Citrus Sinensis ID: 025542

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MAGIHWFGQTHQSVNRRSILGSIHGVKCCSGTVNDGNKNTNNKTATPQILKFAVSGVTELLRLFSSFDKGRLDKVSYKQKYEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSALEAVGQIFTPGDRN
cccccccccccccEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccHHHHHHHHHHHHHcccEEccccccccccccEEEcccccccccHHHHHHHHHHHHcccccccccEEHHEEEHHHHHHHccccccccccccccccccccccccccEEEEEEEEEEEEcccccEEEEEcccEEEEEcccccEEEEEEEccccHHHHHHHcccccccc
cccEEEcccHHHHHHHHHHHccEccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccEccccccHHHHccccEEcccccccccHHHHHHHHHHHHHHHccccccHccHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEEEEccccccEEEcccEEEEEEcccccEEEEEEcccccHHHHHHHHccccccc
magihwfgqthqsvnrRSILgsihgvkccsgtvndgnkntnnktatpQILKFAVSGVTELLRLFSSfdkgrldkvsyKQKYEILVSGIDDIVTILRSDYENAYFVTGIFtseiyaedcifedptirfrgtelysrnlrllvpffeypsiglqnIEKFVFLVSLMVGrregrmrglhnstalgghiFLLPYLLRISLICRTylklpwkplisidgstvyeLNDELKITRHAESWNVSALEAvgqiftpgdrn
magihwfgqthqsvNRRSILGSIHGVKCCSgtvndgnkntnnktatpQILKFAVSGVTELLRLFSsfdkgrldkvsykqkyEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHaeswnvsaleavgqiftpgdrn
MAGIHWFGQTHQSVNRRSILGSIHGVKCCSGTVNDGNKNTNNKTATPQILKFAVSGVTELLRLFSSFDKGRLDKVSYKQKYEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSALEAVGQIFTPGDRN
***IHWFGQTHQSVNRRSILGSIHGVKCCSGTVNDG*******TATPQILKFAVSGVTELLRLFSSFDKGRLDKVSYKQKYEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSALEAVGQIF******
***************************************************FAVSGVTELLR******************************TILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSALEAVGQIFTP****
MAGIHWFGQTHQSVNRRSILGSIHGVKCCSGTVNDGNKNTNNKTATPQILKFAVSGVTELLRLFSSFDKGRLDKVSYKQKYEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSALEAVGQIFTPGDRN
*AGIHWFGQTHQSVNRRSILGSIHGVKCCSG**************TPQILKFAVSGVTELLRLFS********************SGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRR*****GL*N****GGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSALEAVGQIFTP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGIHWFGQTHQSVNRRSILGSIHGVKCCSGTVNDGNKNTNNKTATPQILKFAVSGVTELLRLFSSFDKGRLDKVSYKQKYEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSALEAVGQIFTPGDRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
225451265242 PREDICTED: uncharacterized protein LOC10 0.788 0.818 0.592 4e-67
298204898216 unnamed protein product [Vitis vinifera] 0.836 0.972 0.580 4e-67
449442907217 PREDICTED: uncharacterized protein LOC10 0.788 0.912 0.528 3e-57
224125592199 predicted protein [Populus trichocarpa] 0.701 0.884 0.539 1e-55
351720803255 uncharacterized protein LOC100306700 [Gl 0.768 0.756 0.523 3e-52
297828994216 predicted protein [Arabidopsis lyrata su 0.820 0.953 0.5 5e-51
357441471238 hypothetical protein MTR_1g081280 [Medic 0.752 0.794 0.504 1e-48
21537187216 unknown [Arabidopsis thaliana] 0.693 0.805 0.529 3e-48
18397041216 uncharacterized protein [Arabidopsis tha 0.693 0.805 0.529 3e-48
218199281246 hypothetical protein OsI_25317 [Oryza sa 0.713 0.727 0.448 3e-42
>gi|225451265|ref|XP_002272524.1| PREDICTED: uncharacterized protein LOC100264176 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  260 bits (664), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 164/233 (70%), Gaps = 35/233 (15%)

Query: 16  RRSILGSIHGVKCCSGTVNDGNKNTNNKTATPQILKFAVSGVTELLRLFSSFDKGRLDKV 75
           R+ +   +HG++CCS T        +NK  TPQ+L+ AV GVTELLRL S F + RLD +
Sbjct: 39  RQHLQKRVHGIRCCSTT-------PDNKEKTPQLLRIAVGGVTELLRLVS-FGQNRLDSM 90

Query: 76  SYKQKYEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSR 135
           SYKQ  E+LVS IDD++ IL+SDYENAYFVTGIFTS IY EDCIFEDPTI+FRG +LYSR
Sbjct: 91  SYKQGDELLVSCIDDVLLILKSDYENAYFVTGIFTSAIYDEDCIFEDPTIKFRGKDLYSR 150

Query: 136 NLRLLVPFFEYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRIS 195
           NL+LLVPFF++PSI LQ IEK                 G ++ T      F+L      S
Sbjct: 151 NLKLLVPFFDHPSIALQKIEK-----------------GSNSETK-----FVLA-----S 183

Query: 196 LICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSALEAVGQIFTPG 248
              RTYLKLPW+PLISI GSTVY+LNDE KI RHAESWN+SAL+AVGQIFTP 
Sbjct: 184 WKLRTYLKLPWRPLISIAGSTVYDLNDEFKIVRHAESWNISALQAVGQIFTPS 236

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|298204898|emb|CBI34205.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442907|ref|XP_004139222.1| PREDICTED: uncharacterized protein LOC101220191 [Cucumis sativus] gi|449482948|ref|XP_004156451.1| PREDICTED: uncharacterized LOC101220191 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224125592|ref|XP_002319624.1| predicted protein [Populus trichocarpa] gi|222858000|gb|EEE95547.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351720803|ref|NP_001235141.1| uncharacterized protein LOC100306700 [Glycine max] gi|255629317|gb|ACU15003.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297828994|ref|XP_002882379.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328219|gb|EFH58638.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357441471|ref|XP_003591013.1| hypothetical protein MTR_1g081280 [Medicago truncatula] gi|355480061|gb|AES61264.1| hypothetical protein MTR_1g081280 [Medicago truncatula] Back     alignment and taxonomy information
>gi|21537187|gb|AAM61528.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18397041|ref|NP_566242.1| uncharacterized protein [Arabidopsis thaliana] gi|13878017|gb|AAK44086.1|AF370271_1 unknown protein [Arabidopsis thaliana] gi|17104639|gb|AAL34208.1| unknown protein [Arabidopsis thaliana] gi|332640630|gb|AEE74151.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|218199281|gb|EEC81708.1| hypothetical protein OsI_25317 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2114875221 AT3G04890 "AT3G04890" [Arabido 0.442 0.502 0.589 1.3e-29
TAIR|locus:2062989240 AT2G46100 "AT2G46100" [Arabido 0.593 0.620 0.266 7e-12
TAIR|locus:2114875 AT3G04890 "AT3G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 328 (120.5 bits), Expect = 1.3e-29, P = 1.3e-29
 Identities = 66/112 (58%), Positives = 80/112 (71%)

Query:    46 TPQILKFAVSGVTELLRLFSSFDKGRLDKVSY-KQKYEILVSGIDDIVTILRSDYENAYF 104
             TP +LK+AVSGVTE LRL S          +  + K E+    +DD++ ILRSDY N YF
Sbjct:    34 TPAVLKWAVSGVTEFLRLISGAPSSTSIATNKDRSKNEVTAGDVDDVMGILRSDYRNFYF 93

Query:   105 VTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIEK 156
             VTG+ TS IY++DCIFEDPTI F+GTELY RNL+LLVPF E  SI LQN+EK
Sbjct:    94 VTGVLTSAIYSDDCIFEDPTISFQGTELYERNLKLLVPFLEDASIELQNMEK 145
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2062989 AT2G46100 "AT2G46100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00130351
hypothetical protein (199 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
pfam10184113 pfam10184, DUF2358, Uncharacterized conserved prot 5e-19
>gnl|CDD|220621 pfam10184, DUF2358, Uncharacterized conserved protein (DUF2358) Back     alignment and domain information 
 Score = 79.2 bits (196), Expect = 5e-19
 Identities = 36/145 (24%), Positives = 54/145 (37%), Gaps = 36/145 (24%)

Query: 89  DDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRN---LRLLVP-FF 144
            D +  LR D     F        IY++D  FEDP  +FRG + Y RN   +R L   FF
Sbjct: 1   ADAIEALREDLPR-LFPKDQ-DYSIYSDDVYFEDPLNKFRGIDRYKRNFWLIRFLGRLFF 58

Query: 145 EYPSIGLQNIEKFVFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKL 204
               + L +I +                                   ++         +L
Sbjct: 59  ADIRLELHDITQ------------------------------TPEDTIKTRWTLSGIPRL 88

Query: 205 PWKPLISIDGSTVYELNDELKITRH 229
           PWKP ++ DG++ Y+LN +  I  H
Sbjct: 89  PWKPRLTFDGTSTYKLNSDGLIYSH 113

DUF2358 is a family of conserved proteins found from plants to humans. The function is unknown. Length = 113

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
PF10184113 DUF2358: Uncharacterized conserved protein (DUF235 99.96
TIGR02096129 conserved hypothetical protein, steroid delta-isom 99.26
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 99.16
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 99.0
PF07366126 SnoaL: SnoaL-like polyketide cyclase; InterPro: IP 98.88
KOG4457202 consensus Uncharacterized conserved protein [Funct 98.59
PF07858125 LEH: Limonene-1,2-epoxide hydrolase catalytic doma 98.0
PRK08241339 RNA polymerase factor sigma-70; Validated 97.87
TIGR02960324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 97.48
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 96.83
COG4319137 Ketosteroid isomerase homolog [Function unknown] 96.22
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 95.57
TIGR02246128 conserved hypothetical protein. This family consis 95.5
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 94.34
COG3631133 Ketosteroid isomerase-related protein [General fun 91.92
COG5485131 Predicted ester cyclase [General function predicti 88.1
COG4308130 LimA Limonene-1,2-epoxide hydrolase [Secondary met 84.48
>PF10184 DUF2358: Uncharacterized conserved protein (DUF2358); InterPro: IPR018790 This entry represents a family of conserved proteins Back     alignment and domain information 
Probab=99.96  E-value=1.5e-28  Score=196.96  Aligned_cols=108  Identities=40%  Similarity=0.686  Sum_probs=98.8

Q ss_pred             HHHHHHHHHhhhhhcccCCccccccccceeeeCCCccccChHHHHHH---HHHhhc-cccCceEEEeeeeEeeeeehhhc
Q 025542           90 DIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRN---LRLLVP-FFEYPSIGLQNIEKFVFLVSLMV  165 (251)
Q Consensus        90 ~ll~~L~~Dy~~~Yfvtg~~~~~iY~eD~~F~DP~~~f~Gld~y~~~---~~~L~~-~~~~~~f~l~~~e~~~~~~~~~~  165 (251)
                      +++++|++||+++|  +|+++.+||++||.|+||+++|+|+++|+++   ++.|.. +|.+++++++++++.+       
T Consensus         2 ~~~~~Lr~D~~~~f--~~~~~~~iY~~dv~F~Dp~~~f~g~~~Y~~~~~~l~~l~~~~~~~~~~~v~~i~~~~-------   72 (113)
T PF10184_consen    2 DVIRTLREDLPRFF--TGDLDYSIYDEDVVFIDPIVSFKGLDRYKRNLWALRFLGRLFFSDPSLEVLSIEQDG-------   72 (113)
T ss_pred             hHHHHHHHHHHHHh--cCCCChhhcCCCeEEECCCCceecHHHHHHHHHHHHHHHhhccCCcEEEEEEEEECC-------
Confidence            57899999999875  9999999999999999999999999999999   777777 7889999999998632       


Q ss_pred             cccccccccccccccCCCceeeccceeeEEEEEEEEeeCCCCCeeEEEEEEEEEEcCCCCEEEE
Q 025542          166 GRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRH  229 (251)
Q Consensus       166 ~~~e~~~~~~~~~~~~~g~~~i~p~~v~~~Wrm~~~lkLPw~P~i~v~G~T~~~fd~~GkI~~H  229 (251)
                                             +++|+++|+|++.+++||+|.+.++|.|+|++|++|+|++|
T Consensus        73 -----------------------~~~I~~rW~~~g~~~l~w~p~~~~~G~S~~~ln~~g~I~~H  113 (113)
T PF10184_consen   73 -----------------------EDTIRARWRLRGVPRLPWRPRISFDGTSTYTLNSDGLIYRH  113 (113)
T ss_pred             -----------------------CCEEEEEEEEEEEeCCCcCCcEEEEEEEEEEECCCCcEEeC
Confidence                                   12466999999999999999999999999999999999998

The function is unknown.
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis Back     alignment and domain information
>KOG4457 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>COG3631 Ketosteroid isomerase-related protein [General function prediction only] Back     alignment and domain information
>COG5485 Predicted ester cyclase [General function prediction only] Back     alignment and domain information
>COG4308 LimA Limonene-1,2-epoxide hydrolase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
3rga_A283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 99.46
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 99.45
3dxo_A121 Uncharacterized snoal-like protein; putative isome 99.42
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 99.39
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 99.39
3rga_A 283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 99.38
3hk4_A136 MLR7391 protein; NTF2-like protein, structural gen 99.3
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 99.28
2f99_A153 Aklanonic acid methyl ester cyclase, AKNH; anthrac 99.28
3k0z_A159 Putative polyketide cyclase; structural genomics, 99.28
3f9s_A146 Putative polyketide cyclase; structural genomics, 99.28
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 99.26
3mso_A143 Steroid delta-isomerase; structural genomics, join 99.24
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 99.24
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 99.23
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 99.22
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 99.21
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 99.21
3kkg_A146 Putative snoal-like polyketide cyclase; structural 99.19
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 99.19
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 99.17
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 99.15
3h3h_A122 Uncharacterized snoal-like protein; structural gen 99.14
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 99.12
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 99.09
3f7x_A151 Putative polyketide cyclase; structural genomics, 99.09
3f8x_A148 Putative delta-5-3-ketosteroid isomerase; structur 99.02
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 98.98
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 98.98
3f8h_A150 Putative polyketide cyclase; structural genomics, 98.98
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 98.95
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 98.92
3g8z_A148 Protein of unknown function with cystatin-like FO; 98.91
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 98.9
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 98.84
3g16_A156 Uncharacterized protein with cystatin-like fold; Y 98.83
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 98.65
2k54_A123 Protein ATU0742; protein of unknown function, stru 98.59
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 98.58
3dmc_A134 NTF2-like protein; structural genomics, joint cent 98.47
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 98.4
3g0k_A148 Putative membrane protein; snoal-like polyketide c 98.38
3ff0_A163 Phenazine biosynthesis protein PHZB 2; cystatin-li 98.35
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 98.23
3flj_A155 Uncharacterized protein conserved in bacteria WIT 98.18
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 98.14
3h51_A156 Putative calcium/calmodulin dependent protein KIN 97.85
3ke7_A134 Putative ketosteroid isomerase; structural genomic 97.77
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 97.68
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 97.59
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 97.47
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 97.47
3gzb_A154 Putative snoal-like polyketide cyclase; YP_0011826 97.41
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 97.4
3rob_A139 Uncharacterized conserved protein; structural geno 97.35
3bb9_A148 Putative orphan protein; structural genomics, join 97.28
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 96.84
3cu3_A172 Domain of unknown function with A cystatin-like F; 96.27
3lyg_A120 NTF2-like protein of unknown function; structural 96.23
2rfr_A155 Uncharacterized protein; structural genomics, join 96.01
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 95.71
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 95.52
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 95.03
1tp6_A128 Hypothetical protein PA1314; structural genomics, 94.83
3soy_A145 NTF2-like superfamily protein; structural genomics 94.69
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 94.63
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 94.61
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 93.86
3ef8_A150 Putative scyalone dehydratase; YP_496742.1, struct 93.74
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 93.7
3fsd_A134 NTF2-like protein of unknown function in nutrient; 93.42
3ecf_A130 NTF2-like protein; structural genomics, joint cent 93.33
2f86_B143 Hypothetical protein K11E8.1D; UNC-43, oligomeriza 90.56
2rgq_A144 Domain of unknown function with A cystatin-like F; 90.42
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 89.17
3ejv_A179 Uncharacterized protein with cystatin-like fold; s 87.46
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 81.42
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
Probab=99.46  E-value=6.1e-13  Score=119.35  Aligned_cols=118  Identities=16%  Similarity=0.119  Sum_probs=90.1

Q ss_pred             CHHHHHHHHHHHhhhhhcccCC--ccccccccceeeeCCCc--cccChHHHHHHHHHhhccccCceEEEeeeeEeeeeeh
Q 025542           87 GIDDIVTILRSDYENAYFVTGI--FTSEIYAEDCIFEDPTI--RFRGTELYSRNLRLLVPFFEYPSIGLQNIEKFVFLVS  162 (251)
Q Consensus        87 ~~~~ll~~L~~Dy~~~Yfvtg~--~~~~iY~eD~~F~DP~~--~f~Gld~y~~~~~~L~~~~~~~~f~l~~~e~~~~~~~  162 (251)
                      +.+++.+.+++.|+..  .+++  .+.++|++||+|.||..  .++|++++++++..+... .. .+.+......     
T Consensus       136 ~~~~~~~~v~~~~~a~--~~~D~~~l~~l~a~D~v~~~P~~~~~~~G~~ai~~~~~~~~~~-~~-~~~~~~~~~~-----  206 (283)
T 3rga_A          136 DEERRKELAREHCLRI--NDGDVDGLLKLYSPRIRFEDPVGSWTRTGLEALRAHATMAVGS-NV-RETAGLTVAG-----  206 (283)
T ss_dssp             HHHHHHHHHHHHHHHH--HTTCHHHHHTTEEEEEEEESSTTSCEEESHHHHHHHHHHHHHT-TC-EEEEEEEEEC-----
T ss_pred             ChHHHHHHHHHHHHHH--HcCCHHHHHHhcCCCeEEECCCCCCcccCHHHHHHHHHHhhcc-Cc-EEEEeeEEec-----
Confidence            4455566666666644  6777  78999999999999986  589999999999999876 32 4433332210     


Q ss_pred             hhccccccccccccccccCCCceeeccceeeEEEEEEEE-----------------ee-CCCCCeeEEEEEEEEEEcCCC
Q 025542          163 LMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTY-----------------LK-LPWKPLISIDGSTVYELNDEL  224 (251)
Q Consensus       163 ~~~~~~e~~~~~~~~~~~~~g~~~i~p~~v~~~Wrm~~~-----------------lk-LPw~P~i~v~G~T~~~fd~~G  224 (251)
                                       ..|+.+.       ++|+|++.                 |+ +|-+..+.++|++.|+||++|
T Consensus       207 -----------------~~g~~aa-------~~~~~~~~y~~~g~~~~~~g~~~~~~p~~~~G~~~~~~g~~~~~~~~dG  262 (283)
T 3rga_A          207 -----------------QDGRHAA-------VTVSATMDYLPSGPLLARHHLMTLPAPADPHRALIGIEYVMVIGVDADG  262 (283)
T ss_dssp             -----------------TTSSEEE-------EEEEEEEESTTHHHHHHHTTSCCSCCCSCTTTCEEEEEEEEEEEECTTS
T ss_pred             -----------------CCCCEEE-------EEEEEEEEeecccccccccccccccCCcCCCCceEEEEEEEEEEECCCc
Confidence                             1233454       99999998                 22 466778999999999999889


Q ss_pred             CEEEEEEeccCCh
Q 025542          225 KITRHAESWNVSA  237 (251)
Q Consensus       225 kI~~H~DyWD~sa  237 (251)
                      ||++|++|||.+.
T Consensus       263 kI~~~r~yw~~~d  275 (283)
T 3rga_A          263 LIDEMRAYWGATD  275 (283)
T ss_dssp             CEEEEEEECCGGG
T ss_pred             cEEEEEEeeChhh
Confidence            9999999999875
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} Back     alignment and structure
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Back     alignment and structure
>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea} Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 Back     alignment and structure
>3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21 Back     alignment and structure
>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 Back     alignment and structure
>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28 Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 99.38
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 99.38
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 99.35
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 99.32
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 99.32
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 99.14
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 99.12
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 99.09
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 99.06
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 99.03
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 99.02
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 99.02
d2f99a1140 Aklanonic acid methyl ester cyclase, AknH {Strepto 98.96
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 98.76
d1sjwa_142 Nogalonic acid methyl ester cyclase SnoaL {Strepto 98.75
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 98.72
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 98.6
d1tuha_131 Hypothetical protein egc068 from a soil-derived mo 98.45
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 97.98
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 97.76
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 97.05
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 96.76
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 96.58
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 96.23
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 96.09
d3b8la1144 Uncharacterized protein Saro3538 {Novosphingobium 95.72
d3er7a1118 Uncharacterized protein Exig0174 {Exiguobacterium 95.47
d3ef8a1149 Uncharacterized protein Saro1465 {Novosphingobium 95.19
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 94.86
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 94.74
d2ux0a1135 Association domain of calcium/calmodulin-dependent 94.63
d2chca1167 Uncharacterized protein Rv3472 {Mycobacterium tube 94.43
d2rfra1153 Uncharacterized protein Saro3722 {Novosphingobium 93.91
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 89.72
d3ejva1159 Uncharacterized protein Saro2766 {Novosphingobium 88.45
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 87.47
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 82.81
d2f86b1129 Association domain of calcium/calmodulin-dependent 81.0
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: Ketosteroid isomerase-like
domain: Hypothetical protein Rv0760c
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.38  E-value=3.8e-12  Score=96.32  Aligned_cols=116  Identities=14%  Similarity=0.108  Sum_probs=85.4

Q ss_pred             HHHHHHHHHHhhhhhcccCC--ccccccccceeeeCCCc---------cccChHHHHHHHHHhhccccCceEEEeeeeEe
Q 025542           89 DDIVTILRSDYENAYFVTGI--FTSEIYAEDCIFEDPTI---------RFRGTELYSRNLRLLVPFFEYPSIGLQNIEKF  157 (251)
Q Consensus        89 ~~ll~~L~~Dy~~~Yfvtg~--~~~~iY~eD~~F~DP~~---------~f~Gld~y~~~~~~L~~~~~~~~f~l~~~e~~  157 (251)
                      +++++.+++.|+..  ..+|  -..++|++||+|.||.+         .++|++++...+..+..... ..+.+......
T Consensus         3 ~p~~~~~~~~~~a~--~~~D~~~~~~l~a~D~~~~~P~~~~~~~~~~~~~~G~~ai~~~~~~~~~~~~-~~~~~~~~~~~   79 (132)
T d2a15a1           3 SPALIASQSSWRCV--QAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANR-LTVTCEETFPS   79 (132)
T ss_dssp             CHHHHHHHHHHHHH--HTTCHHHHHHTEEEEEEEESSSSSBTTBTTSSCEESHHHHHHHHHHHTTTTT-CEEEEEEEEEC
T ss_pred             chHHHHHHHHHHHH--HcCCHHHHHHHcCCCeEEEccCCccccCccchheehHHHHHHhhhhhhcccc-ceEEEEEEEEe
Confidence            35678888888754  6787  77899999999999974         47899999999988865443 23333332211


Q ss_pred             eeeehhhccccccccccccccccCCCceeeccceeeEEEEEEEEeeCCCCCeeEEEEEEEEEEcCCCCEEEEEEeccCCh
Q 025542          158 VFLVSLMVGRREGRMRGLHNSTALGGHIFLLPYLLRISLICRTYLKLPWKPLISIDGSTVYELNDELKITRHAESWNVSA  237 (251)
Q Consensus       158 ~~~~~~~~~~~e~~~~~~~~~~~~~g~~~i~p~~v~~~Wrm~~~lkLPw~P~i~v~G~T~~~fd~~GkI~~H~DyWD~sa  237 (251)
                                              +++..     +...|++++..  +-+..+.+.|++.++||++|||+++++|||+++
T Consensus        80 ------------------------~~~~~-----v~~~~~~~~~~--~~G~~~~~~~v~~~~~~~dGkI~~~~~y~D~~~  128 (132)
T d2a15a1          80 ------------------------SSPDE-----IAHILVLHSEF--DGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDM  128 (132)
T ss_dssp             ------------------------SSTTE-----EEEEEEEEEEE--TTTEEEEEEEEEEEEECTTSCEEEEEEECCGGG
T ss_pred             ------------------------cCCcE-----EEEEEEEeecc--ccceeEEEEEEEEEEEcCCCeEEEEEEEECccc
Confidence                                    11122     33777776654  356779999999999998899999999999876


Q ss_pred             h
Q 025542          238 L  238 (251)
Q Consensus       238 ~  238 (251)
                      .
T Consensus       129 ~  129 (132)
T d2a15a1         129 M  129 (132)
T ss_dssp             C
T ss_pred             c
Confidence            4
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} Back     information, alignment and structure
>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure