Citrus Sinensis ID: 025526


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MAAKSQIVTGFTMPMTPAPSSSSSSSSSSLCMVKKPLTTSFFNGGVGALKVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAKFVFPLSLLEFPVFSASATSLVLLVMVAIA
ccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHc
ccccccEEccccccccccccccccccccccEEEcccccccHccccccEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHc
maaksqivtgftmpmtpapsssssssssslcmvkkplttsffnggvgalkvtrlriapssrshcyrqgggalntRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAkfvfplsllefpvfsasATSLVLLVMVAIA
maaksqivtgftmpmtpapssssssssssLCMVKKPLTTSFFNGGVGALKVTrlriapssrshcyrqgggalntRMNLFDRLARVVKSYANAilssfedpEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKaqldqqknvVNNLVSNTRLLESKIQEARSKKDTLKARAQSAKFVFPLSLLEFPVFSASATSLVLLVMVAIA
MAAKSQIVTGFTMPMTPAPssssssssssLCMVKKPLTTSFFNGGVGALKVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAKFVFPLSLLEFPVFSASATSLVLLVMVAIA
******************************CMVKKPLTTSFFNGGVGALKVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVK*******************************************************************************************************AKFVFPLSLLEFPVFSASATSLVLLVMVAI*
****SQI*TGFT**************************TSFFNGGVGALK*************************MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATA*********************DWYRKAQLALQKGEEDLAREALKRRKSYA****A******************************S***********************************LVMVAI*
MAAKSQIVTGFTMPM****************MVKKPLTTSFFNGGVGALKVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLAS**************SEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQE***********AQSAKFVFPLSLLEFPVFSASATSLVLLVMVAIA
*****Q**TGFTMPMTPA**********SLCMVKKPLTTSFFNGGVGALKVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAKFVFPLSLLEFPVFSASATSLVLLVMVAIA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKSQIVTGFTMPMTPAPSSSSSSSSSSLCMVKKPLTTSFFNGGVGALKVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASxxxxxxxxxxxxxxxxxxxxxAQLALQKGEEDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQSAKFVFPLSLLEFPVFSASATSLVLLVMVAIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
Q03943323 Membrane-associated 30 kD N/A no 0.896 0.696 0.690 2e-81
O80796330 Membrane-associated prote yes no 0.864 0.657 0.677 2e-72
Q8S0J7317 Probable membrane-associa yes no 0.780 0.618 0.682 5e-72
Q55707267 Uncharacterized protein s N/A no 0.557 0.524 0.5 2e-31
Q9RUB7223 Phage shock protein A hom yes no 0.585 0.659 0.367 9e-18
P0AFM8222 Phage shock protein A OS= yes no 0.581 0.657 0.335 2e-13
P0AFM6222 Phage shock protein A OS= N/A no 0.581 0.657 0.335 2e-13
P0AFM7222 Phage shock protein A OS= N/A no 0.581 0.657 0.335 2e-13
P54617227 Phage shock protein A hom yes no 0.370 0.409 0.353 2e-06
O32201225 Protein LiaH OS=Bacillus no no 0.513 0.573 0.317 5e-06
>sp|Q03943|IM30_PEA Membrane-associated 30 kDa protein, chloroplastic OS=Pisum sativum GN=IM30 PE=2 SV=1 Back     alignment and function desciption
 Score =  301 bits (772), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 188/242 (77%), Gaps = 17/242 (7%)

Query: 1   MAAKSQIVTGFTMPMTPAPSSSSSSSSSSLCMVKKPLTTSFFNG-GVGALKVTRLRIAPS 59
           M  K QI +G  +P  P   SSS        ++KKPL T+ F    V  LK   +RIA  
Sbjct: 1   MTTKFQIFSG--LPSAPLQPSSS--------LLKKPLATTLFGTRPVDTLKFRVMRIAKP 50

Query: 60  SRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMR 119
            R      GGGA+  RMNLFDR ARVVKSYANA++S+FEDPEKILEQAVLEMNDDL KMR
Sbjct: 51  VR------GGGAIGVRMNLFDRFARVVKSYANALVSTFEDPEKILEQAVLEMNDDLTKMR 104

Query: 120 QATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANAL 179
           QATAQVLASQKRLENK KAA+QASE+WYRKAQLALQKGEEDLAREALKRRKS+ADNA++L
Sbjct: 105 QATAQVLASQKRLENKYKAAQQASEEWYRKAQLALQKGEEDLAREALKRRKSFADNASSL 164

Query: 180 KAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAKFVFPLSLLEFPVFSASA 239
           KAQLDQQK+VV+NLVSNTRLLESKIQEARSKKDTLKARAQSAK    +S +   V ++SA
Sbjct: 165 KAQLDQQKSVVDNLVSNTRLLESKIQEARSKKDTLKARAQSAKTATKVSEMLGNVNTSSA 224

Query: 240 TS 241
            S
Sbjct: 225 LS 226





Pisum sativum (taxid: 3888)
>sp|O80796|VIPP1_ARATH Membrane-associated protein VIPP1, chloroplastic OS=Arabidopsis thaliana GN=VIPP1 PE=1 SV=1 Back     alignment and function description
>sp|Q8S0J7|IM30_ORYSJ Probable membrane-associated 30 kDa protein, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0895100 PE=1 SV=1 Back     alignment and function description
>sp|Q55707|Y617_SYNY3 Uncharacterized protein sll0617 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0617 PE=3 SV=1 Back     alignment and function description
>sp|Q9RUB7|PSPA_DEIRA Phage shock protein A homolog OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_1473 PE=1 SV=1 Back     alignment and function description
>sp|P0AFM8|PSPA_SHIFL Phage shock protein A OS=Shigella flexneri GN=pspA PE=3 SV=2 Back     alignment and function description
>sp|P0AFM6|PSPA_ECOLI Phage shock protein A OS=Escherichia coli (strain K12) GN=pspA PE=1 SV=2 Back     alignment and function description
>sp|P0AFM7|PSPA_ECO57 Phage shock protein A OS=Escherichia coli O157:H7 GN=pspA PE=3 SV=2 Back     alignment and function description
>sp|P54617|PSPA_BACSU Phage shock protein A homolog OS=Bacillus subtilis (strain 168) GN=ydjF PE=1 SV=3 Back     alignment and function description
>sp|O32201|LIAH_BACSU Protein LiaH OS=Bacillus subtilis (strain 168) GN=liaH PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
224138834339 predicted protein [Populus trichocarpa] 0.884 0.654 0.776 4e-94
255578930312 Membrane-associated 30 kDa protein, chlo 0.872 0.701 0.776 1e-90
363807044323 uncharacterized protein LOC100781742 [Gl 0.912 0.708 0.747 5e-88
363806682322 uncharacterized protein LOC100818209 [Gl 0.908 0.708 0.743 4e-87
449468854332 PREDICTED: membrane-associated 30 kDa pr 0.956 0.722 0.702 3e-84
225430912324 PREDICTED: probable membrane-associated 0.920 0.712 0.692 2e-82
359478255314 PREDICTED: membrane-associated 30 kDa pr 0.800 0.640 0.716 4e-81
729842323 RecName: Full=Membrane-associated 30 kDa 0.896 0.696 0.690 1e-79
388510656326 unknown [Lotus japonicus] 0.924 0.711 0.698 5e-79
147795803 465 hypothetical protein VITISV_012616 [Viti 0.828 0.447 0.686 2e-76
>gi|224138834|ref|XP_002322913.1| predicted protein [Populus trichocarpa] gi|222867543|gb|EEF04674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  350 bits (897), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 177/228 (77%), Positives = 199/228 (87%), Gaps = 6/228 (2%)

Query: 1   MAAKSQIVTGFTMPMTPAP-----SSSSSSSSSSLCMVKK-PLTTSFFNGGVGALKVTRL 54
           MA KSQ++TG T+PM   P     S+++ +++++LCMVK+  LTTSFFNGGV ALKV R+
Sbjct: 1   MAIKSQLITGLTLPMPHPPYTSSSSNNNGNNNTTLCMVKRRTLTTSFFNGGVEALKVARI 60

Query: 55  RIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDD 114
           R + S+RS CYRQGGGAL T MNLFDR  RVVKSYANAI+SSFEDPEKILEQ VLEMNDD
Sbjct: 61  RTSLSTRSQCYRQGGGALGTCMNLFDRFGRVVKSYANAIISSFEDPEKILEQTVLEMNDD 120

Query: 115 LVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYAD 174
           L KMRQATAQVLASQKRLENK KAA+ ASE+WYRKAQLALQKGEEDLAREALKRRK+YAD
Sbjct: 121 LTKMRQATAQVLASQKRLENKYKAAQLASEEWYRKAQLALQKGEEDLAREALKRRKTYAD 180

Query: 175 NANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAK 222
           NAN+ KAQLDQQK VV NLVSNTRLLESK+QEA+SKKDTLKARAQSAK
Sbjct: 181 NANSFKAQLDQQKGVVENLVSNTRLLESKMQEAKSKKDTLKARAQSAK 228




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255578930|ref|XP_002530318.1| Membrane-associated 30 kDa protein, chloroplast precursor, putative [Ricinus communis] gi|223530174|gb|EEF32085.1| Membrane-associated 30 kDa protein, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|363807044|ref|NP_001242581.1| uncharacterized protein LOC100781742 [Glycine max] gi|255641682|gb|ACU21113.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|363806682|ref|NP_001242008.1| uncharacterized protein LOC100818209 [Glycine max] gi|255639265|gb|ACU19931.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449468854|ref|XP_004152136.1| PREDICTED: membrane-associated 30 kDa protein, chloroplastic-like [Cucumis sativus] gi|449484741|ref|XP_004156967.1| PREDICTED: membrane-associated 30 kDa protein, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225430912|ref|XP_002276816.1| PREDICTED: probable membrane-associated 30 kDa protein, chloroplastic [Vitis vinifera] gi|297735245|emb|CBI17607.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478255|ref|XP_002273068.2| PREDICTED: membrane-associated 30 kDa protein, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|729842|sp|Q03943.1|IM30_PEA RecName: Full=Membrane-associated 30 kDa protein, chloroplastic; Short=M30; Flags: Precursor gi|169107|gb|AAA53545.1| IM30 [Pisum sativum] Back     alignment and taxonomy information
>gi|388510656|gb|AFK43394.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|147795803|emb|CAN69783.1| hypothetical protein VITISV_012616 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2206290330 PTAC4 "plastid transcriptional 0.864 0.657 0.650 1.9e-67
UNIPROTKB|Q9KRG4222 VC1678 "Phage shock protein A" 0.581 0.657 0.376 8e-21
TIGR_CMR|VC_1678222 VC_1678 "phage shock protein A 0.581 0.657 0.376 8e-21
TIGR_CMR|SO_1807227 SO_1807 "phage shock protein A 0.581 0.643 0.349 1.7e-20
TIGR_CMR|CPS_3772221 CPS_3772 "phage shock protein 0.581 0.660 0.342 9.2e-20
TIGR_CMR|CPS_4751220 CPS_4751 "phage shock protein 0.585 0.668 0.319 2.5e-19
UNIPROTKB|P0AFM6222 pspA [Escherichia coli K-12 (t 0.581 0.657 0.335 4e-19
UNIPROTKB|Q9F4H4221 pspA "Phage shock protein A" [ 0.581 0.660 0.328 2.2e-18
UNIPROTKB|Q81KD9221 BAS4700 "Uncharacterized prote 0.585 0.665 0.272 4.4e-13
TIGR_CMR|BA_5061221 BA_5061 "conserved hypothetica 0.585 0.665 0.272 4.4e-13
TAIR|locus:2206290 PTAC4 "plastid transcriptionally active 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 685 (246.2 bits), Expect = 1.9e-67, P = 1.9e-67
 Identities = 145/223 (65%), Positives = 171/223 (76%)

Query:     1 MAAKSQIVTGFTMPMTPAPXXXXXXXXXXLCMVK-KPLTTSFFNGGVGALKVTRLRIAPS 59
             MA K+  VTG   P+ P             C ++  PL TSFF    GAL+V  LR+A  
Sbjct:     1 MALKASPVTGLFPPLRPTASSSPSTSSNRPCSLRILPLRTSFFGNSSGALRVNVLRLACD 60

Query:    60 SRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMR 119
             +R  C   G GA    MNLF+R +RVVKSYANA++SSFEDPEKILEQ V+EMN DL KMR
Sbjct:    61 NRLRC--NGHGAT---MNLFERFSRVVKSYANALISSFEDPEKILEQTVIEMNSDLTKMR 115

Query:   120 QATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANAL 179
             QATAQVLASQK+L+NK KAA+Q+S+DWY++AQLAL KG+EDLAREALKRRKS+ADNA AL
Sbjct:   116 QATAQVLASQKQLQNKYKAAQQSSDDWYKRAQLALAKGDEDLAREALKRRKSFADNATAL 175

Query:   180 KAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAK 222
             K QLDQQK VV+NLVSNTRLLESKIQEA++KKDTL ARA++AK
Sbjct:   176 KTQLDQQKGVVDNLVSNTRLLESKIQEAKAKKDTLLARARTAK 218




GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016020 "membrane" evidence=ISS
GO:0010027 "thylakoid membrane organization" evidence=RCA;IMP
GO:0016050 "vesicle organization" evidence=IMP
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009295 "nucleoid" evidence=IDA
GO:0009508 "plastid chromosome" evidence=IDA
UNIPROTKB|Q9KRG4 VC1678 "Phage shock protein A" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1678 VC_1678 "phage shock protein A" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1807 SO_1807 "phage shock protein A" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3772 CPS_3772 "phage shock protein A" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4751 CPS_4751 "phage shock protein A" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P0AFM6 pspA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9F4H4 pspA "Phage shock protein A" [Yersinia enterocolitica (taxid:630)] Back     alignment and assigned GO terms
UNIPROTKB|Q81KD9 BAS4700 "Uncharacterized protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5061 BA_5061 "conserved hypothetical protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O80796VIPP1_ARATHNo assigned EC number0.67710.86450.6575yesno
Q8S0J7IM30_ORYSJNo assigned EC number0.68240.78080.6182yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
COG1842225 COG1842, PspA, Phage shock protein A (IM30), suppr 1e-37
pfam04012220 pfam04012, PspA_IM30, PspA/IM30 family 1e-35
TIGR02977219 TIGR02977, phageshock_pspA, phage shock protein A 2e-33
PRK10698222 PRK10698, PRK10698, phage shock protein PspA; Prov 3e-22
TIGR01069 771 TIGR01069, mutS2, MutS2 family protein 0.002
>gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
 Score =  131 bits (331), Expect = 1e-37
 Identities = 72/147 (48%), Positives = 95/147 (64%)

Query: 76  MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENK 135
           M +F RL  +VK+  N +L   EDPEK+LEQA+ +M  +L K RQA AQ +A QK+LE K
Sbjct: 1   MGIFSRLKDLVKANINELLDKAEDPEKMLEQAIRDMESELAKARQALAQAIARQKQLERK 60

Query: 136 CKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVS 195
            + A+  +E    KA+LALQ G EDLAREAL+ ++S  D A AL+A+L Q +  V  L  
Sbjct: 61  LEEAQARAEKLEEKAELALQAGNEDLAREALEEKQSLEDLAKALEAELQQAEEQVEKLKK 120

Query: 196 NTRLLESKIQEARSKKDTLKARAQSAK 222
               LE KI E R+KK+ LKAR  +AK
Sbjct: 121 QLAALEQKIAELRAKKEALKARKAAAK 147


Length = 225

>gnl|CDD|217843 pfam04012, PspA_IM30, PspA/IM30 family Back     alignment and domain information
>gnl|CDD|213755 TIGR02977, phageshock_pspA, phage shock protein A Back     alignment and domain information
>gnl|CDD|182657 PRK10698, PRK10698, phage shock protein PspA; Provisional Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
PRK10698222 phage shock protein PspA; Provisional 100.0
TIGR02977219 phageshock_pspA phage shock protein A. Members of 100.0
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 100.0
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 100.0
PF03357171 Snf7: Snf7; InterPro: IPR005024 This is a family o 97.34
PTZ00446191 vacuolar sorting protein SNF7-like; Provisional 97.07
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 97.06
PRK10698222 phage shock protein PspA; Provisional 96.83
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.78
PRK09039 343 hypothetical protein; Validated 96.56
TIGR02977219 phageshock_pspA phage shock protein A. Members of 96.44
PRK09039 343 hypothetical protein; Validated 96.37
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.25
PRK04863 1486 mukB cell division protein MukB; Provisional 96.12
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 96.11
PRK11637 428 AmiB activator; Provisional 96.09
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 95.54
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.52
KOG2911439 consensus Uncharacterized conserved protein [Funct 95.41
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 95.19
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.04
KOG0963 629 consensus Transcription factor/CCAAT displacement 95.03
PRK11637 428 AmiB activator; Provisional 94.95
COG4372 499 Uncharacterized protein conserved in bacteria with 94.92
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 94.79
KOG0971 1243 consensus Microtubule-associated protein dynactin 94.78
PRK02224 880 chromosome segregation protein; Provisional 94.76
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 94.64
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 94.52
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 94.5
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.48
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 94.46
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 94.46
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 94.4
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 94.18
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 94.14
PRK10884206 SH3 domain-containing protein; Provisional 94.07
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 93.94
PRK04863 1486 mukB cell division protein MukB; Provisional 93.91
KOG0996 1293 consensus Structural maintenance of chromosome pro 93.85
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 93.81
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.74
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.73
PTZ00464211 SNF-7-like protein; Provisional 93.71
PRK02224 880 chromosome segregation protein; Provisional 93.62
COG4942 420 Membrane-bound metallopeptidase [Cell division and 93.6
PF06120301 Phage_HK97_TLTM: Tail length tape measure protein; 93.56
PF13166 712 AAA_13: AAA domain 93.53
TIGR02231 525 conserved hypothetical protein. This family consis 93.53
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 93.41
KOG0971 1243 consensus Microtubule-associated protein dynactin 93.4
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 93.24
PHA02562 562 46 endonuclease subunit; Provisional 93.03
PF00038 312 Filament: Intermediate filament protein; InterPro: 93.03
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 92.94
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 92.87
PF1004699 BLOC1_2: Biogenesis of lysosome-related organelles 92.83
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 92.56
PRK03918 880 chromosome segregation protein; Provisional 92.29
KOG3232203 consensus Vacuolar assembly/sorting protein DID2 [ 92.14
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 91.74
KOG2910209 consensus Uncharacterized conserved protein predic 91.71
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 91.68
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 91.67
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 91.64
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 91.47
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.46
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 91.33
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 91.27
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 91.16
PF03148384 Tektin: Tektin family; InterPro: IPR000435 Tektin 91.01
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 90.99
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 90.59
COG3883265 Uncharacterized protein conserved in bacteria [Fun 90.56
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 90.56
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 90.52
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 90.43
PF05816333 TelA: Toxic anion resistance protein (TelA); Inter 90.09
PRK04778 569 septation ring formation regulator EzrA; Provision 90.05
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 90.03
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 89.97
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 89.9
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 89.74
CHL00118156 atpG ATP synthase CF0 B' subunit; Validated 89.66
PRK11281 1113 hypothetical protein; Provisional 89.5
PRK08476141 F0F1 ATP synthase subunit B'; Validated 89.48
PRK10476 346 multidrug resistance protein MdtN; Provisional 89.41
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 89.36
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 89.35
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 89.3
PRK13454181 F0F1 ATP synthase subunit B'; Provisional 89.15
PRK09343121 prefoldin subunit beta; Provisional 89.12
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 89.03
KOG0996 1293 consensus Structural maintenance of chromosome pro 88.93
PRK03918 880 chromosome segregation protein; Provisional 88.89
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 88.89
PF03194254 LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa 88.85
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 88.72
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 88.68
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 88.65
PRK00409 782 recombination and DNA strand exchange inhibitor pr 88.6
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 88.56
PRK07720146 fliJ flagellar biosynthesis chaperone; Validated 88.51
COG4942 420 Membrane-bound metallopeptidase [Cell division and 88.39
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 88.28
KOG2685421 consensus Cystoskeletal protein Tektin [Cytoskelet 88.25
PHA02562 562 46 endonuclease subunit; Provisional 88.23
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 88.19
KOG4673 961 consensus Transcription factor TMF, TATA element m 88.15
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 88.03
KOG0982 502 consensus Centrosomal protein Nuf [Cell cycle cont 87.9
KOG0249 916 consensus LAR-interacting protein and related prot 87.85
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 87.76
PF05701522 WEMBL: Weak chloroplast movement under blue light; 87.71
COG4372 499 Uncharacterized protein conserved in bacteria with 87.56
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 87.34
TIGR00998 334 8a0101 efflux pump membrane protein (multidrug res 87.33
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 87.29
COG1566 352 EmrA Multidrug resistance efflux pump [Defense mec 87.22
PRK15136 390 multidrug efflux system protein EmrA; Provisional 86.98
KOG0979 1072 consensus Structural maintenance of chromosome pro 86.9
PRK12704 520 phosphodiesterase; Provisional 86.67
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 86.62
PRK09174204 F0F1 ATP synthase subunit B'; Validated 86.55
PRK10884206 SH3 domain-containing protein; Provisional 86.51
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 86.31
KOG0249 916 consensus LAR-interacting protein and related prot 86.13
PF00038312 Filament: Intermediate filament protein; InterPro: 85.99
TIGR03545 555 conserved hypothetical protein TIGR03545. This mod 85.96
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 85.76
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 85.53
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 85.25
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 85.22
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 84.94
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 84.73
KOG1003205 consensus Actin filament-coating protein tropomyos 84.71
PRK0084677 hypothetical protein; Provisional 84.69
PRK05689147 fliJ flagellar biosynthesis chaperone; Validated 84.67
PLN02718 603 Probable galacturonosyltransferase 84.66
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 84.52
smart0068559 DM14 Repeats in fly CG4713, worm Y37H9A.3 and huma 84.41
KOG0964 1200 consensus Structural maintenance of chromosome pro 84.25
PF10186 302 Atg14: UV radiation resistance protein and autopha 84.11
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 83.99
PRK04778 569 septation ring formation regulator EzrA; Provision 83.73
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 83.7
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 83.65
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 83.56
TIGR02231 525 conserved hypothetical protein. This family consis 83.55
TIGR02473141 flagell_FliJ flagellar export protein FliJ. Member 83.31
KOG0288 459 consensus WD40 repeat protein TipD [General functi 83.3
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 83.21
PF12761195 End3: Actin cytoskeleton-regulatory complex protei 83.18
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 83.15
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 83.14
KOG1656221 consensus Protein involved in glucose derepression 83.08
PRK1542279 septal ring assembly protein ZapB; Provisional 82.98
KOG0933 1174 consensus Structural maintenance of chromosome pro 82.96
PF05529192 Bap31: B-cell receptor-associated protein 31-like 82.89
PRK0073668 hypothetical protein; Provisional 82.51
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 82.34
PF13094160 CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub 82.21
PRK0440675 hypothetical protein; Provisional 82.18
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 81.96
PRK03947140 prefoldin subunit alpha; Reviewed 81.93
KOG0933 1174 consensus Structural maintenance of chromosome pro 81.9
PF15112307 DUF4559: Domain of unknown function (DUF4559) 81.78
PRK0029568 hypothetical protein; Provisional 81.65
PRK0432574 hypothetical protein; Provisional 81.59
COG3206458 GumC Uncharacterized protein involved in exopolysa 81.21
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 81.16
PLN02829 639 Probable galacturonosyltransferase 81.12
PRK11281 1113 hypothetical protein; Provisional 81.11
PF09787 511 Golgin_A5: Golgin subfamily A member 5; InterPro: 80.71
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 80.53
PRK14475167 F0F1 ATP synthase subunit B; Provisional 80.51
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 80.5
PRK0279372 phi X174 lysis protein; Provisional 80.35
COG2433 652 Uncharacterized conserved protein [Function unknow 80.34
PF0774378 HSCB_C: HSCB C-terminal oligomerisation domain; In 80.31
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 80.21
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 80.18
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-38  Score=281.67  Aligned_cols=171  Identities=30%  Similarity=0.412  Sum_probs=169.4

Q ss_pred             CchHHHHHHHHHHHHHHhhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 025526           76 MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQ  155 (251)
Q Consensus        76 M~if~Rl~~lira~in~~lDk~EDP~~mLdQ~Ireme~~L~kar~~lA~v~A~~k~le~k~~~~~~~~~~~e~rA~~AL~  155 (251)
                      ||||+||+++|+|++|+++|++|||++||+|+|+||++++.++++++|++++.++++++++.++...+++|+.+|++||+
T Consensus         1 M~if~Rl~~ii~a~in~~ldkaEDP~k~l~q~i~em~~~l~~~r~alA~~~A~~k~~er~~~~~~~~~~~~e~kA~~Al~   80 (222)
T PRK10698          1 MGIFSRFADIVNANINALLEKAEDPQKLVRLMIQEMEDTLVEVRSTSARALAEKKQLTRRIEQAEAQQVEWQEKAELALR   80 (222)
T ss_pred             CCHHHHHHHHHHhHHHHHHHhhcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCC
Q 025526          156 KGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAKFVFPLSLLEFPVF  235 (251)
Q Consensus       156 ~G~EdLAreAL~rk~~~e~~~~~l~~ql~~~~~~v~~Lk~~l~~Le~ki~e~k~k~~~LkAr~~~AkAq~~vn~~l~~~~  235 (251)
                      +|+|||||+||.+|..++.++..|+.+++.+...+++|+.++.+|+.+|.+++.|+++|++|.++|+++.++++.+++++
T Consensus        81 ~G~EdLAr~AL~~K~~~~~~~~~l~~~~~~~~~~~~~L~~~l~~L~~ki~eak~k~~~L~aR~~~A~a~~~~~~~~~~~~  160 (222)
T PRK10698         81 KEKEDLARAALIEKQKLTDLIATLEHEVTLVDETLARMKKEIGELENKLSETRARQQALMLRHQAASSSRDVRRQLDSGK  160 (222)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhHHHHHHHH
Q 025526          236 SASATSLVLLV  246 (251)
Q Consensus       236 ~~~a~~~f~~~  246 (251)
                      +++++.+|+..
T Consensus       161 ~~~a~~~f~rm  171 (222)
T PRK10698        161 LDEAMARFESF  171 (222)
T ss_pred             cchHHHHHHHH
Confidence            99999999864



>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF03357 Snf7: Snf7; InterPro: IPR005024 This is a family of eukaryotic proteins which are variously described as either hypothetical protein, developmental protein or related to yeast SNF7 Back     alignment and domain information
>PTZ00446 vacuolar sorting protein SNF7-like; Provisional Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG2911 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PTZ00464 SNF-7-like protein; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG3232 consensus Vacuolar assembly/sorting protein DID2 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>KOG2910 consensus Uncharacterized conserved protein predicted to be involved in protein sorting [General function prediction only] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF05816 TelA: Toxic anion resistance protein (TelA); InterPro: IPR008863 This family consists of several prokaryotic TelA like proteins Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PRK08476 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK13454 F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK07720 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PRK09174 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR03545 conserved hypothetical protein TIGR03545 Back     alignment and domain information
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PRK05689 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>PLN02718 Probable galacturonosyltransferase Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>smart00685 DM14 Repeats in fly CG4713, worm Y37H9A Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>TIGR02473 flagell_FliJ flagellar export protein FliJ Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG1656 consensus Protein involved in glucose derepression and pre-vacuolar endosome protein sorting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15112 DUF4559: Domain of unknown function (DUF4559) Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>PLN02829 Probable galacturonosyltransferase Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14475 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07743 HSCB_C: HSCB C-terminal oligomerisation domain; InterPro: IPR009073 This entry represents the C-terminal oligomerisation domain found in HscB (heat shock cognate protein B), which is also known as HSC20 (20K heat shock cognate protein) Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.8 bits (105), Expect = 2e-05
 Identities = 27/205 (13%), Positives = 57/205 (27%), Gaps = 60/205 (29%)

Query: 36  PLTTSFFNGGVGALKVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAI-- 93
           P   S             +R   +     ++             D+L  +++S  N +  
Sbjct: 327 PRRLSII----AES----IRDGLA-TWDNWKH---------VNCDKLTTIIESSLNVLEP 368

Query: 94  ---------LSSFEDPEKILEQAVLEMNDDL-VKMRQATAQVLASQKRLENKCKAAEQAS 143
                    LS F     I    +L +   +   + ++   V+ ++  L       +Q  
Sbjct: 369 AEYRKMFDRLSVFPPSAHIPTI-LLSL---IWFDVIKSDVMVVVNK--LHKYSLVEKQPK 422

Query: 144 EDWYRKAQLALQKGEEDLAREALKRR-----------------KSYADN--ANAL----- 179
           E       + L+   +     AL R                    Y D    + +     
Sbjct: 423 ESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLK 482

Query: 180 KAQLDQQKNVVNNLVSNTRLLESKI 204
             +  ++  +   +  + R LE KI
Sbjct: 483 NIEHPERMTLFRMVFLDFRFLEQKI 507


>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 97.53
4abm_A79 Charged multivesicular BODY protein 4B; cell cycle 97.23
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.89
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.78
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.85
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.4
2gd5_A179 Charged multivesicular BODY protein 3; CHMP3, ESCR 95.03
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.94
3bas_A89 Myosin heavy chain, striated muscle/general contro 93.28
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 93.26
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 93.17
3ajw_A150 Flagellar FLIJ protein; flagellum, type III secret 92.46
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 92.33
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 91.72
3frt_A218 Charged multivesicular BODY protein 3; ESCRT, ESCR 91.69
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 91.63
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 91.32
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 90.96
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 90.9
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 90.8
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 90.7
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 90.43
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 90.31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 90.12
4fm3_A98 Uncharacterized hypothetical protein; PF14346 fami 89.91
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 89.62
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 89.6
1m1j_C 409 Fibrinogen gamma chain; coiled coils, disulfide ri 88.9
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 88.53
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 88.42
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 88.15
2v4h_A110 NF-kappa-B essential modulator; transcription, met 87.74
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 86.72
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 86.32
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 86.23
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 86.12
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 84.91
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.85
3ghg_B 461 Fibrinogen beta chain; triple-stranded coiled coil 84.29
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 84.15
3ghg_C 411 Fibrinogen gamma chain; triple-stranded coiled coi 83.43
1jcd_A52 Major outer membrane lipoprotein; protein folding, 82.11
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 80.97
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 80.06
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
Probab=97.53  E-value=0.0082  Score=56.38  Aligned_cols=121  Identities=16%  Similarity=0.144  Sum_probs=84.9

Q ss_pred             hHHHHHHHHHHHHHHhhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Q 025526           78 LFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKG  157 (251)
Q Consensus        78 if~Rl~~lira~in~~lDk~EDP~~mLdQ~Ireme~~L~kar~~lA~v~A~~k~le~k~~~~~~~~~~~e~rA~~AL~~G  157 (251)
                      -+..+.+++...+..++..-.||+..|+.+..++++.|.+.+... +..--...++++++++++...+.+.+|-.|=.  
T Consensus       349 ~~~~~~~~~~~~~~~vl~G~~t~eeal~~~~~~i~~~l~~~~~~~-e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  425 (471)
T 3mq9_A          349 QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITAARDGLRAVM-EARNVTHLLQQELTEAQKGFQDVEAQAATANH--  425 (471)
T ss_dssp             THHHHHHHHHHHHHHHHHSSSCHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
T ss_pred             cHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhhHHHH-HhhhHHHHHHHHHHHHhhhHHHHHHHhhhcch--
Confidence            356778888888899988888999999999999999998886655 77778889999999999999999999987621  


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 025526          158 EEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTL  214 (251)
Q Consensus       158 ~EdLAreAL~rk~~~e~~~~~l~~ql~~~~~~v~~Lk~~l~~Le~ki~e~k~k~~~L  214 (251)
                            ....=..+++.       ...+.+..+++|+..+.+++.+|++++.+.+.+
T Consensus       426 ------~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  469 (471)
T 3mq9_A          426 ------TVMALMASLDA-------EKAQGQKKVEELEGEITTLNHKLQDASAEVERL  469 (471)
T ss_dssp             ------HHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ------hHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence                  22222222333       333333455555555555555555555554444



>4abm_A Charged multivesicular BODY protein 4B; cell cycle, protein transport, HIV-1; 1.80A {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2gd5_A Charged multivesicular BODY protein 3; CHMP3, ESCRT-III, protein transport; 2.80A {Homo sapiens} PDB: 3frv_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3frt_A Charged multivesicular BODY protein 3; ESCRT, ESCRT-111, CHMP, IST1, coiled coil, cytoplasm, lipoprotein, membrane, myristate, phosphoprotein; 4.00A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fm3_A Uncharacterized hypothetical protein; PF14346 family protein, DUF4398, structural genomics, joint for structural genomics, JCSG; HET: PG4; 2.47A {Pseudomonas aeruginosa} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Back     alignment and structure
>1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 86.65
d1fpoa295 HSC20 (HSCB), C-terminal oligomerisation domain {E 84.35
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Prefoldin
family: Prefoldin
domain: Prefoldin beta subunit
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=86.65  E-value=2.7  Score=29.90  Aligned_cols=40  Identities=13%  Similarity=0.203  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 025526          108 VLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWY  147 (251)
Q Consensus       108 Ireme~~L~kar~~lA~v~A~~k~le~k~~~~~~~~~~~e  147 (251)
                      +.+.-..+..+++.+..+......++.++.+.....+.++
T Consensus         3 lqe~~~~~q~lq~el~~~~~q~~~le~q~~E~~~vl~eL~   42 (107)
T d1fxka_           3 VQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELS   42 (107)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4455566777777777777878888888877776666655



>d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure