Citrus Sinensis ID: 025526
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 251 | ||||||
| 224138834 | 339 | predicted protein [Populus trichocarpa] | 0.884 | 0.654 | 0.776 | 4e-94 | |
| 255578930 | 312 | Membrane-associated 30 kDa protein, chlo | 0.872 | 0.701 | 0.776 | 1e-90 | |
| 363807044 | 323 | uncharacterized protein LOC100781742 [Gl | 0.912 | 0.708 | 0.747 | 5e-88 | |
| 363806682 | 322 | uncharacterized protein LOC100818209 [Gl | 0.908 | 0.708 | 0.743 | 4e-87 | |
| 449468854 | 332 | PREDICTED: membrane-associated 30 kDa pr | 0.956 | 0.722 | 0.702 | 3e-84 | |
| 225430912 | 324 | PREDICTED: probable membrane-associated | 0.920 | 0.712 | 0.692 | 2e-82 | |
| 359478255 | 314 | PREDICTED: membrane-associated 30 kDa pr | 0.800 | 0.640 | 0.716 | 4e-81 | |
| 729842 | 323 | RecName: Full=Membrane-associated 30 kDa | 0.896 | 0.696 | 0.690 | 1e-79 | |
| 388510656 | 326 | unknown [Lotus japonicus] | 0.924 | 0.711 | 0.698 | 5e-79 | |
| 147795803 | 465 | hypothetical protein VITISV_012616 [Viti | 0.828 | 0.447 | 0.686 | 2e-76 |
| >gi|224138834|ref|XP_002322913.1| predicted protein [Populus trichocarpa] gi|222867543|gb|EEF04674.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 350 bits (897), Expect = 4e-94, Method: Compositional matrix adjust.
Identities = 177/228 (77%), Positives = 199/228 (87%), Gaps = 6/228 (2%)
Query: 1 MAAKSQIVTGFTMPMTPAP-----SSSSSSSSSSLCMVKK-PLTTSFFNGGVGALKVTRL 54
MA KSQ++TG T+PM P S+++ +++++LCMVK+ LTTSFFNGGV ALKV R+
Sbjct: 1 MAIKSQLITGLTLPMPHPPYTSSSSNNNGNNNTTLCMVKRRTLTTSFFNGGVEALKVARI 60
Query: 55 RIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDD 114
R + S+RS CYRQGGGAL T MNLFDR RVVKSYANAI+SSFEDPEKILEQ VLEMNDD
Sbjct: 61 RTSLSTRSQCYRQGGGALGTCMNLFDRFGRVVKSYANAIISSFEDPEKILEQTVLEMNDD 120
Query: 115 LVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYAD 174
L KMRQATAQVLASQKRLENK KAA+ ASE+WYRKAQLALQKGEEDLAREALKRRK+YAD
Sbjct: 121 LTKMRQATAQVLASQKRLENKYKAAQLASEEWYRKAQLALQKGEEDLAREALKRRKTYAD 180
Query: 175 NANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAK 222
NAN+ KAQLDQQK VV NLVSNTRLLESK+QEA+SKKDTLKARAQSAK
Sbjct: 181 NANSFKAQLDQQKGVVENLVSNTRLLESKMQEAKSKKDTLKARAQSAK 228
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255578930|ref|XP_002530318.1| Membrane-associated 30 kDa protein, chloroplast precursor, putative [Ricinus communis] gi|223530174|gb|EEF32085.1| Membrane-associated 30 kDa protein, chloroplast precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|363807044|ref|NP_001242581.1| uncharacterized protein LOC100781742 [Glycine max] gi|255641682|gb|ACU21113.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|363806682|ref|NP_001242008.1| uncharacterized protein LOC100818209 [Glycine max] gi|255639265|gb|ACU19931.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449468854|ref|XP_004152136.1| PREDICTED: membrane-associated 30 kDa protein, chloroplastic-like [Cucumis sativus] gi|449484741|ref|XP_004156967.1| PREDICTED: membrane-associated 30 kDa protein, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225430912|ref|XP_002276816.1| PREDICTED: probable membrane-associated 30 kDa protein, chloroplastic [Vitis vinifera] gi|297735245|emb|CBI17607.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359478255|ref|XP_002273068.2| PREDICTED: membrane-associated 30 kDa protein, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|729842|sp|Q03943.1|IM30_PEA RecName: Full=Membrane-associated 30 kDa protein, chloroplastic; Short=M30; Flags: Precursor gi|169107|gb|AAA53545.1| IM30 [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|388510656|gb|AFK43394.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|147795803|emb|CAN69783.1| hypothetical protein VITISV_012616 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 251 | ||||||
| TAIR|locus:2206290 | 330 | PTAC4 "plastid transcriptional | 0.864 | 0.657 | 0.650 | 1.9e-67 | |
| UNIPROTKB|Q9KRG4 | 222 | VC1678 "Phage shock protein A" | 0.581 | 0.657 | 0.376 | 8e-21 | |
| TIGR_CMR|VC_1678 | 222 | VC_1678 "phage shock protein A | 0.581 | 0.657 | 0.376 | 8e-21 | |
| TIGR_CMR|SO_1807 | 227 | SO_1807 "phage shock protein A | 0.581 | 0.643 | 0.349 | 1.7e-20 | |
| TIGR_CMR|CPS_3772 | 221 | CPS_3772 "phage shock protein | 0.581 | 0.660 | 0.342 | 9.2e-20 | |
| TIGR_CMR|CPS_4751 | 220 | CPS_4751 "phage shock protein | 0.585 | 0.668 | 0.319 | 2.5e-19 | |
| UNIPROTKB|P0AFM6 | 222 | pspA [Escherichia coli K-12 (t | 0.581 | 0.657 | 0.335 | 4e-19 | |
| UNIPROTKB|Q9F4H4 | 221 | pspA "Phage shock protein A" [ | 0.581 | 0.660 | 0.328 | 2.2e-18 | |
| UNIPROTKB|Q81KD9 | 221 | BAS4700 "Uncharacterized prote | 0.585 | 0.665 | 0.272 | 4.4e-13 | |
| TIGR_CMR|BA_5061 | 221 | BA_5061 "conserved hypothetica | 0.585 | 0.665 | 0.272 | 4.4e-13 |
| TAIR|locus:2206290 PTAC4 "plastid transcriptionally active 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 685 (246.2 bits), Expect = 1.9e-67, P = 1.9e-67
Identities = 145/223 (65%), Positives = 171/223 (76%)
Query: 1 MAAKSQIVTGFTMPMTPAPXXXXXXXXXXLCMVK-KPLTTSFFNGGVGALKVTRLRIAPS 59
MA K+ VTG P+ P C ++ PL TSFF GAL+V LR+A
Sbjct: 1 MALKASPVTGLFPPLRPTASSSPSTSSNRPCSLRILPLRTSFFGNSSGALRVNVLRLACD 60
Query: 60 SRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMR 119
+R C G GA MNLF+R +RVVKSYANA++SSFEDPEKILEQ V+EMN DL KMR
Sbjct: 61 NRLRC--NGHGAT---MNLFERFSRVVKSYANALISSFEDPEKILEQTVIEMNSDLTKMR 115
Query: 120 QATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANAL 179
QATAQVLASQK+L+NK KAA+Q+S+DWY++AQLAL KG+EDLAREALKRRKS+ADNA AL
Sbjct: 116 QATAQVLASQKQLQNKYKAAQQSSDDWYKRAQLALAKGDEDLAREALKRRKSFADNATAL 175
Query: 180 KAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAK 222
K QLDQQK VV+NLVSNTRLLESKIQEA++KKDTL ARA++AK
Sbjct: 176 KTQLDQQKGVVDNLVSNTRLLESKIQEAKAKKDTLLARARTAK 218
|
|
| UNIPROTKB|Q9KRG4 VC1678 "Phage shock protein A" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1678 VC_1678 "phage shock protein A" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1807 SO_1807 "phage shock protein A" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3772 CPS_3772 "phage shock protein A" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4751 CPS_4751 "phage shock protein A" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0AFM6 pspA [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9F4H4 pspA "Phage shock protein A" [Yersinia enterocolitica (taxid:630)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81KD9 BAS4700 "Uncharacterized protein" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5061 BA_5061 "conserved hypothetical protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 251 | |||
| COG1842 | 225 | COG1842, PspA, Phage shock protein A (IM30), suppr | 1e-37 | |
| pfam04012 | 220 | pfam04012, PspA_IM30, PspA/IM30 family | 1e-35 | |
| TIGR02977 | 219 | TIGR02977, phageshock_pspA, phage shock protein A | 2e-33 | |
| PRK10698 | 222 | PRK10698, PRK10698, phage shock protein PspA; Prov | 3e-22 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.002 |
| >gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
Score = 131 bits (331), Expect = 1e-37
Identities = 72/147 (48%), Positives = 95/147 (64%)
Query: 76 MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENK 135
M +F RL +VK+ N +L EDPEK+LEQA+ +M +L K RQA AQ +A QK+LE K
Sbjct: 1 MGIFSRLKDLVKANINELLDKAEDPEKMLEQAIRDMESELAKARQALAQAIARQKQLERK 60
Query: 136 CKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVS 195
+ A+ +E KA+LALQ G EDLAREAL+ ++S D A AL+A+L Q + V L
Sbjct: 61 LEEAQARAEKLEEKAELALQAGNEDLAREALEEKQSLEDLAKALEAELQQAEEQVEKLKK 120
Query: 196 NTRLLESKIQEARSKKDTLKARAQSAK 222
LE KI E R+KK+ LKAR +AK
Sbjct: 121 QLAALEQKIAELRAKKEALKARKAAAK 147
|
Length = 225 |
| >gnl|CDD|217843 pfam04012, PspA_IM30, PspA/IM30 family | Back alignment and domain information |
|---|
| >gnl|CDD|213755 TIGR02977, phageshock_pspA, phage shock protein A | Back alignment and domain information |
|---|
| >gnl|CDD|182657 PRK10698, PRK10698, phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 251 | |||
| PRK10698 | 222 | phage shock protein PspA; Provisional | 100.0 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 100.0 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 100.0 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 100.0 | |
| PF03357 | 171 | Snf7: Snf7; InterPro: IPR005024 This is a family o | 97.34 | |
| PTZ00446 | 191 | vacuolar sorting protein SNF7-like; Provisional | 97.07 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 97.06 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 96.83 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.78 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.56 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 96.44 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.37 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.25 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.12 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 96.11 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.09 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 95.54 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.52 | |
| KOG2911 | 439 | consensus Uncharacterized conserved protein [Funct | 95.41 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 95.19 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.04 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.03 | |
| PRK11637 | 428 | AmiB activator; Provisional | 94.95 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.92 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 94.79 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 94.78 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.76 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.64 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.52 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 94.5 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 94.48 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 94.46 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 94.46 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 94.4 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 94.18 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 94.14 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.07 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 93.94 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 93.91 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 93.85 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 93.81 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 93.74 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 93.73 | |
| PTZ00464 | 211 | SNF-7-like protein; Provisional | 93.71 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 93.62 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 93.6 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 93.56 | |
| PF13166 | 712 | AAA_13: AAA domain | 93.53 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 93.53 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 93.41 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 93.4 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 93.24 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 93.03 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 93.03 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 92.94 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 92.87 | |
| PF10046 | 99 | BLOC1_2: Biogenesis of lysosome-related organelles | 92.83 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 92.56 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 92.29 | |
| KOG3232 | 203 | consensus Vacuolar assembly/sorting protein DID2 [ | 92.14 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 91.74 | |
| KOG2910 | 209 | consensus Uncharacterized conserved protein predic | 91.71 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 91.68 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 91.67 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 91.64 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 91.47 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.46 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 91.33 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 91.27 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 91.16 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 91.01 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 90.99 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 90.59 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 90.56 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 90.56 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 90.52 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 90.43 | |
| PF05816 | 333 | TelA: Toxic anion resistance protein (TelA); Inter | 90.09 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 90.05 | |
| PF09325 | 236 | Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp | 90.03 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 89.97 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 89.9 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 89.74 | |
| CHL00118 | 156 | atpG ATP synthase CF0 B' subunit; Validated | 89.66 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 89.5 | |
| PRK08476 | 141 | F0F1 ATP synthase subunit B'; Validated | 89.48 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 89.41 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 89.36 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 89.35 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 89.3 | |
| PRK13454 | 181 | F0F1 ATP synthase subunit B'; Provisional | 89.15 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 89.12 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 89.03 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 88.93 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 88.89 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 88.89 | |
| PF03194 | 254 | LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa | 88.85 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 88.72 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 88.68 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 88.65 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 88.6 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 88.56 | |
| PRK07720 | 146 | fliJ flagellar biosynthesis chaperone; Validated | 88.51 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 88.39 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 88.28 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 88.25 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 88.23 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 88.19 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 88.15 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 88.03 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 87.9 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 87.85 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 87.76 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 87.71 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 87.56 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 87.34 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 87.33 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 87.29 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 87.22 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 86.98 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 86.9 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 86.67 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 86.62 | |
| PRK09174 | 204 | F0F1 ATP synthase subunit B'; Validated | 86.55 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 86.51 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 86.31 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 86.13 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 85.99 | |
| TIGR03545 | 555 | conserved hypothetical protein TIGR03545. This mod | 85.96 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 85.76 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 85.53 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 85.25 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 85.22 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 84.94 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 84.73 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 84.71 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 84.69 | |
| PRK05689 | 147 | fliJ flagellar biosynthesis chaperone; Validated | 84.67 | |
| PLN02718 | 603 | Probable galacturonosyltransferase | 84.66 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 84.52 | |
| smart00685 | 59 | DM14 Repeats in fly CG4713, worm Y37H9A.3 and huma | 84.41 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 84.25 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 84.11 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 83.99 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 83.73 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 83.7 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 83.65 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 83.56 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 83.55 | |
| TIGR02473 | 141 | flagell_FliJ flagellar export protein FliJ. Member | 83.31 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 83.3 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 83.21 | |
| PF12761 | 195 | End3: Actin cytoskeleton-regulatory complex protei | 83.18 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 83.15 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 83.14 | |
| KOG1656 | 221 | consensus Protein involved in glucose derepression | 83.08 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 82.98 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 82.96 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 82.89 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 82.51 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 82.34 | |
| PF13094 | 160 | CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub | 82.21 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 82.18 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 81.96 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 81.93 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 81.9 | |
| PF15112 | 307 | DUF4559: Domain of unknown function (DUF4559) | 81.78 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 81.65 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 81.59 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 81.21 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 81.16 | |
| PLN02829 | 639 | Probable galacturonosyltransferase | 81.12 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 81.11 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 80.71 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 80.53 | |
| PRK14475 | 167 | F0F1 ATP synthase subunit B; Provisional | 80.51 | |
| PF05103 | 131 | DivIVA: DivIVA protein; InterPro: IPR007793 The Ba | 80.5 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 80.35 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 80.34 | |
| PF07743 | 78 | HSCB_C: HSCB C-terminal oligomerisation domain; In | 80.31 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 80.21 | |
| PF05103 | 131 | DivIVA: DivIVA protein; InterPro: IPR007793 The Ba | 80.18 |
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-38 Score=281.67 Aligned_cols=171 Identities=30% Similarity=0.412 Sum_probs=169.4
Q ss_pred CchHHHHHHHHHHHHHHhhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 025526 76 MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQ 155 (251)
Q Consensus 76 M~if~Rl~~lira~in~~lDk~EDP~~mLdQ~Ireme~~L~kar~~lA~v~A~~k~le~k~~~~~~~~~~~e~rA~~AL~ 155 (251)
||||+||+++|+|++|+++|++|||++||+|+|+||++++.++++++|++++.++++++++.++...+++|+.+|++||+
T Consensus 1 M~if~Rl~~ii~a~in~~ldkaEDP~k~l~q~i~em~~~l~~~r~alA~~~A~~k~~er~~~~~~~~~~~~e~kA~~Al~ 80 (222)
T PRK10698 1 MGIFSRFADIVNANINALLEKAEDPQKLVRLMIQEMEDTLVEVRSTSARALAEKKQLTRRIEQAEAQQVEWQEKAELALR 80 (222)
T ss_pred CCHHHHHHHHHHhHHHHHHHhhcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCC
Q 025526 156 KGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAKFVFPLSLLEFPVF 235 (251)
Q Consensus 156 ~G~EdLAreAL~rk~~~e~~~~~l~~ql~~~~~~v~~Lk~~l~~Le~ki~e~k~k~~~LkAr~~~AkAq~~vn~~l~~~~ 235 (251)
+|+|||||+||.+|..++.++..|+.+++.+...+++|+.++.+|+.+|.+++.|+++|++|.++|+++.++++.+++++
T Consensus 81 ~G~EdLAr~AL~~K~~~~~~~~~l~~~~~~~~~~~~~L~~~l~~L~~ki~eak~k~~~L~aR~~~A~a~~~~~~~~~~~~ 160 (222)
T PRK10698 81 KEKEDLARAALIEKQKLTDLIATLEHEVTLVDETLARMKKEIGELENKLSETRARQQALMLRHQAASSSRDVRRQLDSGK 160 (222)
T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred chhHHHHHHHH
Q 025526 236 SASATSLVLLV 246 (251)
Q Consensus 236 ~~~a~~~f~~~ 246 (251)
+++++.+|+..
T Consensus 161 ~~~a~~~f~rm 171 (222)
T PRK10698 161 LDEAMARFESF 171 (222)
T ss_pred cchHHHHHHHH
Confidence 99999999864
|
|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF03357 Snf7: Snf7; InterPro: IPR005024 This is a family of eukaryotic proteins which are variously described as either hypothetical protein, developmental protein or related to yeast SNF7 | Back alignment and domain information |
|---|
| >PTZ00446 vacuolar sorting protein SNF7-like; Provisional | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG2911 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PTZ00464 SNF-7-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG3232 consensus Vacuolar assembly/sorting protein DID2 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >KOG2910 consensus Uncharacterized conserved protein predicted to be involved in protein sorting [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF05816 TelA: Toxic anion resistance protein (TelA); InterPro: IPR008863 This family consists of several prokaryotic TelA like proteins | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >CHL00118 atpG ATP synthase CF0 B' subunit; Validated | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08476 F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK13454 F0F1 ATP synthase subunit B'; Provisional | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK07720 fliJ flagellar biosynthesis chaperone; Validated | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09174 F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR03545 conserved hypothetical protein TIGR03545 | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05689 fliJ flagellar biosynthesis chaperone; Validated | Back alignment and domain information |
|---|
| >PLN02718 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >smart00685 DM14 Repeats in fly CG4713, worm Y37H9A | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >TIGR02473 flagell_FliJ flagellar export protein FliJ | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG1656 consensus Protein involved in glucose derepression and pre-vacuolar endosome protein sorting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15112 DUF4559: Domain of unknown function (DUF4559) | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >PLN02829 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14475 F0F1 ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07743 HSCB_C: HSCB C-terminal oligomerisation domain; InterPro: IPR009073 This entry represents the C-terminal oligomerisation domain found in HscB (heat shock cognate protein B), which is also known as HSC20 (20K heat shock cognate protein) | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 251 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 6e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 44.8 bits (105), Expect = 2e-05
Identities = 27/205 (13%), Positives = 57/205 (27%), Gaps = 60/205 (29%)
Query: 36 PLTTSFFNGGVGALKVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAI-- 93
P S +R + ++ D+L +++S N +
Sbjct: 327 PRRLSII----AES----IRDGLA-TWDNWKH---------VNCDKLTTIIESSLNVLEP 368
Query: 94 ---------LSSFEDPEKILEQAVLEMNDDL-VKMRQATAQVLASQKRLENKCKAAEQAS 143
LS F I +L + + + ++ V+ ++ L +Q
Sbjct: 369 AEYRKMFDRLSVFPPSAHIPTI-LLSL---IWFDVIKSDVMVVVNK--LHKYSLVEKQPK 422
Query: 144 EDWYRKAQLALQKGEEDLAREALKRR-----------------KSYADN--ANAL----- 179
E + L+ + AL R Y D + +
Sbjct: 423 ESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLK 482
Query: 180 KAQLDQQKNVVNNLVSNTRLLESKI 204
+ ++ + + + R LE KI
Sbjct: 483 NIEHPERMTLFRMVFLDFRFLEQKI 507
|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 251 | |||
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 97.53 | |
| 4abm_A | 79 | Charged multivesicular BODY protein 4B; cell cycle | 97.23 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.89 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.78 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.31 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.85 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.4 | |
| 2gd5_A | 179 | Charged multivesicular BODY protein 3; CHMP3, ESCR | 95.03 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 94.94 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 93.28 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 93.26 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 93.17 | |
| 3ajw_A | 150 | Flagellar FLIJ protein; flagellum, type III secret | 92.46 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 92.33 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 91.72 | |
| 3frt_A | 218 | Charged multivesicular BODY protein 3; ESCRT, ESCR | 91.69 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.63 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 91.32 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 90.96 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 90.9 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 90.8 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 90.7 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 90.43 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 90.31 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 90.12 | |
| 4fm3_A | 98 | Uncharacterized hypothetical protein; PF14346 fami | 89.91 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 89.62 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 89.6 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 88.9 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 88.53 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 88.42 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 88.15 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 87.74 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 86.72 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 86.32 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 86.23 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 86.12 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 84.91 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 84.85 | |
| 3ghg_B | 461 | Fibrinogen beta chain; triple-stranded coiled coil | 84.29 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 84.15 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 83.43 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 82.11 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 80.97 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 80.06 |
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
Probab=97.53 E-value=0.0082 Score=56.38 Aligned_cols=121 Identities=16% Similarity=0.144 Sum_probs=84.9
Q ss_pred hHHHHHHHHHHHHHHhhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Q 025526 78 LFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKG 157 (251)
Q Consensus 78 if~Rl~~lira~in~~lDk~EDP~~mLdQ~Ireme~~L~kar~~lA~v~A~~k~le~k~~~~~~~~~~~e~rA~~AL~~G 157 (251)
-+..+.+++...+..++..-.||+..|+.+..++++.|.+.+... +..--...++++++++++...+.+.+|-.|=.
T Consensus 349 ~~~~~~~~~~~~~~~vl~G~~t~eeal~~~~~~i~~~l~~~~~~~-e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-- 425 (471)
T 3mq9_A 349 QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITAARDGLRAVM-EARNVTHLLQQELTEAQKGFQDVEAQAATANH-- 425 (471)
T ss_dssp THHHHHHHHHHHHHHHHHSSSCHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
T ss_pred cHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhhHHHH-HhhhHHHHHHHHHHHHhhhHHHHHHHhhhcch--
Confidence 356778888888899988888999999999999999998886655 77778889999999999999999999987621
Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 025526 158 EEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTL 214 (251)
Q Consensus 158 ~EdLAreAL~rk~~~e~~~~~l~~ql~~~~~~v~~Lk~~l~~Le~ki~e~k~k~~~L 214 (251)
....=..+++. ...+.+..+++|+..+.+++.+|++++.+.+.+
T Consensus 426 ------~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 469 (471)
T 3mq9_A 426 ------TVMALMASLDA-------EKAQGQKKVEELEGEITTLNHKLQDASAEVERL 469 (471)
T ss_dssp ------HHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred ------hHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 22222222333 333333455555555555555555555554444
|
| >4abm_A Charged multivesicular BODY protein 4B; cell cycle, protein transport, HIV-1; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2gd5_A Charged multivesicular BODY protein 3; CHMP3, ESCRT-III, protein transport; 2.80A {Homo sapiens} PDB: 3frv_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3frt_A Charged multivesicular BODY protein 3; ESCRT, ESCRT-111, CHMP, IST1, coiled coil, cytoplasm, lipoprotein, membrane, myristate, phosphoprotein; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fm3_A Uncharacterized hypothetical protein; PF14346 family protein, DUF4398, structural genomics, joint for structural genomics, JCSG; HET: PG4; 2.47A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 251 | |||
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 86.65 | |
| d1fpoa2 | 95 | HSC20 (HSCB), C-terminal oligomerisation domain {E | 84.35 |
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Prefoldin family: Prefoldin domain: Prefoldin beta subunit species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=86.65 E-value=2.7 Score=29.90 Aligned_cols=40 Identities=13% Similarity=0.203 Sum_probs=28.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 025526 108 VLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWY 147 (251)
Q Consensus 108 Ireme~~L~kar~~lA~v~A~~k~le~k~~~~~~~~~~~e 147 (251)
+.+.-..+..+++.+..+......++.++.+.....+.++
T Consensus 3 lqe~~~~~q~lq~el~~~~~q~~~le~q~~E~~~vl~eL~ 42 (107)
T d1fxka_ 3 VQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELS 42 (107)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4455566777777777777878888888877776666655
|
| >d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|