Citrus Sinensis ID: 025563

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MVLEASMEDNHHKRAIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFFSFWPF
cccccccccccccccHHcHHHHHHcccccEEccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHcccEEEcccccccccHHHHHHcHHHHHHccccccccEEEEcccccccccHHHHHHHHcccccEEEEEcccccccccccccccccEEEEcccEEEEEcccccc
ccccccccccccccHHHHHHHHHHccccEEEEccccccccccEEEEEcccccccEcHHHHHHHHHHHHHHccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHcHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEEEEEEEEEEccccc
mvleasmednhhkrAIKKDATqligntpmvylNNVVDGCVARIAAKLEmmepccsvKDRIALSMIKDAeekglitpgksvliettggntGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVyladqaggfegILRKGeeilsntpngfmfrqfenpanpkihyettgpeiwkdsggdvDILVAGIgtggtvtgsgrflkeknpnikvygveptesamlnggqpgRLLFFLFFLFFFCfffsfwpf
mvleasmednhhkraikkdatqliGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGgtvtgsgrflkeknpnIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFFSFWPF
MVLEASMEDNHHKRAIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAgigtggtvtgsgRFLKEKNPNIKVYGVEPTESAMLNGGQPGRllfflfflfffcfffsfWPF
*******************ATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFFSFW**
*****************KDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFFSFWPF
************KRAIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFFSFWPF
************KRAIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFFSFWPF
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLEASMEDNHHKRAIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFFSFWPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
P31300374 Cysteine synthase, chloro N/A no 0.856 0.574 0.716 3e-84
O81155386 Cysteine synthase, chloro N/A no 0.856 0.556 0.716 2e-83
Q43317325 Cysteine synthase OS=Citr N/A no 0.868 0.670 0.720 3e-83
P47999392 Cysteine synthase, chloro no no 0.856 0.548 0.716 4e-83
F4K5T2323 Bifunctional cystathionin no no 0.896 0.696 0.714 6e-82
Q9XEA8325 Cysteine synthase OS=Oryz no no 0.864 0.667 0.700 2e-80
O81154325 Cysteine synthase OS=Sola N/A no 0.872 0.673 0.698 2e-80
O23733322 Cysteine synthase OS=Bras N/A no 0.856 0.667 0.697 3e-80
Q43725430 Cysteine synthase, mitoch no no 0.856 0.5 0.688 6e-80
P47998322 Cysteine synthase OS=Arab no no 0.856 0.667 0.697 7e-80
>sp|P31300|CYSKP_CAPAN Cysteine synthase, chloroplastic/chromoplastic OS=Capsicum annuum PE=2 SV=1 Back     alignment and function desciption
 Score =  311 bits (797), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 154/215 (71%), Positives = 186/215 (86%)

Query: 16  IKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLIT 75
           I +D TQLIGNTPMVYLN +V GCVA IAAKLE+MEPCCSVKDRI  SMI DAEEKGLI+
Sbjct: 67  IAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLIS 126

Query: 76  PGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGG 135
           PGK+VL+E T GNTGIGLAFIAA RGYKLI+ MP+  S+ERR++L+A GAE+ L D A G
Sbjct: 127 PGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAKG 186

Query: 136 FEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGG 195
            +G + K EEIL+NTP+ ++ +QF+NPANPKIHYETTGPEIW+D+ G +DILVAGIGTGG
Sbjct: 187 MKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTGG 246

Query: 196 TVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPG 230
           T++G+GR+LKEKNPNIK+ GVEPTES +L+GG+PG
Sbjct: 247 TISGTGRYLKEKNPNIKIIGVEPTESNVLSGGKPG 281

Capsicum annuum (taxid: 4072)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 4EC: 7
>sp|O81155|CYSKP_SOLTU Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function description
>sp|P47999|CYSKP_ARATH Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=OASB PE=1 SV=2 Back     alignment and function description
>sp|F4K5T2|CGL_ARATH Bifunctional cystathionine gamma-lyase/cysteine synthase OS=Arabidopsis thaliana GN=DES1 PE=1 SV=1 Back     alignment and function description
>sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 Back     alignment and function description
>sp|O81154|CYSK_SOLTU Cysteine synthase OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description
>sp|Q43725|CYSKM_ARATH Cysteine synthase, mitochondrial OS=Arabidopsis thaliana GN=OASC PE=1 SV=3 Back     alignment and function description
>sp|P47998|CYSK1_ARATH Cysteine synthase OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
363814498324 uncharacterized protein LOC100775420 [Gl 0.876 0.679 0.745 2e-95
351724467324 cysteine synthase [Glycine max] gi|12650 0.876 0.679 0.727 2e-93
255636625242 unknown [Glycine max] 0.872 0.904 0.735 3e-93
255542388332 cysteine synthase, putative [Ricinus com 0.916 0.692 0.769 4e-90
356557036321 PREDICTED: cysteine synthase-like [Glyci 0.860 0.672 0.777 7e-88
224130748331 predicted protein [Populus trichocarpa] 0.880 0.667 0.761 3e-87
255542384256 cysteine synthase, putative [Ricinus com 0.884 0.867 0.76 8e-87
388508804323 unknown [Medicago truncatula] 0.876 0.681 0.740 8e-87
359487834323 PREDICTED: cysteine synthase-like [Vitis 0.876 0.681 0.768 8e-87
359487838323 PREDICTED: cysteine synthase-like [Vitis 0.876 0.681 0.763 2e-86
>gi|363814498|ref|NP_001242884.1| uncharacterized protein LOC100775420 [Glycine max] gi|255645072|gb|ACU23035.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 164/220 (74%), Positives = 194/220 (88%)

Query: 15  AIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLI 74
           AIKKDAT+L+GNTPMV+LNN+V GCVARIAAKLE M+ CCSVKDRIALSMI+DAE+KGLI
Sbjct: 7   AIKKDATELVGNTPMVFLNNIVVGCVARIAAKLEYMQACCSVKDRIALSMIEDAEKKGLI 66

Query: 75  TPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAG 134
           TPGK+VL+E T GNTGIGLAFIAALRGYKL + MPS  S+ER+I+LRA GAEVYL D A 
Sbjct: 67  TPGKTVLVEYTSGNTGIGLAFIAALRGYKLQVTMPSYVSLERKIILRAFGAEVYLTDPAK 126

Query: 135 GFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTG 194
           G +G+++K EE+L+ TP+ FM  QFENPANP IHYETTGPEIW+DSGG +D LVAGIGTG
Sbjct: 127 GIDGVIQKAEELLAKTPDSFMLNQFENPANPNIHYETTGPEIWRDSGGKIDALVAGIGTG 186

Query: 195 GTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLF 234
           G++ G+GRFL+EKNP+IK+YGVEP ESA+LNGGQPG+ L 
Sbjct: 187 GSIAGAGRFLREKNPDIKLYGVEPAESAVLNGGQPGKHLI 226

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351724467|ref|NP_001235267.1| cysteine synthase [Glycine max] gi|126508784|gb|ABO15567.1| cysteine synthase [Glycine max] Back     alignment and taxonomy information
>gi|255636625|gb|ACU18650.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255542388|ref|XP_002512257.1| cysteine synthase, putative [Ricinus communis] gi|223548218|gb|EEF49709.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356557036|ref|XP_003546824.1| PREDICTED: cysteine synthase-like [Glycine max] Back     alignment and taxonomy information
>gi|224130748|ref|XP_002328366.1| predicted protein [Populus trichocarpa] gi|222838081|gb|EEE76446.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542384|ref|XP_002512255.1| cysteine synthase, putative [Ricinus communis] gi|223548216|gb|EEF49707.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388508804|gb|AFK42468.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|359487834|ref|XP_003633659.1| PREDICTED: cysteine synthase-like [Vitis vinifera] gi|298204916|emb|CBI34223.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487838|ref|XP_003633660.1| PREDICTED: cysteine synthase-like [Vitis vinifera] gi|298204917|emb|CBI34224.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2114804324 CYSD1 "cysteine synthase D1" [ 0.884 0.685 0.665 2.1e-77
TAIR|locus:2143814323 CYSD2 "cysteine synthase D2" [ 0.880 0.684 0.691 5.5e-77
TAIR|locus:2043964392 OASB "O-acetylserine (thiol) l 0.856 0.548 0.669 1e-75
TAIR|locus:2143754323 DES1 "L-cysteine desulfhydrase 0.880 0.684 0.678 1.3e-75
TAIR|locus:2130419322 OASA1 "O-acetylserine (thiol) 0.856 0.667 0.651 4e-74
TAIR|locus:2080417433 OASC "O-acetylserine (thiol) l 0.856 0.496 0.641 1.6e-72
UNIPROTKB|Q1KLZ2376 CAS1 "L-3-cyanoalanine synthas 0.856 0.571 0.553 1.1e-64
UNIPROTKB|Q1KLZ1375 CAS2 "L-3-cyanoalanine synthas 0.856 0.573 0.553 2.9e-64
UNIPROTKB|Q43153368 CYSC "Bifunctional L-3-cyanoal 0.856 0.584 0.558 3.7e-64
UNIPROTKB|Q76MX2351 PCAS-1 "Bifunctional L-3-cyano 0.856 0.612 0.548 1.2e-63
TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 779 (279.3 bits), Expect = 2.1e-77, P = 2.1e-77
 Identities = 149/224 (66%), Positives = 178/224 (79%)

Query:     7 MEDNHHKRAIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIK 66
             ME++  + +IK DATQLIGNTPMVYLNN+VDGCVARIAAKLEMMEPC SVK+RIA  MIK
Sbjct:     1 MEED--RCSIKDDATQLIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKERIAYGMIK 58

Query:    67 DAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAE 126
             DAE+KGLITPGKS LIE T GNTGIGLAFI A +GYK+++ MPS  S+ER+I+L ALGAE
Sbjct:    59 DAEDKGLITPGKSTLIEATSGNTGIGLAFIGAAKGYKVVLTMPSSMSLERKIILLALGAE 118

Query:   127 VYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDI 186
             V+L D + G +GI+ K EEI S  P+  M  QF+NP+NP+ HY TTGPEIW+DS G+VDI
Sbjct:   119 VHLTDPSKGVQGIIDKAEEICSKNPDSIMLEQFKNPSNPQTHYRTTGPEIWRDSAGEVDI 178

Query:   187 LVAXXXXXXXXXXXXRFLKEKNPNIKVYGVEPTESAMLNGGQPG 230
             LVA            RFLKEKN + KVYGVEPTESA+++GG+PG
Sbjct:   179 LVAGVGTGGTLSGSGRFLKEKNKDFKVYGVEPTESAVISGGKPG 222
GO:0003824 "catalytic activity" evidence=IEA
GO:0004124 "cysteine synthase activity" evidence=IEA;ISS;IDA;IMP
GO:0006535 "cysteine biosynthetic process from serine" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0019344 "cysteine biosynthetic process" evidence=ISS;RCA;IDA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009069 "serine family amino acid metabolic process" evidence=RCA
GO:0042545 "cell wall modification" evidence=RCA
TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143754 DES1 "L-cysteine desulfhydrase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ1 CAS2 "L-3-cyanoalanine synthase 2, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q43153 CYSC "Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0A535CYSK_MYCBO2, ., 5, ., 1, ., 4, 70.50460.85650.6935yesno
P0A534CYSK_MYCTU2, ., 5, ., 1, ., 4, 70.50460.85650.6935yesno
P37887CYSK_BACSU2, ., 5, ., 1, ., 4, 70.53550.82860.6753yesno
O32978CYSK_MYCLE2, ., 5, ., 1, ., 4, 70.50920.85650.6935yesno
Q43317CYSK_CITLA2, ., 5, ., 1, ., 5, 20.72010.86850.6707N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.3.1LOW CONFIDENCE prediction!
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00700110
hypothetical protein (331 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pm.C_LG_XV0472
serine O-acetyltransferase (EC-2.3.1.30) (293 aa)
• •  •• 0.941
estExt_fgenesh4_pg.C_410108
serine O-acetyltransferase (EC-2.3.1.30) (294 aa)
• •  •• 0.940
estExt_fgenesh4_pm.C_LG_I1139
serine O-acetyltransferase (EC-2.3.1.30) (334 aa)
  •  •• 0.937
estExt_fgenesh4_pg.C_LG_V0392
hypothetical protein (395 aa)
  •  •• 0.924
gw1.IX.3567.1
sulfite reductase (EC-1.8.7.1) (576 aa)
     •• 0.914
gw1.I.1513.1
sulfite reductase (EC-1.8.7.1) (634 aa)
     •• 0.913
estExt_Genewise1_v1.C_LG_I4741
phosphateglycerate kinase (EC-2.5.1.47) (424 aa)
  •  •••0.908
gw1.XIV.1323.1
cysteine synthase/L-3-cyanoalanine synthase (EC-4.4.1.9) (342 aa)
  •  • •0.902
grail3.0039007102
RecName- Full=Cysteine synthase; EC=2.5.1.47; (375 aa)
  •  • •0.902
gw1.142.135.1
hypothetical protein (336 aa)
  •  • •0.901

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
PLN00011323 PLN00011, PLN00011, cysteine synthase 1e-128
PLN02565322 PLN02565, PLN02565, cysteine synthase 1e-127
PLN02556368 PLN02556, PLN02556, cysteine synthase/L-3-cyanoala 1e-111
TIGR01136299 TIGR01136, cysKM, cysteine synthase 1e-110
PLN03013429 PLN03013, PLN03013, cysteine synthase 1e-109
cd01561291 cd01561, CBS_like, CBS_like: This subgroup include 1e-106
TIGR01139298 TIGR01139, cysK, cysteine synthase A 1e-104
COG0031300 COG0031, CysK, Cysteine synthase [Amino acid trans 1e-101
PRK10717330 PRK10717, PRK10717, cysteine synthase A; Provision 2e-81
PRK11761296 PRK11761, cysM, cysteine synthase B; Provisional 2e-77
TIGR01137 454 TIGR01137, cysta_beta, cystathionine beta-synthase 4e-70
TIGR01138290 TIGR01138, cysM, cysteine synthase B 1e-66
cd00640244 cd00640, Trp-synth-beta_II, Tryptophan synthase be 1e-64
TIGR03945304 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio 5e-60
pfam00291295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 2e-52
PLN02356 423 PLN02356, PLN02356, phosphateglycerate kinase 2e-44
cd01562304 cd01562, Thr-dehyd, Threonine dehydratase: The fir 1e-18
COG1171 347 COG1171, IlvA, Threonine dehydratase [Amino acid t 3e-18
TIGR01127 380 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, m 5e-14
PRK08638333 PRK08638, PRK08638, threonine dehydratase; Validat 2e-11
TIGR01124 499 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, b 3e-11
PRK08198 404 PRK08198, PRK08198, threonine dehydratase; Provisi 7e-11
PRK12483 521 PRK12483, PRK12483, threonine dehydratase; Reviewe 9e-10
PRK06815317 PRK06815, PRK06815, hypothetical protein; Provisio 2e-08
PRK09224 504 PRK09224, PRK09224, threonine dehydratase; Reviewe 4e-08
PLN02550 591 PLN02550, PLN02550, threonine dehydratase 5e-08
PRK06382 406 PRK06382, PRK06382, threonine dehydratase; Provisi 6e-08
cd01563324 cd01563, Thr-synth_1, Threonine synthase is a pyri 2e-07
PRK06721 352 PRK06721, PRK06721, threonine synthase; Reviewed 2e-07
PRK08246310 PRK08246, PRK08246, threonine dehydratase; Provisi 2e-07
PRK06352 351 PRK06352, PRK06352, threonine synthase; Validated 8e-07
PRK08526 403 PRK08526, PRK08526, threonine dehydratase; Provisi 1e-06
TIGR02079 409 TIGR02079, THD1, threonine dehydratase 2e-06
PRK07334 403 PRK07334, PRK07334, threonine dehydratase; Provisi 2e-06
PRK06381319 PRK06381, PRK06381, threonine synthase; Validated 4e-06
PRK06608338 PRK06608, PRK06608, threonine dehydratase; Provisi 7e-06
TIGR02991317 TIGR02991, ectoine_eutB, ectoine utilization prote 3e-05
PRK06110322 PRK06110, PRK06110, hypothetical protein; Provisio 4e-05
PRK07476322 PRK07476, eutB, threonine dehydratase; Provisional 6e-05
PRK08639 420 PRK08639, PRK08639, threonine dehydratase; Validat 2e-04
PRK08329347 PRK08329, PRK08329, threonine synthase; Validated 4e-04
TIGR03528 396 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammoni 5e-04
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 8e-04
TIGR01747 376 TIGR01747, diampropi_NH3ly, diaminopropionate ammo 0.001
PRK08197394 PRK08197, PRK08197, threonine synthase; Validated 0.001
PRK07048321 PRK07048, PRK07048, serine/threonine dehydratase; 0.001
COG0498 411 COG0498, ThrC, Threonine synthase [Amino acid tran 0.002
PRK08206 399 PRK08206, PRK08206, diaminopropionate ammonia-lyas 0.002
cd06448316 cd06448, L-Ser-dehyd, Serine dehydratase is a pyri 0.003
PRK06450338 PRK06450, PRK06450, threonine synthase; Validated 0.003
>gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase Back     alignment and domain information 
 Score =  365 bits (939), Expect = e-128
 Identities = 168/224 (75%), Positives = 190/224 (84%), Gaps = 3/224 (1%)

Query: 7   MEDNHHKRAIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIK 66
           MED   +  IK D T+LIGNTPMVYLNN+VDGCVARIAAKLEMMEPC SVKDRIA SMIK
Sbjct: 1   MED---RCLIKNDVTELIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKDRIAYSMIK 57

Query: 67  DAEEKGLITPGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAE 126
           DAE+KGLITPGKS LIE T GNTGIGLA I A RGYK+I+VMPS  S+ERRI+LRALGAE
Sbjct: 58  DAEDKGLITPGKSTLIEATAGNTGIGLACIGAARGYKVILVMPSTMSLERRIILRALGAE 117

Query: 127 VYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDI 186
           V+L DQ+ G +G+L K EEILS TP G++ +QFENPANP+IHY TTGPEIW+DS G VDI
Sbjct: 118 VHLTDQSIGLKGMLEKAEEILSKTPGGYIPQQFENPANPEIHYRTTGPEIWRDSAGKVDI 177

Query: 187 LVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPG 230
           LVAG+GTGGT TG G+FLKEKN +IKV  VEP ESA+L+GGQPG
Sbjct: 178 LVAGVGTGGTATGVGKFLKEKNKDIKVCVVEPVESAVLSGGQPG 221

Length = 323
>gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase Back     alignment and domain information
>gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase Back     alignment and domain information
>gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase Back     alignment and domain information
>gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A Back     alignment and domain information
>gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase Back     alignment and domain information
>gnl|CDD|107205 cd01562, Thr-dehyd, Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>gnl|CDD|224092 COG1171, IlvA, Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130197 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, medium form Back     alignment and domain information
>gnl|CDD|236317 PRK08638, PRK08638, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|130194 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>gnl|CDD|236182 PRK08198, PRK08198, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|237111 PRK12483, PRK12483, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|180709 PRK06815, PRK06815, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236417 PRK09224, PRK09224, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|178165 PLN02550, PLN02550, threonine dehydratase Back     alignment and domain information
>gnl|CDD|180550 PRK06382, PRK06382, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|107206 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>gnl|CDD|136018 PRK06721, PRK06721, threonine synthase; Reviewed Back     alignment and domain information
>gnl|CDD|181319 PRK08246, PRK08246, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|180539 PRK06352, PRK06352, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|181457 PRK08526, PRK08526, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|233712 TIGR02079, THD1, threonine dehydratase Back     alignment and domain information
>gnl|CDD|235994 PRK07334, PRK07334, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|235789 PRK06381, PRK06381, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|235842 PRK06608, PRK06608, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|132036 TIGR02991, ectoine_eutB, ectoine utilization protein EutB Back     alignment and domain information
>gnl|CDD|235699 PRK06110, PRK06110, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236025 PRK07476, eutB, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|236318 PRK08639, PRK08639, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|236244 PRK08329, PRK08329, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|234245 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammonia-lyase Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|130808 TIGR01747, diampropi_NH3ly, diaminopropionate ammonia-lyase family Back     alignment and domain information
>gnl|CDD|181283 PRK08197, PRK08197, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|235918 PRK07048, PRK07048, serine/threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|223572 COG0498, ThrC, Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236186 PRK08206, PRK08206, diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>gnl|CDD|107209 cd06448, L-Ser-dehyd, Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>gnl|CDD|180565 PRK06450, PRK06450, threonine synthase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
COG0031300 CysK Cysteine synthase [Amino acid transport and m 100.0
PLN03013429 cysteine synthase 100.0
PLN02565322 cysteine synthase 100.0
PLN02556368 cysteine synthase/L-3-cyanoalanine synthase 100.0
PLN00011323 cysteine synthase 100.0
KOG1252362 consensus Cystathionine beta-synthase and related 100.0
TIGR01136299 cysKM cysteine synthases. This model discriminates 100.0
TIGR01139298 cysK cysteine synthase A. This model distinguishes 100.0
PRK11761296 cysM cysteine synthase B; Provisional 100.0
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 100.0
COG1171 347 IlvA Threonine dehydratase [Amino acid transport a 100.0
PRK10717330 cysteine synthase A; Provisional 100.0
cd01561291 CBS_like CBS_like: This subgroup includes Cystathi 100.0
PLN02356423 phosphateglycerate kinase 100.0
PRK08198 404 threonine dehydratase; Provisional 100.0
PRK08526 403 threonine dehydratase; Provisional 100.0
PRK07476322 eutB threonine dehydratase; Provisional 100.0
PRK08638333 threonine dehydratase; Validated 100.0
PRK06382 406 threonine dehydratase; Provisional 100.0
PRK06110322 hypothetical protein; Provisional 100.0
PLN02970328 serine racemase 100.0
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 100.0
PRK07334 403 threonine dehydratase; Provisional 100.0
TIGR02991317 ectoine_eutB ectoine utilization protein EutB. Mem 100.0
PRK07048321 serine/threonine dehydratase; Validated 100.0
PRK08639 420 threonine dehydratase; Validated 100.0
PRK06608338 threonine dehydratase; Provisional 100.0
PRK08246310 threonine dehydratase; Provisional 100.0
TIGR02079 409 THD1 threonine dehydratase. This model represents 100.0
PRK06815317 hypothetical protein; Provisional 100.0
cd01562304 Thr-dehyd Threonine dehydratase: The first step in 100.0
cd06448316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 100.0
PRK12483 521 threonine dehydratase; Reviewed 100.0
cd06447404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 100.0
PRK02991 441 D-serine dehydratase; Provisional 100.0
TIGR01127 380 ilvA_1Cterm threonine dehydratase, medium form. A 100.0
TIGR02035431 D_Ser_am_lyase D-serine ammonia-lyase. This family 100.0
PRK08813349 threonine dehydratase; Provisional 100.0
PRK06352 351 threonine synthase; Validated 100.0
PLN02550 591 threonine dehydratase 100.0
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 100.0
PRK08197394 threonine synthase; Validated 100.0
PRK07591 421 threonine synthase; Validated 100.0
PRK09224 504 threonine dehydratase; Reviewed 100.0
PRK06381319 threonine synthase; Validated 100.0
KOG1250 457 consensus Threonine/serine dehydratases [Amino aci 100.0
PRK06721 352 threonine synthase; Reviewed 100.0
PRK07409353 threonine synthase; Validated 100.0
PRK05638 442 threonine synthase; Validated 100.0
PRK06260 397 threonine synthase; Validated 100.0
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phos 100.0
PRK08329347 threonine synthase; Validated 100.0
PLN02569 484 threonine synthase 100.0
PRK08206 399 diaminopropionate ammonia-lyase; Provisional 100.0
PRK06450338 threonine synthase; Validated 100.0
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfa 100.0
KOG1251323 consensus Serine racemase [Signal transduction mec 100.0
PRK12391427 tryptophan synthase subunit beta; Reviewed 100.0
TIGR01415419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 100.0
KOG1481391 consensus Cysteine synthase [Amino acid transport 100.0
TIGR01747376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 100.0
TIGR03528 396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 100.0
PRK13028402 tryptophan synthase subunit beta; Provisional 100.0
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 100.0
PRK04346 397 tryptophan synthase subunit beta; Validated 100.0
TIGR00260328 thrC threonine synthase. Involved in threonine bio 100.0
PLN02618 410 tryptophan synthase, beta chain 100.0
TIGR00263385 trpB tryptophan synthase, beta subunit. Tryptophan 100.0
TIGR01275311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 100.0
PRK03910331 D-cysteine desulfhydrase; Validated 100.0
PF00291306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 100.0
cd06446365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 100.0
TIGR03844 398 cysteate_syn cysteate synthase. Members of this fa 100.0
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 100.0
TIGR01274337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 100.0
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 100.0
PRK14045329 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
COG0498 411 ThrC Threonine synthase [Amino acid transport and 100.0
COG0133 396 TrpB Tryptophan synthase beta chain [Amino acid tr 99.97
COG1350432 Predicted alternative tryptophan synthase beta-sub 99.95
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 99.95
KOG1395 477 consensus Tryptophan synthase beta chain [Amino ac 99.93
PRK09225 462 threonine synthase; Validated 99.9
cd01560 460 Thr-synth_2 Threonine synthase catalyzes the final 99.89
COG3048 443 DsdA D-serine dehydratase [Amino acid transport an 99.81
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 93.95
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 92.25
TIGR00696177 wecB_tagA_cpsF bacterial polymer biosynthesis prot 89.4
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 88.71
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 88.45
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 88.33
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 88.22
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 87.16
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 87.12
PRK07109 334 short chain dehydrogenase; Provisional 86.93
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 86.84
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 86.79
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 86.0
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 85.67
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 84.89
PRK10669558 putative cation:proton antiport protein; Provision 83.9
KOG2862 385 consensus Alanine-glyoxylate aminotransferase AGT1 83.84
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 83.76
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 83.61
COG2130340 Putative NADP-dependent oxidoreductases [General f 83.47
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 82.9
PRK15408336 autoinducer 2-binding protein lsrB; Provisional 82.72
PRK08643256 acetoin reductase; Validated 82.67
PRK03659601 glutathione-regulated potassium-efflux system prot 82.66
PF00764 388 Arginosuc_synth: Arginosuccinate synthase; InterPr 82.55
PRK03562621 glutathione-regulated potassium-efflux system prot 82.46
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 82.27
PRK09880343 L-idonate 5-dehydrogenase; Provisional 82.27
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 82.13
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 82.08
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 81.77
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 81.48
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 81.23
PRK05993 277 short chain dehydrogenase; Provisional 81.01
PRK06182273 short chain dehydrogenase; Validated 80.86
PF13433 363 Peripla_BP_5: Periplasmic binding protein domain; 80.83
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 80.67
TIGR01064473 pyruv_kin pyruvate kinase. This enzyme is a homote 80.44
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 80.34
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 80.32
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 80.25
PRK12743256 oxidoreductase; Provisional 80.13
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.7e-58  Score=397.55  Aligned_cols=227  Identities=51%  Similarity=0.830  Sum_probs=215.2

Q ss_pred             HHhhcccCCCcceecccccccCCceEEEEeCCCCCCCchhhHHHHHHHHHHHHcCCCCCCCeEEEEeccChHHHHHHHHH
Q 025563           18 KDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFIA   97 (251)
Q Consensus        18 ~~v~~~~~~TPl~~~~~l~~~~g~~i~~K~E~~~ptGS~K~R~a~~~l~~a~~~g~~~~g~~~vv~~ssGN~g~alA~~a   97 (251)
                      +.+.+.+++|||++++++....+++||+|+|.+||+||.|||.|.+|+.+|+++|.+++|.+ ||++||||+|.+||+.|
T Consensus         3 ~~~~~~iG~TPlvrL~~~~~~~~~~i~~KlE~~NP~gSvKDR~A~~mI~~Ae~~G~l~pG~t-IVE~TSGNTGI~LA~va   81 (300)
T COG0031           3 ESILDLIGNTPLVRLNRLSPGTGVEIYAKLESFNPGGSVKDRIALYMIEDAEKRGLLKPGGT-IVEATSGNTGIALAMVA   81 (300)
T ss_pred             cchHHHhCCCCcEeecccCCCCCceEEEEhhhcCCCCchhHHHHHHHHHHHHHcCCCCCCCE-EEEcCCChHHHHHHHHH
Confidence            45778899999999999988888999999999999999999999999999999999999987 99999999999999999


Q ss_pred             HHCCCcEEEEecCCCcHHHHHHHHHcCCEEEEeCCCCC-hHHHHHHHHHHhhcCCC-eEecCCCCCCchHHHHHhhHHHH
Q 025563           98 ALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGG-FEGILRKGEEILSNTPN-GFMFRQFENPANPKIHYETTGPE  175 (251)
Q Consensus        98 ~~~G~~~~ivvp~~~~~~~~~~~~~~Ga~v~~v~~~~~-~~~~~~~a~~~~~~~~~-~~~~~~~~n~~~~~~g~~t~~~E  175 (251)
                      +.+|+|+++|||++++.++++.|+.|||+|+.++...+ +..+.+++++++++.|+ .+|.+||+||.|+++||.++++|
T Consensus        82 a~~Gy~~iivmP~~~S~er~~~l~a~GAevi~t~~~~g~~~~a~~~a~el~~~~p~~~~~~~Qf~NpaN~~aH~~tT~~E  161 (300)
T COG0031          82 AAKGYRLIIVMPETMSQERRKLLRALGAEVILTPGAPGNMKGAIERAKELAAEIPGYAVWLNQFENPANPEAHYETTGPE  161 (300)
T ss_pred             HHcCCcEEEEeCCCCCHHHHHHHHHcCCEEEEcCCCCCchHHHHHHHHHHHHhCCCceEchhhcCCCccHHHHHhhhHHH
Confidence            99999999999999999999999999999999998434 88999999999999988 77888999999999999999999


Q ss_pred             HhhhhCCCCCEEEEecCchhHHHHHHHHHHhhCCCcEEEEEeCCCCccccCCCCCceeecccCCccccccc
Q 025563          176 IWKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFF  246 (251)
Q Consensus       176 I~~q~~~~~d~vv~~vGtGg~~~Gi~~~~~~~~~~~~vigVep~~s~~~~~~~~~~~~i~g~g~~~~~~~~  246 (251)
                      |++|+++.+|+||+++|||||++|++++||+.+|++|+++|||++|+.+.+|. ++|.|+|||.+|+|.++
T Consensus       162 I~~~~~g~~d~fVagvGTGGTitGvar~Lk~~~p~i~iv~vdP~~S~~~~~G~-g~~~i~GIG~~~ip~~~  231 (300)
T COG0031         162 IWQQTDGKVDAFVAGVGTGGTITGVARYLKERNPNVRIVAVDPEGSVLLSGGE-GPHKIEGIGAGFVPENL  231 (300)
T ss_pred             HHHHhCCCCCEEEEeCCcchhHHHHHHHHHhhCCCcEEEEECCCCCcccCCCC-CCcccCCCCCCcCCccc
Confidence            99999888999999999999999999999999999999999999998888766 99999999999999654

>PLN03013 cysteine synthase Back     alignment and domain information
>PLN02565 cysteine synthase Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15408 autoinducer 2-binding protein lsrB; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1z7w_A322 Crystal Structure Of O-Acetylserine Sulfhydrylase F 3e-81
2isq_A320 Crystal Structure Of O-Acetylserine Sulfhydrylase F 4e-81
4aec_A430 Crystal Structure Of The Arabidopsis Thaliana O-Ace 4e-81
1z7y_A322 Crystal Structure Of The Arabidopsis Thaliana O-Ace 1e-80
3vbe_A344 Crystal Structure Of Beta-Cyanoalanine Synthase In 4e-73
3vc3_A344 Crystal Structure Of Beta-Cyanoalanine Synthase K95 2e-72
2q3d_A313 2.2 A Resolution Crystal Structure Of O-acetylserin 3e-52
2q3b_A313 1.8 A Resolution Crystal Structure Of O-Acetylserin 1e-51
3rr2_A314 Structure Of A Cysteine Synthase (O-Acetylserine Su 2e-49
4i1y_A314 The Structure Of Cysteine Synthase From Mycobacteri 6e-49
2egu_A308 Crystal Structure Of O-Acetylserine Sulfhydrase Fro 1e-47
4air_A354 Leishmania Major Cysteine Synthase Length = 354 1e-44
1oas_A322 O-Acetylserine Sulfhydrylase From Salmonella Typhim 2e-44
3t4p_A334 Crystal Structure Of O-Acetyl Serine Sulfhydrylase 4e-44
1d6s_A322 Crystal Structure Of The K41a Mutant Of O-Acetylser 9e-44
1ve1_A304 Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh 5e-43
2bhs_A303 Crystal Structure Of Cysteine Synthase B Length = 3 2e-40
2jc3_A303 Structure Of O-acetylserine Sulfhydrylase B From Sa 6e-40
2bht_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase B 7e-40
2v03_A303 High Resolution Structure And Catalysis Of An O- Ac 1e-39
1y7l_A316 O-Acetylserine Sulfhydrylase Complex Length = 316 5e-36
3pc2_A 527 Full Length Structure Of Cystathionine Beta-Synthas 5e-36
1m54_A363 Cystathionine-Beta Synthase: Reduced Vicinal Thiols 2e-35
1jbq_A435 Structure Of Human Cystathionine Beta-Synthase: A U 3e-35
3fca_A291 Genetic Incorporation Of A Metal-Ion Chelating Amin 5e-35
1o58_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase ( 7e-35
3dwg_A325 Crystal Structure Of A Sulfur Carrier Protein Compl 9e-33
3dwi_A323 Crystal Structure Of Mycobacterium Tuberculosis Cys 4e-32
3dki_A326 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac 4e-32
3bm5_A338 Crystal Structure Of O-Acetyl-Serine Sulfhydrylase 2e-28
2pqm_A343 Crystal Structure Of Cysteine Synthase (Oass) From 3e-28
1wkv_A389 Crystal Structure Of O-Phosphoserine Sulfhydrylase 5e-08
3vsc_A389 Crystal Structure Of The K127a Mutant Of O-Phosphos 2e-07
>pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 Back     alignment and structure 
Iteration: 1

 Score =  297 bits (761), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 167/215 (77%)
Query: 16  IKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLIT 75
           I KD T+LIGNTP+VYLNNV +GCV R+AAKLEMMEPC SVKDRI  SMI DAE+KGLI 
Sbjct: 5   IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 64
Query: 76  PGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGG 135
           PG+SVLIE T GNTG+GLAF AA +GYKLII MP+  S ERRI+L A G E+ L D A G
Sbjct: 65  PGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKG 124
Query: 136 FEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAXXXXXX 195
            +G + K EEIL+ TPNG+M +QFENPANPKIHYETTGPEIWK +GG +D  V+      
Sbjct: 125 MKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGG 184
Query: 196 XXXXXXRFLKEKNPNIKVYGVEPTESAMLNGGQPG 230
                 ++LKE+N N+K+YGVEP ESA+L+GG+PG
Sbjct: 185 TITGAGKYLKEQNANVKLYGVEPVESAILSGGKPG 219
>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 Back     alignment and structure
>pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 Back     alignment and structure
>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 Back     alignment and structure
>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 Back     alignment and structure
>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 Back     alignment and structure
>pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 Back     alignment and structure
>pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 Back     alignment and structure
>pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 Back     alignment and structure
>pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 Back     alignment and structure
>pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 Back     alignment and structure
>pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 Back     alignment and structure
>pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 Back     alignment and structure
>pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Back     alignment and structure
>pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 Back     alignment and structure
>pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 Back     alignment and structure
>pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 Back     alignment and structure
>pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 Back     alignment and structure
>pdb|1Y7L|A Chain A, O-Acetylserine Sulfhydrylase Complex Length = 316 Back     alignment and structure
>pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 Back     alignment and structure
>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 Back     alignment and structure
>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 Back     alignment and structure
>pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 Back     alignment and structure
>pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 Back     alignment and structure
>pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 Back     alignment and structure
>pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 Back     alignment and structure
>pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 Back     alignment and structure
>pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 Back     alignment and structure
>pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 Back     alignment and structure
>pdb|1WKV|A Chain A, Crystal Structure Of O-Phosphoserine Sulfhydrylase Length = 389 Back     alignment and structure
>pdb|3VSC|A Chain A, Crystal Structure Of The K127a Mutant Of O-Phosphoserine Sulfhydrylase Complexed With External Schiff Base Of Pyridoxal 5'-Phosphate With O- Phospho-L-Serine Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 1e-144
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 1e-143
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 1e-141
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 1e-140
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 1e-134
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 1e-131
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 1e-130
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 1e-129
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 1e-124
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 1e-122
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 1e-115
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-109
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 1e-109
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 1e-108
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 4e-16
3l6b_A 346 Serine racemase; pyridoxal phosphate, PLP, isomera 3e-15
1p5j_A 372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 4e-15
4d9i_A 398 Diaminopropionate ammonia-lyase; fold type II PLP- 4e-15
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 5e-15
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 3e-14
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 4e-14
1e5x_A 486 Threonine synthase; threonine biosynthesis, PLP en 2e-13
3ss7_X 442 D-serine dehydratase; type II fold, ALFA,beta-elim 4e-13
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 8e-13
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 8e-13
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 5e-12
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 1e-11
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 2e-11
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 Back     alignment and structure
 Score =  404 bits (1040), Expect = e-144
 Identities = 150/215 (69%), Positives = 179/215 (83%)

Query: 16  IKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLIT 75
           I KD T+LIGNTP+VYLNNV +GCV R+AAKLEMMEPC SVKDRI  SMI DAE+KGLI 
Sbjct: 5   IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 64

Query: 76  PGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGG 135
           PG+SVLIE T GNTG+GLAF AA +GYKLII MP+  S ERRI+L A G E+ L D A G
Sbjct: 65  PGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKG 124

Query: 136 FEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGG 195
            +G + K EEIL+ TPNG+M +QFENPANPKIHYETTGPEIWK +GG +D  V+GIGTGG
Sbjct: 125 MKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGG 184

Query: 196 TVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPG 230
           T+TG+G++LKE+N N+K+YGVEP ESA+L+GG+PG
Sbjct: 185 TITGAGKYLKEQNANVKLYGVEPVESAILSGGKPG 219
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Length = 323 Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* Length = 346 Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Length = 372 Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Length = 398 Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Length = 311 Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Length = 318 Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Length = 486 Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Length = 442 Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Length = 360 Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Length = 352 Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Length = 366 Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Length = 351 Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
3vc3_A344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 100.0
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 100.0
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 100.0
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 100.0
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 100.0
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 100.0
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 100.0
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 100.0
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 100.0
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 100.0
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 100.0
3l6b_A 346 Serine racemase; pyridoxal phosphate, PLP, isomera 100.0
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 100.0
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 100.0
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 100.0
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 100.0
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 100.0
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 100.0
4h27_A364 L-serine dehydratase/L-threonine deaminase; PLP de 100.0
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 100.0
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 100.0
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 100.0
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 100.0
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 100.0
3ss7_X 442 D-serine dehydratase; type II fold, ALFA,beta-elim 100.0
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 100.0
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 100.0
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 100.0
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 100.0
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 100.0
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 100.0
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 100.0
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 100.0
1x1q_A 418 Tryptophan synthase beta chain; structural genomic 100.0
1qop_B 396 Tryptophan synthase beta chain; lyase, carbon-oxyg 100.0
1v8z_A 388 Tryptophan synthase beta chain 1; beta+alpha, rike 100.0
2o2e_A 422 Tryptophan synthase beta chain; amino-acid biosynt 100.0
1e5x_A 486 Threonine synthase; threonine biosynthesis, PLP en 100.0
1vb3_A 428 Threonine synthase; PLP-dependent enzyme, lyase; H 100.0
1kl7_A 514 Threonine synthase; threonine synthesis, pyridoxal 99.97
4f4f_A 468 Threonine synthase; structural genomics, niaid, na 99.97
3v7n_A 487 Threonine synthase; ssgcid, structural genomics, s 99.97
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.15
1vp8_A201 Hypothetical protein AF0103; putative pyruvate kin 93.42
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 92.62
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 92.13
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.09
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 91.91
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 91.81
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 91.09
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 90.86
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 90.54
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 90.45
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 90.08
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 90.0
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 89.87
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 89.84
4eye_A342 Probable oxidoreductase; structural genomics, niai 89.66
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 89.66
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 89.42
3gms_A340 Putative NADPH:quinone reductase; structural genom 89.19
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 88.25
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 87.91
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 87.84
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 87.8
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 87.77
3c85_A183 Putative glutathione-regulated potassium-efflux S 87.72
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 87.62
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 87.52
3fbg_A346 Putative arginate lyase; structural genomics, unkn 87.36
1t57_A206 Conserved protein MTH1675; structural genomics, FM 87.24
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 87.21
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 87.14
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 86.95
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 86.89
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 86.62
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 86.58
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 86.3
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 86.04
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 86.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 85.86
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 85.75
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 85.48
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 85.29
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 85.19
3krt_A456 Crotonyl COA reductase; structural genomics, prote 85.15
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 85.04
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 84.8
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 84.69
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 84.59
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 84.3
3l6u_A293 ABC-type sugar transport system periplasmic compo; 84.22
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 84.1
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 84.08
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 83.98
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 83.82
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 83.72
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 83.58
3gem_A260 Short chain dehydrogenase; structural genomics, AP 83.4
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 83.38
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 83.31
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 83.28
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 83.02
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 82.52
3e03_A274 Short chain dehydrogenase; structural genomics, PS 82.4
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 82.36
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 81.89
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 81.75
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 81.72
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 81.57
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 81.49
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 81.43
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 81.36
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 81.16
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 80.79
3edm_A259 Short chain dehydrogenase; structural genomics, ox 80.74
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 80.73
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 80.48
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 80.43
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 80.32
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 80.29
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 80.18
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
Probab=100.00  E-value=7.2e-56  Score=396.75  Aligned_cols=232  Identities=56%  Similarity=0.950  Sum_probs=215.6

Q ss_pred             HHHHHhhcccCCCcceecccccccCCceEEEEeCCCCCCCchhhHHHHHHHHHHHHcCCCCCCCeEEEEeccChHHHHHH
Q 025563           15 AIKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLA   94 (251)
Q Consensus        15 ~~~~~v~~~~~~TPl~~~~~l~~~~g~~i~~K~E~~~ptGS~K~R~a~~~l~~a~~~g~~~~g~~~vv~~ssGN~g~alA   94 (251)
                      .+++.|.+.||+|||+++++|++.+|++||+|+|++|||||||+|++.+++.+|.++|.+.+|..+||++|+||||.|+|
T Consensus        24 ~i~~~i~~lIG~TPLv~~~~Ls~~~G~~IylK~E~lnptGSfK~RgA~~~i~~a~~~g~l~~g~~~Vv~aSsGN~g~alA  103 (344)
T 3vc3_A           24 NIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIADRPAYAMITDAEEKNLITPGKTTLIEPTSGNMGISMA  103 (344)
T ss_dssp             SCBSSGGGGSCCCCEEECCSTTTTCCSEEEEEEGGGSTTSBTTHHHHHHHHHHHHHTTCCCTTTCEEEEECSSHHHHHHH
T ss_pred             hhhccHhhhcCCCceEECcccchhhCCEEEEEecCCCCCCCcHHHHHHHHHHHHHHcCCCCCCCCEEEEeCCcHHHHHHH
Confidence            35667999999999999999999999999999999999999999999999999999999888877799999999999999


Q ss_pred             HHHHHCCCcEEEEecCCCcHHHHHHHHHcCCEEEEeCCCCChHHHHHHHHHHhhcCCCeEecCCCCCCchHHHHHhhHHH
Q 025563           95 FIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGP  174 (251)
Q Consensus        95 ~~a~~~G~~~~ivvp~~~~~~~~~~~~~~Ga~v~~v~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~n~~~~~~g~~t~~~  174 (251)
                      ++|+++|++|+||||++++..|+++++.+||+|+.++...++.++...+.++..+.++.+|++||+||.++.+||.|++.
T Consensus       104 ~~aa~~G~~~~IvmP~~~~~~k~~~~~~~GA~Vv~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~np~~~~a~~~t~g~  183 (344)
T 3vc3_A          104 FMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGP  183 (344)
T ss_dssp             HHHHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHSTTEECCCTTTCHHHHHHHHHTHHH
T ss_pred             HHHHHcCCcEEEEECCCChHHHHHHHHHcCCEEEEECCCCcchHHHHHHHHHHhhccCceeccccccchhHHHHHHHHHH
Confidence            99999999999999999999999999999999999987545556666666666666799999999999999889999999


Q ss_pred             HHhhhhCCCCCEEEEecCchhHHHHHHHHHHhhCCCcEEEEEeCCCCccccCCCCCceeecccCCccccccc
Q 025563          175 EIWKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFF  246 (251)
Q Consensus       175 EI~~q~~~~~d~vv~~vGtGg~~~Gi~~~~~~~~~~~~vigVep~~s~~~~~~~~~~~~i~g~g~~~~~~~~  246 (251)
                      ||++|+++.+|+||+|+|+||+++|++.++++.+|++||++|||.+|+++.++.++++.++|+|.++.|.+.
T Consensus       184 EI~eq~~~~~d~vv~~vGgGG~~~Gi~~~~k~~~p~v~vigVep~~s~~l~~~~~~~~~i~g~g~~~~~~~~  255 (344)
T 3vc3_A          184 EIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDIL  255 (344)
T ss_dssp             HHHHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCGGGTCCCCCCSCTTSCCSSCCTTC
T ss_pred             HHHHHhCCCceEEEEecCCccchHHHhhhhHhhCCCceEEEEcCCCChhhcCCCCCCeeEecccccccCccc
Confidence            999999889999999999999999999999999999999999999999999999999999999999887653
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1vp8_A Hypothetical protein AF0103; putative pyruvate kinase, structural genomics, joint center structural genomics, JCSG; HET: MSE FMN; 1.30A {Archaeoglobus fulgidus} SCOP: c.49.1.2 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1t57_A Conserved protein MTH1675; structural genomics, FMN; HET: FMN; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.49.1.2 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1z7wa1320 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C 3e-57
d1jbqa_355 c.79.1.1 (A:) Cystathionine beta-synthase {Human ( 5e-46
d1y7la1310 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C 4e-45
d1o58a_293 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 2e-44
d1ve1a1302 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C 4e-43
d1fcja_302 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 2e-40
d2bhsa1292 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C 5e-37
d1tdja1331 c.79.1.1 (A:5-335) Threonine deaminase {Escherichi 1e-29
d1wkva1382 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C 2e-29
d1v71a1318 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S 1e-23
d1tyza_338 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 3e-20
d1e5xa_ 477 c.79.1.1 (A:) Threonine synthase {Mouse-ear cress 1e-19
d1ve5a1310 c.79.1.1 (A:2-311) Threonine deaminase {Thermus th 5e-18
d1f2da_341 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-17
d1v8za1 386 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun 1e-15
d1j0aa_325 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-15
d1p5ja_319 c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa 5e-15
d1v7ca_351 c.79.1.1 (A:) Threonine synthase {Thermus thermoph 1e-13
d1qopb_ 390 c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S 2e-13
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  183 bits (464), Expect = 3e-57
 Identities = 150/215 (69%), Positives = 179/215 (83%)

Query: 16  IKKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLIT 75
           I KD T+LIGNTP+VYLNNV +GCV R+AAKLEMMEPC SVKDRI  SMI DAE+KGLI 
Sbjct: 3   IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 62

Query: 76  PGKSVLIETTGGNTGIGLAFIAALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGG 135
           PG+SVLIE T GNTG+GLAF AA +GYKLII MP+  S ERRI+L A G E+ L D A G
Sbjct: 63  PGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKG 122

Query: 136 FEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEIWKDSGGDVDILVAGIGTGG 195
            +G + K EEIL+ TPNG+M +QFENPANPKIHYETTGPEIWK +GG +D  V+GIGTGG
Sbjct: 123 MKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGG 182

Query: 196 TVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPG 230
           T+TG+G++LKE+N N+K+YGVEP ESA+L+GG+PG
Sbjct: 183 TITGAGKYLKEQNANVKLYGVEPVESAILSGGKPG 217
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ve1a1302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 100.0
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ve5a1310 Threonine deaminase {Thermus thermophilus [TaxId: 100.0
d1p5ja_319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 100.0
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1v7ca_351 Threonine synthase {Thermus thermophilus [TaxId: 2 100.0
d1e5xa_ 477 Threonine synthase {Mouse-ear cress (Arabidopsis t 100.0
d1v8za1 386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1qopb_ 390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1j0aa_325 1-aminocyclopropane-1-carboxylate deaminase {Archa 100.0
d1tyza_338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 99.97
d1f2da_341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 99.97
d1vb3a1 428 Threonine synthase {Escherichia coli [TaxId: 562]} 99.7
d1kl7a_ 511 Threonine synthase {Baker's yeast (Saccharomyces c 98.92
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.72
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.28
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.85
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.67
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.66
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.57
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.51
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 95.18
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.08
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.04
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.92
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.55
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 94.49
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.43
d1vp8a_190 Hypothetical protein AF0103 {Archaeoglobus fulgidu 94.33
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.24
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.71
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 93.59
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.56
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 93.09
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.82
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.75
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.68
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.06
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.7
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 91.58
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 91.15
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 90.82
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.64
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 90.13
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.94
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 89.83
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 89.7
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 89.6
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 88.93
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 88.74
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 87.92
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 87.91
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.44
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 87.3
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 86.93
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 86.92
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 86.89
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 86.74
d1t57a_186 Hypothetical protein MTH1675 {Methanobacterium the 86.67
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 86.36
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 85.92
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 85.43
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 85.28
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 85.26
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 85.25
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 85.23
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 84.19
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 83.34
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 83.06
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 82.94
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 82.31
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 82.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 80.77
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 80.7
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 80.05
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=1.5e-53  Score=376.33  Aligned_cols=230  Identities=65%  Similarity=1.070  Sum_probs=210.4

Q ss_pred             HHHhhcccCCCcceecccccccCCceEEEEeCCCCCCCchhhHHHHHHHHHHHHcCCCCCCCeEEEEeccChHHHHHHHH
Q 025563           17 KKDATQLIGNTPMVYLNNVVDGCVARIAAKLEMMEPCCSVKDRIALSMIKDAEEKGLITPGKSVLIETTGGNTGIGLAFI   96 (251)
Q Consensus        17 ~~~v~~~~~~TPl~~~~~l~~~~g~~i~~K~E~~~ptGS~K~R~a~~~l~~a~~~g~~~~g~~~vv~~ssGN~g~alA~~   96 (251)
                      .+.|.+.+|+|||+++++|++.+|++||+|+|++|||||||+|++.+++..|+++|.++.+...+|++|+||||.|+|++
T Consensus         4 ~~~i~~~iG~TPLv~~~~l~~~~g~~i~~K~E~~nptGSfKdRgA~~~i~~a~~~g~~~~~~~~vv~aSsGN~g~a~A~~   83 (320)
T d1z7wa1           4 AKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFT   83 (320)
T ss_dssp             CSSGGGGSSCCCEEECCGGGTTCSSEEEEEEGGGSTTSBTHHHHHHHHHHHHHHTTSCCTTTCEEEEECSSHHHHHHHHH
T ss_pred             hhhhhhhcCCCCeEECCCcccccCCEEEEEeCCCCCccCcHHHHHHHHHHHHHHcCCCCCCCceEEeeCCchHHHHHHHH
Confidence            45688999999999999999999999999999999999999999999999999999887776779999999999999999


Q ss_pred             HHHCCCcEEEEecCCCcHHHHHHHHHcCCEEEEeCCCCChHHHHHHHHHHhhcCCCeEecCCCCCCchHHHHHhhHHHHH
Q 025563           97 AALRGYKLIIVMPSIASMERRIVLRALGAEVYLADQAGGFEGILRKGEEILSNTPNGFMFRQFENPANPKIHYETTGPEI  176 (251)
Q Consensus        97 a~~~G~~~~ivvp~~~~~~~~~~~~~~Ga~v~~v~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~n~~~~~~g~~t~~~EI  176 (251)
                      |+.+|++|+||||..+++.|+++++.+||+|+.++...+..+....+.+...+.++.+|+++++|+.++.+||.|++.||
T Consensus        84 a~~~g~~~~iv~p~~~~~~k~~~i~~~Ga~vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~g~~t~~~EI  163 (320)
T d1z7wa1          84 AAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEI  163 (320)
T ss_dssp             HHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHCTTEEECCTTTCTHHHHHHHHTHHHHH
T ss_pred             HHhhccceEEeehhhhhhhhhhhhhccCcceEEeeccccccccchhHHHHHHhCCCceecccccccchHHHhhhhHHHHH
Confidence            99999999999999999999999999999999998653333444444444555568999999999998888999999999


Q ss_pred             hhhhCCCCCEEEEecCchhHHHHHHHHHHhhCCCcEEEEEeCCCCccccCCCCCceeecccCCccccccc
Q 025563          177 WKDSGGDVDILVAGIGTGGTVTGSGRFLKEKNPNIKVYGVEPTESAMLNGGQPGRLLFFLFFLFFFCFFF  246 (251)
Q Consensus       177 ~~q~~~~~d~vv~~vGtGg~~~Gi~~~~~~~~~~~~vigVep~~s~~~~~~~~~~~~i~g~g~~~~~~~~  246 (251)
                      .+|+.+.+|+||+|+|+||+++|++++|+..+|++++++|||.+|+.+.++.++++.++|||.+++|..+
T Consensus       164 ~~q~~~~~D~vv~~vGgGg~~~Gi~~~~k~~~~~~~~igve~~~s~~~~~~~~~~~~~~gig~~~~~~~~  233 (320)
T d1z7wa1         164 WKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVL  233 (320)
T ss_dssp             HHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCGGGTCCCCCCSCTTSCCSSCCTTC
T ss_pred             HHhccCCCCEEEeCCCCCcccchhhhhhhhhhcceeeecccccCCccccCCCCCCceeeeccCCcCcchh
Confidence            9999888999999999999999999999999999999999999999999999999999999999998753
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vp8a_ c.49.1.2 (A:) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1t57a_ c.49.1.2 (A:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure