elongation factor | 97.42 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 97.42 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 97.39 | |
| KOG0466 | 466 | consensus Translation initiation factor 2, gamma s | 97.3 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 97.25 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 97.23 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 97.22 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 97.19 | |
| KOG3905 | 473 | consensus Dynein light intermediate chain [Cell mo | 97.19 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.12 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 97.09 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 97.08 | |
| KOG0469 | 842 | consensus Elongation factor 2 [Translation, riboso | 97.06 | |
| KOG0463 | 641 | consensus GTP-binding protein GP-1 [General functi | 97.04 | |
| KOG0446 | 657 | consensus Vacuolar sorting protein VPS1, dynamin, | 97.03 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.01 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 96.99 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 96.99 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 96.99 | |
| KOG0099 | 379 | consensus G protein subunit Galphas, small G prote | 96.95 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 96.89 | |
| KOG1424 | 562 | consensus Predicted GTP-binding protein MMR1 [Gene | 96.88 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 96.79 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 96.77 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 96.76 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 96.74 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 96.73 | |
| KOG2423 | 572 | consensus Nucleolar GTPase [General function predi | 96.73 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 96.72 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.71 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 96.71 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 96.69 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 96.69 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 96.66 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.64 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 96.63 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 96.59 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 96.56 | |
| PF00503 | 389 | G-alpha: G-protein alpha subunit; InterPro: IPR001 | 96.54 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 96.54 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 96.49 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.49 | |
| KOG0085 | 359 | consensus G protein subunit Galphaq/Galphay, small | 96.48 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 96.44 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 96.39 | |
| PRK13695 | 174 | putative NTPase; Provisional | 96.34 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 96.3 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 96.27 | |
| PF05729 | 166 | NACHT: NACHT domain | 96.25 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 96.24 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 96.24 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 96.21 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 96.19 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 96.19 | |
| PF09547 | 492 | Spore_IV_A: Stage IV sporulation protein A (spore_ | 96.13 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 96.13 | |
| KOG0459 | 501 | consensus Polypeptide release factor 3 [Translatio | 96.13 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.11 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 96.11 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 96.08 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 96.08 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 96.05 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 96.04 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 96.02 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.02 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 96.01 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 95.99 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 95.98 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 95.97 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 95.95 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.92 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 95.91 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 95.9 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 95.88 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 95.86 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 95.82 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 95.82 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 95.81 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 95.78 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 95.76 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 95.76 | |
| PF02263 | 260 | GBP: Guanylate-binding protein, N-terminal domain; | 95.75 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 95.75 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 95.75 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 95.74 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 95.73 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 95.72 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 95.69 | |
| PRK08181 | 269 | transposase; Validated | 95.69 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 95.67 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 95.67 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 95.66 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 95.65 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 95.65 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 95.64 | |
| PF05783 | 472 | DLIC: Dynein light intermediate chain (DLIC); Inte | 95.63 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 95.63 |
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.5e-31 Score=225.52 Aligned_cols=225 Identities=21% Similarity=0.253 Sum_probs=187.9
Q ss_pred cCCccccccCCcchhhhccccccCCceeeeeecccccccccchHHHHHHHHhhhc-ccccCCCCC-CC---CccChHhhh
Q 025346 10 SFGSLFPHYSTLTAYREIKFGFQGRSSSITCRSNEHQSLVLSEKEVQQQKLWSNQ-REMDLDDGD-EM---EFDDASSFL 84 (254)
Q Consensus 10 ~~~~~~p~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~d~~-~~---~~~~~~~~~ 84 (254)
.|++|||||++| ++..++.++++..++++..+. ....++...+ +.+...++. .. -....+++.
T Consensus 71 ~id~LhpFY~eL---idvl~d~d~~k~sLs~v~~A~---------~~i~~l~~eYi~~lk~a~~~~~~~~lrR~a~GR~a 138 (346)
T COG1084 71 SLDDLHPFYREL---IDVLVDIDHLKISLSAVSWAS---------KIIEKLAREYIRLLKAAKDPKEANQLRRQAFGRVA 138 (346)
T ss_pred CccccChHHHHH---HHHHhCHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHhcCCChhHHHHHHHHHHHHHH
Confidence 689999999999 999999999999999998766 4455555555 223333211 11 122346888
Q ss_pred hhccCCcCCCCCCCchhhhhccccCCCCCCCcEEEEEeCCCCChHHHHHHHhcCccccccCCCCceEEEEEEEEecCCee
Q 025346 85 SLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQ 164 (254)
Q Consensus 85 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~G~~~~gKssl~~~~~~~~~~~~~~~~~tt~~~~~~~~~~~~~~ 164 (254)
++.++....+.++.... .++...+..++..+.+++.|.||+|||||++++.+.+.. +.+||+||.....+++..+..+
T Consensus 139 Siik~i~~~L~fL~~~r-~~l~~LP~Idp~~pTivVaG~PNVGKSSlv~~lT~AkpE-vA~YPFTTK~i~vGhfe~~~~R 216 (346)
T COG1084 139 SIIKKIDDDLEFLRKAR-DHLKKLPAIDPDLPTIVVAGYPNVGKSSLVRKLTTAKPE-VAPYPFTTKGIHVGHFERGYLR 216 (346)
T ss_pred HHHHHhhHHHHHHHHHH-HHHhcCCCCCCCCCeEEEecCCCCcHHHHHHHHhcCCCc-cCCCCccccceeEeeeecCCce
Confidence 88888888888888886 888899999999999999999999999999999999876 8999999999999999999999
Q ss_pred EEEEecCCCcccchhhhhHHHHHHHHHHccCccEEEEEEeCCC----CchhHHHHHHHhhcccCCCCCEEEEEecCCCCC
Q 025346 165 MILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACK----APERIDEILEEGVGDHKDKLPILLVLNKKDLIK 240 (254)
Q Consensus 165 ~~liDtpG~~~~~~~~~~~~~~~~~~~~~~~~d~iv~vid~~~----~~~~~~~~~~~~~~~~~~~~piivV~nK~Dl~~ 240 (254)
++++||||+.+.+.+.++...+++..+..+..++|+|++|.+. +.+.+...+.++...+ +.|+++|+||+|..+
T Consensus 217 ~QvIDTPGlLDRPl~ErN~IE~qAi~AL~hl~~~IlF~~D~Se~cgy~lE~Q~~L~~eIk~~f--~~p~v~V~nK~D~~~ 294 (346)
T COG1084 217 IQVIDTPGLLDRPLEERNEIERQAILALRHLAGVILFLFDPSETCGYSLEEQISLLEEIKELF--KAPIVVVINKIDIAD 294 (346)
T ss_pred EEEecCCcccCCChHHhcHHHHHHHHHHHHhcCeEEEEEcCccccCCCHHHHHHHHHHHHHhc--CCCeEEEEecccccc
Confidence 9999999999999999999999999999999999999999987 3455566666666654 389999999999998
Q ss_pred hHhHHHHHHH
Q 025346 241 PGEIAKKLEV 250 (254)
Q Consensus 241 ~~~~~~~~~~ 250 (254)
.+.+++....
T Consensus 295 ~e~~~~~~~~ 304 (346)
T COG1084 295 EEKLEEIEAS 304 (346)
T ss_pred hhHHHHHHHH
Confidence 8877766544
|
|
| >KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >KOG0394 consensus Ras-related GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >KOG0395 consensus Ras-related GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
| >KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01900 YchF YchF subfamily | Back alignment and domain information |
|---|
| >PRK09601 GTP-binding protein YchF; Reviewed | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0410 consensus Predicted GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2486 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >KOG1673 consensus Ras GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00092 GTP-binding protein YchF | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00066 G-alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00275 G_alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >TIGR03348 VI_IcmF type VI secretion protein IcmF | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily | Back alignment and domain information |
|---|
| >KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) | Back alignment and domain information |
|---|
| >KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0523 Putative GTPases (G3E family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2423 consensus Nucleolar GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11537 putative GTP-binding protein YjiA; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2484 consensus GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >TIGR02475 CobW cobalamin biosynthesis protein CobW | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >KOG1534 consensus Putative transcription factor FET5 [Transcription] | Back alignment and domain information |
|---|
| >KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >KOG2484 consensus GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG3905 consensus Dynein light intermediate chain [Cell motility] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >KOG2423 consensus Nucleolar GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 254 | ||||
| 1wf3_A | 301 | Crystal Structure Of Gtp-Binding Protein Tt1341 Fro | 5e-20 | ||
| 1x18_X | 292 | Contact Sites Of Era Gtpase On The Thermus Thermoph | 3e-19 | ||
| 3r9w_A | 307 | Crystal Structure Of Era In Complex With Mggdpnp An | 4e-19 | ||
| 3iev_A | 308 | Crystal Structure Of Era In Complex With Mggnp And | 4e-19 | ||
| 1ega_A | 301 | Crystal Structure Of A Widely Conserved Gtpase Era | 4e-19 | ||
| 2hjg_A | 436 | The Crystal Structure Of The B. Subtilis Yphc Gtpas | 5e-11 | ||
| 4dcs_A | 456 | Crystal Structure Of B. Subtilis Enga In Complex Wi | 5e-11 | ||
| 3k53_A | 271 | Crystal Structure Of Nfeob From P. Furiosus Length | 1e-09 | ||
| 3geh_A | 462 | Crystal Structure Of Mnme From Nostoc In Complex Wi | 7e-09 | ||
| 3qq5_A | 423 | Crystal Structure Of The [fefe]-Hydrogenase Maturat | 1e-07 | ||
| 1xzp_A | 482 | Structure Of The Gtp-Binding Protein Trme From Ther | 8e-07 | ||
| 2e87_A | 357 | Crystal Structure Of Hypothetical Gtp-Binding Prote | 1e-06 | ||
| 1mky_A | 439 | Structural Analysis Of The Domain Interactions In D | 1e-06 | ||
| 3gee_A | 476 | Crystal Structure Of Mnme From Chlorobium Tepidum I | 1e-06 | ||
| 3t5g_A | 181 | Structure Of Fully Modified Farnesylated Rheb In Co | 4e-06 | ||
| 1xtq_A | 177 | Structure Of Small Gtpase Human Rheb In Complex Wit | 4e-06 | ||
| 2dyk_A | 161 | Crystal Structure Of N-Terminal Gtp-Binding Domain | 1e-05 | ||
| 3sea_A | 167 | Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo | 2e-05 | ||
| 3a1t_A | 258 | Crystal Structue Of The Cytosolic Domain Of T. Mari | 4e-05 | ||
| 3a1s_A | 258 | Crystal Structue Of The Cytosolic Domain Of T. Mari | 5e-05 | ||
| 3a1w_A | 168 | Crystal Structue Of The G Domain Of T. Maritima Feo | 5e-05 | ||
| 2l0x_A | 169 | Solution Structure Of The 21 Kda Gtpase Rheb Bound | 7e-05 | ||
| 2gj9_A | 172 | Structure Of The Mnme G-Domain In Complex With GdpA | 7e-05 | ||
| 1rfl_A | 172 | Nmr Data Driven Structural Model Of G-Domain Of Mnm | 8e-05 | ||
| 2gj8_A | 172 | Structure Of The Mnme G-domain In Complex With Gdp* | 9e-05 | ||
| 2wjg_A | 188 | Structure And Function Of The Feob G-Domain From Me | 2e-04 | ||
| 2wjj_A | 168 | Structure And Function Of The Feob G-Domain From Me | 2e-04 | ||
| 2wji_A | 165 | Structure And Function Of The Feob G-Domain From Me | 2e-04 | ||
| 2wjh_A | 166 | Structure And Function Of The Feob G-Domain From Me | 2e-04 |
| >pdb|1WF3|A Chain A, Crystal Structure Of Gtp-Binding Protein Tt1341 From Thermus Thermophilus Hb8 Length = 301 | Back alignment and structure |
|
| >pdb|1X18|X Chain X, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 292 | Back alignment and structure |
| >pdb|3R9W|A Chain A, Crystal Structure Of Era In Complex With Mggdpnp And Nucleotides 1506- 1542 Of 16s Ribosomal Rna Length = 307 | Back alignment and structure |
| >pdb|3IEV|A Chain A, Crystal Structure Of Era In Complex With Mggnp And The 3' End Of 16s Rrna Length = 308 | Back alignment and structure |
| >pdb|1EGA|A Chain A, Crystal Structure Of A Widely Conserved Gtpase Era Length = 301 | Back alignment and structure |
| >pdb|2HJG|A Chain A, The Crystal Structure Of The B. Subtilis Yphc Gtpase In Complex With Gdp Length = 436 | Back alignment and structure |
| >pdb|4DCS|A Chain A, Crystal Structure Of B. Subtilis Enga In Complex With Sulfate Ion And Gdp Length = 456 | Back alignment and structure |
| >pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 | Back alignment and structure |
| >pdb|3GEH|A Chain A, Crystal Structure Of Mnme From Nostoc In Complex With Gdp, Folinic Acid And Zn Length = 462 | Back alignment and structure |
| >pdb|3QQ5|A Chain A, Crystal Structure Of The [fefe]-Hydrogenase Maturation Protein Hydf Length = 423 | Back alignment and structure |
| >pdb|1XZP|A Chain A, Structure Of The Gtp-Binding Protein Trme From Thermotoga Maritima Length = 482 | Back alignment and structure |
| >pdb|2E87|A Chain A, Crystal Structure Of Hypothetical Gtp-Binding Protein Ph1320 From Pyrococcus Horikoshii Ot3, In Complex With Gdp Length = 357 | Back alignment and structure |
| >pdb|1MKY|A Chain A, Structural Analysis Of The Domain Interactions In Der, A Switch Protein Containing Two Gtpase Domains Length = 439 | Back alignment and structure |
| >pdb|3GEE|A Chain A, Crystal Structure Of Mnme From Chlorobium Tepidum In Complex With Gdp And Folinic Acid Length = 476 | Back alignment and structure |
| >pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 | Back alignment and structure |
| >pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 | Back alignment and structure |
| >pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 | Back alignment and structure |
| >pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 | Back alignment and structure |
| >pdb|3A1T|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form Ii Length = 258 | Back alignment and structure |
| >pdb|3A1S|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form I Length = 258 | Back alignment and structure |
| >pdb|3A1W|A Chain A, Crystal Structue Of The G Domain Of T. Maritima Feob Iron Iransporter Length = 168 | Back alignment and structure |
| >pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 | Back alignment and structure |
| >pdb|2GJ9|A Chain A, Structure Of The Mnme G-Domain In Complex With GdpAlf4-, Mg2+ And Rb+ Length = 172 | Back alignment and structure |
| >pdb|1RFL|A Chain A, Nmr Data Driven Structural Model Of G-Domain Of Mnme Protein Length = 172 | Back alignment and structure |
| >pdb|2GJ8|A Chain A, Structure Of The Mnme G-domain In Complex With Gdp*alf4-, Mg2+ And K+ Length = 172 | Back alignment and structure |
| >pdb|2WJG|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 188 | Back alignment and structure |
| >pdb|2WJJ|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 168 | Back alignment and structure |
| >pdb|2WJI|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 165 | Back alignment and structure |
| >pdb|2WJH|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 166 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 254 | |||
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 2e-55 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 9e-55 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 1e-53 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 2e-41 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 5e-23 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 1e-19 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 2e-19 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 7e-14 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 2e-18 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 4e-14 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 2e-17 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 6e-16 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 5e-14 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 9e-14 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 2e-13 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 3e-13 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 8e-13 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 2e-11 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 3e-11 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 8e-11 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 3e-10 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 8e-10 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 1e-08 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 3e-08 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 4e-08 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 7e-08 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 1e-07 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 2e-07 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 2e-07 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 4e-07 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 4e-07 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 4e-07 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 5e-07 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 6e-07 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 9e-07 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 5e-04 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 3e-06 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 4e-06 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 4e-06 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 5e-06 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 7e-06 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 8e-06 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 9e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 2e-05 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 1e-04 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 2e-04 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 5e-04 |
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 | Back alignment and structure |
|---|
Score = 178 bits (455), Expect = 2e-55
Identities = 51/132 (38%), Positives = 76/132 (57%), Gaps = 1/132 (0%)
Query: 112 NHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTP 171
SG+VA++GKPNVGKSTL N ++G K++ ++ +PQTTR R+ GI + Q++ DTP
Sbjct: 4 KTYSGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGRRQIVFVDTP 63
Query: 172 GIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILL 231
G+ + L M + V A + + +V +VD P DE++ + K+PILL
Sbjct: 64 GLHKPM-DALGEFMDQEVYEALADVNAVVWVVDLRHPPTPEDELVARALKPLVGKVPILL 122
Query: 232 VLNKKDLIKPGE 243
V NK D K E
Sbjct: 123 VGNKLDAAKYPE 134
|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Length = 416 | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Length = 342 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Length = 262 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 254 | |||
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 99.85 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 99.82 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 99.81 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 99.8 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 99.8 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 99.79 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.78 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 99.78 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 99.77 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 99.77 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 99.77 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 99.77 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 99.76 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 99.76 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.76 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 99.76 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 99.75 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 99.75 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 99.75 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 99.75 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.75 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 99.75 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 99.74 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 99.74 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 99.74 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 99.74 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 99.74 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 99.74 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 99.74 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 99.74 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 99.74 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 99.74 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 99.74 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 99.74 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 99.73 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 99.73 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 99.73 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 99.73 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 99.73 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 99.73 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 99.73 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 99.73 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 99.73 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 99.73 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 99.73 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 99.73 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 99.73 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 99.73 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 99.73 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 99.73 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 99.73 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 99.73 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 99.73 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 99.73 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 99.73 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 99.72 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 99.72 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 99.72 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 99.72 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 99.72 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 99.72 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 99.72 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 99.72 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 99.72 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 99.72 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 99.72 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 99.72 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 99.72 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 99.72 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 99.71 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 99.71 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 99.71 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 99.71 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 99.71 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 99.71 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 99.71 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 99.71 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 99.71 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 99.71 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 99.71 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 99.71 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 99.71 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 99.7 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 99.7 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 99.7 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 99.7 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 99.7 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 99.7 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 99.7 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 99.7 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 99.7 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 99.7 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 99.7 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 99.7 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 99.7 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 99.7 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 99.7 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 99.7 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 99.7 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 99.7 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.7 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 99.7 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 99.69 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 99.69 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 99.69 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 99.69 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 99.69 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 99.69 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 99.69 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 99.69 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 99.69 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 99.69 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 99.69 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 99.69 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 99.69 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 99.69 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 99.68 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 99.68 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 99.68 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 99.68 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 99.67 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 99.67 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 99.67 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 99.67 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 99.66 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 99.66 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 99.66 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.66 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 99.66 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 99.66 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 99.65 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 99.64 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 99.63 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 99.63 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.63 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 99.63 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.62 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 99.62 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 99.61 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 99.61 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 99.61 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 99.6 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 99.39 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 99.6 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 99.59 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 99.59 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 99.59 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 99.57 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 99.56 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 99.56 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.54 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 99.54 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 99.54 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 99.54 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 99.54 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 99.52 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 99.51 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 99.51 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 99.51 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 99.5 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 99.5 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 99.49 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 99.49 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 99.49 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 99.48 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.48 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 99.48 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 99.48 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 99.47 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 99.47 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.45 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 99.44 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 99.44 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 99.44 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 99.43 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 99.42 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 99.42 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 99.41 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 99.38 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 99.37 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 99.37 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 99.35 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 99.34 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 99.34 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 99.32 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 99.31 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 99.3 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 99.3 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 99.24 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 99.24 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 99.22 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 99.21 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 99.2 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 99.2 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 99.2 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 99.18 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 99.15 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 99.15 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 99.09 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 99.08 | |
| 4fid_A | 340 | G protein alpha subunit; RAS-like domain, all-heli | 99.08 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 99.02 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 99.01 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 98.97 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 98.96 | |
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 98.94 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 98.93 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 98.92 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 98.74 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 98.73 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 98.6 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 98.48 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 98.48 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 98.47 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 98.45 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 98.44 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 98.35 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 98.35 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 98.34 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 98.34 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 98.26 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 98.09 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 97.87 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.85 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 97.81 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.65 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 97.57 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.55 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.54 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.46 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.44 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.27 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 97.24 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 97.2 | |
| 3l82_B | 227 | F-box only protein 4; TRFH domain, helix, GTPase d | 97.18 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.13 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.08 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 97.07 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.99 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 96.91 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 96.89 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 96.8 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.76 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 96.68 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 96.68 | |
| 4ido_A | 457 | Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE | 96.67 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.62 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 96.62 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 96.61 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 96.56 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 96.56 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 96.47 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 96.43 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 96.42 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.34 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 96.33 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 96.32 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 96.32 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 96.3 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 96.28 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 96.27 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 96.22 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.19 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 96.18 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.13 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 96.12 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.04 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 95.99 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 95.97 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 95.97 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.94 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 95.94 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 95.91 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 95.88 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 95.88 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.86 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 95.84 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 95.84 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 95.81 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.8 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 95.79 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 95.78 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 95.77 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 95.75 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 95.75 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 95.74 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 95.74 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 95.72 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 95.72 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 95.71 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.71 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 95.69 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 95.68 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 95.68 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 95.67 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 95.64 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 95.63 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 95.61 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 95.6 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 95.6 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 95.59 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 95.58 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 95.55 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 95.54 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 95.54 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 95.52 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 95.51 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 95.51 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 95.5 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 95.48 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 95.47 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 95.46 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 95.46 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 95.43 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 95.42 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 95.42 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 95.41 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 95.4 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 95.39 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 95.38 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 95.36 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.34 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 95.34 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.32 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 95.32 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 95.31 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 95.3 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 95.29 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 95.25 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.25 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 95.23 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 95.23 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.21 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 95.2 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 95.2 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 95.19 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.17 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 95.16 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 95.15 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.14 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 95.14 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 95.14 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 95.1 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 95.09 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 95.08 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 95.08 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 95.08 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 95.07 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 95.05 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 95.04 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 95.02 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 95.01 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 95.0 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 94.99 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 94.98 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 94.97 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.96 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 94.95 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.95 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 94.94 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 94.91 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 94.91 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 94.89 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 94.89 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 94.87 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 94.86 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 94.83 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 94.82 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 94.82 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 94.81 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 94.79 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.79 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 94.78 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 94.77 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 94.74 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 94.72 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 94.71 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 94.69 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 94.65 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 94.64 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 94.64 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 94.64 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 94.64 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 94.64 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 94.64 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.63 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 94.62 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 94.6 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 94.59 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 94.58 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 94.58 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.55 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 94.53 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.45 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 94.45 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 94.42 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 94.38 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 94.34 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 94.34 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 94.32 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 94.31 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 94.29 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 94.29 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 94.28 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 94.28 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 94.27 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 94.26 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.25 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 94.22 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 94.18 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 94.15 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 94.14 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 94.13 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 94.13 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 94.13 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 94.12 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 94.11 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 94.06 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.04 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 94.04 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 94.02 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 94.01 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 94.0 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 93.98 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 93.95 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 93.86 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 93.85 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 93.84 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 93.81 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 93.8 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 93.8 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 93.79 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 93.79 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 93.77 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 93.76 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 93.76 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 93.75 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 93.72 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 93.68 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 93.67 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 93.67 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 93.67 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 93.62 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.61 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 93.6 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 93.56 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 93.54 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.51 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 93.51 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.44 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 93.35 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 93.29 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 93.26 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 93.24 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 93.17 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 93.07 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 93.03 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 93.01 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 92.92 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 92.91 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 92.85 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 92.83 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 92.81 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 92.74 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 92.71 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 92.68 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 92.68 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 92.68 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 92.65 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 92.64 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 92.53 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 92.52 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 92.51 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 92.47 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.41 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 92.36 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 92.35 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 92.33 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 92.21 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 92.21 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 92.17 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 92.11 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 92.08 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 92.05 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.99 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 91.92 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 91.91 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 91.86 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 91.82 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.79 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 91.78 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 91.76 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 91.7 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 91.62 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 91.62 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 91.57 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 91.56 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 91.54 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.27 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 91.26 |
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
Probab=99.85 E-value=2.2e-20 Score=160.74 Aligned_cols=133 Identities=39% Similarity=0.567 Sum_probs=107.0
Q ss_pred CCCcEEEEEeCCCCChHHHHHHHhcCccccccCCCCceEEEEEEEEecCCeeEEEEecCCCcccchhhhhHHHHHHHHHH
Q 025346 113 HKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSA 192 (254)
Q Consensus 113 ~~~~~~~~~G~~~~gKssl~~~~~~~~~~~~~~~~~tt~~~~~~~~~~~~~~~~liDtpG~~~~~~~~~~~~~~~~~~~~ 192 (254)
.+..+++++|.+|+|||||+|++++.++..+++.++||+....+.....+.++.+|||||+.... ..+...+......+
T Consensus 5 ~~~g~V~ivG~~nvGKSTLln~l~g~~~~ivs~~~~tTr~~i~~i~~~~~~~l~l~DTpG~~~~~-~~l~~~~~~~~~~~ 83 (301)
T 1wf3_A 5 TYSGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGRRQIVFVDTPGLHKPM-DALGEFMDQEVYEA 83 (301)
T ss_dssp CEEEEEEEECSTTSSHHHHHHHHHTSCCSCCCSSSCCCCSCEEEEEEETTEEEEEEECCCCCCCC-SHHHHHHHHHHHHH
T ss_pred ccCCEEEEECCCCCCHHHHHHHHhCCceeeecCCCCceeEEEEEEEEeCCcEEEEecCccccchh-hHHHHHHHHHHHHH
Confidence 34568999999999999999999999988788888899887777777888999999999986543 34555566677788
Q ss_pred ccCccEEEEEEeCCCCchhHHHHHHHhhcccCCCCCEEEEEecCCCCChHh-HHH
Q 025346 193 GINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGE-IAK 246 (254)
Q Consensus 193 ~~~~d~iv~vid~~~~~~~~~~~~~~~~~~~~~~~piivV~nK~Dl~~~~~-~~~ 246 (254)
+..+|++++|+|+++.......++...+.....+.|+++|+||+|+...+. +.+
T Consensus 84 l~~ad~il~VvD~~~~~~~~~~~i~~~l~~~~~~~p~ilV~NK~Dl~~~~~~~~~ 138 (301)
T 1wf3_A 84 LADVNAVVWVVDLRHPPTPEDELVARALKPLVGKVPILLVGNKLDAAKYPEEAMK 138 (301)
T ss_dssp TSSCSEEEEEEETTSCCCHHHHHHHHHHGGGTTTSCEEEEEECGGGCSSHHHHHH
T ss_pred HhcCCEEEEEEECCCCCChHHHHHHHHHHhhcCCCCEEEEEECcccCCchHHHHH
Confidence 999999999999998776666666544443334799999999999987665 433
|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 254 | ||||
| d1egaa1 | 179 | c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { | 2e-20 | |
| d1xzpa2 | 160 | c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog | 7e-17 | |
| d1udxa2 | 180 | c.37.1.8 (A:157-336) Obg GTP-binding protein middl | 5e-14 | |
| d1lnza2 | 185 | c.37.1.8 (A:158-342) Obg GTP-binding protein middl | 1e-13 | |
| d1h65a_ | 257 | c.37.1.8 (A:) Chloroplast protein translocon GTPas | 3e-13 | |
| d1tq4a_ | 400 | c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( | 3e-13 | |
| d1wf3a1 | 178 | c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { | 5e-13 | |
| d2cxxa1 | 184 | c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc | 2e-12 | |
| d1mkya1 | 171 | c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal | 7e-12 | |
| d2gj8a1 | 161 | c.37.1.8 (A:216-376) Probable tRNA modification GT | 5e-11 | |
| d1mkya2 | 186 | c.37.1.8 (A:173-358) Probable GTPase Der, N-termin | 6e-11 | |
| d1nrjb_ | 209 | c.37.1.8 (B:) Signal recognition particle receptor | 2e-10 | |
| d1puia_ | 188 | c.37.1.8 (A:) Probable GTPase EngB {Escherichia co | 1e-08 | |
| d1svia_ | 195 | c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti | 2e-08 | |
| d2fh5b1 | 207 | c.37.1.8 (B:63-269) Signal recognition particle re | 4e-07 | |
| d1puja_ | 273 | c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti | 6e-07 | |
| d2f9la1 | 175 | c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T | 2e-06 | |
| d2qtvb1 | 166 | c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom | 2e-06 | |
| d1u0la2 | 225 | c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C | 2e-06 | |
| d1wxqa1 | 319 | c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr | 6e-06 | |
| d1f6ba_ | 186 | c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr | 3e-05 | |
| d2fu5c1 | 173 | c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta | 3e-05 | |
| d1g7sa4 | 227 | c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- | 4e-05 | |
| d2bmea1 | 174 | c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta | 5e-05 | |
| d1ksha_ | 165 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 1e-04 | |
| d1mh1a_ | 183 | c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 | 1e-04 | |
| d2bcgy1 | 194 | c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac | 1e-04 | |
| d1zd9a1 | 164 | c.37.1.8 (A:18-181) ADP-ribosylation factor {Human | 1e-04 | |
| d3raba_ | 169 | c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI | 1e-04 | |
| d1u8za_ | 168 | c.37.1.8 (A:) Ras-related protein RalA {Cotton-top | 1e-04 | |
| d1kaoa_ | 167 | c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: | 2e-04 | |
| d2a5ja1 | 173 | c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta | 2e-04 | |
| d1t9ha2 | 231 | c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C | 2e-04 | |
| d1g16a_ | 166 | c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye | 3e-04 | |
| d1fzqa_ | 176 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 4e-04 | |
| d2ngra_ | 191 | c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: | 5e-04 | |
| d1ni3a1 | 296 | c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter | 6e-04 | |
| d1z0fa1 | 166 | c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta | 7e-04 | |
| d1x3sa1 | 177 | c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta | 8e-04 | |
| d1ly1a_ | 152 | c.37.1.1 (A:) Polynucleotide kinase, kinase domain | 8e-04 | |
| d2ew1a1 | 171 | c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta | 9e-04 | |
| d2g6ba1 | 170 | c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T | 0.001 | |
| d1ctqa_ | 166 | c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi | 0.001 | |
| d2g3ya1 | 172 | c.37.1.8 (A:73-244) GTP-binding protein GEM {Human | 0.001 | |
| d1vg8a_ | 184 | c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId | 0.002 | |
| d2atxa1 | 185 | c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax | 0.002 | |
| d1ky3a_ | 175 | c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y | 0.002 | |
| d2c78a3 | 204 | c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N | 0.002 | |
| d2erxa1 | 171 | c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ | 0.002 | |
| d1wmsa_ | 174 | c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: | 0.002 | |
| d1upta_ | 169 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 0.003 | |
| d1r8sa_ | 160 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 0.004 |
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: GTPase Era, N-terminal domain species: Escherichia coli [TaxId: 562]
Score = 83.2 bits (204), Expect = 2e-20
Identities = 45/132 (34%), Positives = 80/132 (60%), Gaps = 3/132 (2%)
Query: 112 NHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTP 171
G++A++G+PNVGKSTL N+++GQK+SI + K QTTRHRI+GI + YQ I DTP
Sbjct: 2 KSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYVDTP 61
Query: 172 GIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILL 231
G+ ++ ++ +M K S+ + + ++ +V+ + + +L + + K P++L
Sbjct: 62 GLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNK---LREGKAPVIL 118
Query: 232 VLNKKDLIKPGE 243
+NK D ++
Sbjct: 119 AVNKVDNVQEKA 130
|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 254 | |||
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 99.86 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 99.79 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 99.78 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 99.76 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 99.74 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 99.74 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 99.74 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 99.74 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 99.73 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.73 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 99.73 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 99.72 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.71 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 99.71 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 99.71 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 99.71 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 99.7 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 99.7 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 99.7 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 99.69 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 99.69 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 99.69 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 99.68 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 99.68 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 99.68 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 99.67 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 99.67 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 99.67 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 99.66 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 99.66 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 99.64 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 99.64 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 99.63 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.63 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.63 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 99.62 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 99.62 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 99.62 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 99.61 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 99.6 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 99.59 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.59 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 99.55 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.51 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 99.51 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 99.49 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.46 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 99.45 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.44 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.42 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 99.4 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 99.39 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.39 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 99.38 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.38 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 99.37 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 99.35 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.33 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 99.32 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 99.27 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 99.27 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 99.24 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 99.21 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 99.18 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 99.15 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 99.11 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 99.03 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 99.02 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 98.88 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 98.83 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 98.66 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 98.35 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 98.35 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.13 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 98.11 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 98.1 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 98.09 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 98.07 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 98.03 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 97.96 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.89 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 97.44 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.23 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.21 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.86 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.85 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.81 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.79 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.72 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.7 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.67 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 96.63 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.59 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 96.58 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 96.55 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.51 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.46 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.41 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.36 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 96.35 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.28 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.19 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.18 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.17 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.16 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 96.16 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.13 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.12 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.12 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.09 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.08 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.06 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 96.06 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 96.05 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 96.05 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 96.04 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.02 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 95.98 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.96 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 95.9 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 95.87 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.84 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 95.84 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.82 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.71 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.71 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.69 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.69 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 95.65 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.62 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 95.62 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 95.61 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.59 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 95.56 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 95.56 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 95.55 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.55 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.55 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.52 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 95.49 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.48 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 95.46 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 95.37 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 95.31 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.31 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 95.23 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 95.2 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.2 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 95.19 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.15 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.09 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.05 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 94.96 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 94.92 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.84 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 94.82 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 94.82 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 94.78 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.6 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.46 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.37 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 94.31 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 94.23 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 94.19 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.15 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 93.97 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 93.69 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.64 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 93.58 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 93.49 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.39 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 93.35 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 93.32 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 93.2 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 93.19 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.07 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 92.97 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 92.75 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 92.53 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 92.47 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 92.39 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 92.26 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 92.22 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 92.19 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 92.17 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 91.9 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 91.89 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 91.79 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 91.75 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 91.66 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 91.54 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 91.35 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 91.34 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 91.3 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 90.38 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 90.27 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 90.18 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 90.14 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 89.98 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 89.64 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 89.32 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 89.3 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 89.27 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 89.21 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 89.15 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 89.09 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 89.06 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 88.89 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 88.76 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 88.65 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 88.63 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 88.02 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 87.92 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 87.65 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 87.3 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 86.89 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 86.86 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 86.41 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 86.1 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 85.37 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 85.28 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 84.89 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 84.0 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 82.26 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 82.25 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 81.52 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 80.79 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 80.62 |
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: GTPase Era, N-terminal domain species: Thermus thermophilus [TaxId: 274]
Probab=99.86 E-value=3.9e-21 Score=150.97 Aligned_cols=128 Identities=40% Similarity=0.591 Sum_probs=105.6
Q ss_pred CcEEEEEeCCCCChHHHHHHHhcCccccccCCCCceEEEEEEEEecCCeeEEEEecCCCcccchhhhhHHHHHHHHHHcc
Q 025346 115 SGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGI 194 (254)
Q Consensus 115 ~~~~~~~G~~~~gKssl~~~~~~~~~~~~~~~~~tt~~~~~~~~~~~~~~~~liDtpG~~~~~~~~~~~~~~~~~~~~~~ 194 (254)
...|+++|.+|+|||||+|++++.+...++..+++|...........+..+.++||||+.... ......+...+...+.
T Consensus 5 ~~~I~lvG~~~~GKSSLin~l~~~~~~~~~~~~~tt~~~~~~~~~~~~~~~~~~DtpG~~~~~-~~~~~~~~~~~~~~~~ 83 (178)
T d1wf3a1 5 SGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGRRQIVFVDTPGLHKPM-DALGEFMDQEVYEALA 83 (178)
T ss_dssp EEEEEEECSTTSSHHHHHHHHHTSCCSCCCSSSCCCCSCEEEEEEETTEEEEEEECCCCCCCC-SHHHHHHHHHHHHHTS
T ss_pred CcEEEEECCCCCCHHHHHHHHhCCCceeecccCCcccccccceeeeeeeeeeecccccccccc-cccchhcccccccccc
Confidence 347999999999999999999999877788889999888888788888999999999975543 3333444566667789
Q ss_pred CccEEEEEEeCCCCchhHHHHHHHhhcccCCCCCEEEEEecCCCCChHh
Q 025346 195 NADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGE 243 (254)
Q Consensus 195 ~~d~iv~vid~~~~~~~~~~~~~~~~~~~~~~~piivV~nK~Dl~~~~~ 243 (254)
.+|++++|+|++++......++...++....+.|+++|+||+|+....+
T Consensus 84 ~ad~il~v~D~~~~~~~~~~~i~~~l~~~~~~~piilv~NK~Dl~~~~~ 132 (178)
T d1wf3a1 84 DVNAVVWVVDLRHPPTPEDELVARALKPLVGKVPILLVGNKLDAAKYPE 132 (178)
T ss_dssp SCSEEEEEEETTSCCCHHHHHHHHHHGGGTTTSCEEEEEECGGGCSSHH
T ss_pred cccceeeeechhhhhcccccchhhheeccccchhhhhhhcccccccCHH
Confidence 9999999999999887777777777766667899999999999987543
|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|