Citrus Sinensis ID: 025800

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MDIEQGSHHHRRSVAGSEVSVCFSDAEDGGSCYSQFYSTTGGSYDEYSFACVSDDQEMSLGGGDSRRVSSVSSSSSSDCSVEIESAVHEIEIKVHLATAAAAATTTTTNNNNRVEGERDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEIETAELSNEVNNANATSSISAAIGHGETRSIWHGHRFLNFLLACMVFAFVISWLFHFNMPSS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHEEEEEEEEccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccc
mdieqgshhhrrsvagsevsvcfsdaedggscysqfysttggsydeysfacvsddqemslgggdsrrvssvssssssdcsVEIESAVHEIEIKVHLATAAAAATttttnnnnrvegerdcricrichlclesnshesgvpiqlgcsckDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEIETAELsnevnnanatsSISAAIghgetrsiwHGHRFLNFLLACMVFAFVISWLFHFNMPSS
mdieqgshhhrrsvagseVSVCFSDAEDGGSCYSQFYSTTGGSYDEYSFACVSDDQEMSLGGGDSRRVSSVSSSSSSDCSVEIESAVHEIEIKVHLATAAAaatttttnnnnrvegerDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEIETAELSNEVNNANATSSISAAIGHGETRSIWHGHRFLNFLLACMVFAFVISWLFHFNMPSS
MDIEQGSHHHRRSVAGSEVSVCFSDAEDGGSCYSQFYSTTGGSYDEYSFACVSDDQEMSLGGGDsrrvssvssssssDCSVEIESAVHEIEIKVHLataaaaatttttnnnnRVEGERDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEIETAELSNEVnnanatssisaaiGHGETRSIWHGHRFLNFLLACMVFAFVISWLFHFNMPSS
*******************SVCFSDAEDGGSCYSQFYSTTGGSYDEYSFACV******************************IESAVHEIEIKVHLATAAAAATTTTTNNNNRVEGERDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEIETA**************ISAAIGHGETRSIWHGHRFLNFLLACMVFAFVISWLFHFN****
*************************************************************************************************************************ICRICHLCLE*****SGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEIETAELS*******************ETRSIWHGHRFLNFLLACMVFAFVISWLFHFNMP**
****************SEVSVCFSDAEDGGSCYSQFYSTTGGSYDEYSFACVSDDQE*************************IESAVHEIEIKVHLATAAAAATTTTTNNNNRVEGERDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEIETAELSNEVNNANATSSISAAIGHGETRSIWHGHRFLNFLLACMVFAFVISWLFHFNMPSS
****************************************************************************************************************RVEGERDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEI**************************TRSIWHGHRFLNFLLACMVFAFVISWLFHFNMP**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIEQGSHHHRRSVAGSEVSVCFSDAEDGGSCYSQFYSTTGGSYDEYSFACVSDDQEMSLGGGDSRRVSSVSSSSSSDCSVEIESAVHEIEIKVHLATAAAAATTTTTNNNNRVEGERDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARNVAGATEIETAELSNEVNNANATSSISAAIGHGETRSIWHGHRFLNFLLACMVFAFVISWLFHFNMPSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
224090847229 predicted protein [Populus trichocarpa] 0.883 0.956 0.64 2e-76
359806055232 uncharacterized protein LOC100808666 [Gl 0.887 0.948 0.611 6e-74
255573945218 protein binding protein, putative [Ricin 0.846 0.963 0.633 4e-72
225440556236 PREDICTED: uncharacterized protein LOC10 0.870 0.915 0.602 3e-70
356496116222 PREDICTED: uncharacterized protein LOC10 0.850 0.950 0.604 1e-69
356504319228 PREDICTED: uncharacterized protein LOC10 0.870 0.947 0.605 2e-69
449439944231 PREDICTED: uncharacterized protein LOC10 0.875 0.939 0.585 3e-67
224140333200 predicted protein [Populus trichocarpa] 0.790 0.98 0.589 2e-66
224109334208 predicted protein [Populus trichocarpa] 0.790 0.942 0.589 3e-66
297740275161 unnamed protein product [Vitis vinifera] 0.608 0.937 0.616 4e-51
>gi|224090847|ref|XP_002309103.1| predicted protein [Populus trichocarpa] gi|222855079|gb|EEE92626.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 186/250 (74%), Gaps = 31/250 (12%)

Query: 1   MDIEQGSHHHRRSVAGSEVSVCFSDAEDGGSCYSQFYSTTGGSYDEYSFACVSDDQEMSL 60
           +D+EQG+HH   SVAGS++S  FSDAE+G SCYSQFYSTT GSYD+YSFACVS+ + +  
Sbjct: 9   LDLEQGTHH--CSVAGSDIS-SFSDAENG-SCYSQFYSTTAGSYDDYSFACVSEPEGIDG 64

Query: 61  GGGDSRRVSSVSSSSSSDCSVEIESAVHEIEIKVHLATAAAAATTTTTNNNNRVEGERDC 120
              DSRRVSSVS     DCSVE+E      EIKVHL+                   ERDC
Sbjct: 65  VVLDSRRVSSVS-----DCSVEVEIENRVPEIKVHLSKV-----------------ERDC 102

Query: 121 RICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARN 180
           RIC   HL LESNSHESGVPI+LGCSCK+DLAAAHKQCAEAWF+IRGNKTCEIC+S ARN
Sbjct: 103 RIC---HLGLESNSHESGVPIELGCSCKNDLAAAHKQCAEAWFRIRGNKTCEICHSTARN 159

Query: 181 VAGATEIETAELSNEVNNA--NATSSISAAIGHGETRSIWHGHRFLNFLLACMVFAFVIS 238
           V  A++IE+ E  NE NN    AT+++SA+I   ETRS W GHRFLNFLLAC+VFAFV+S
Sbjct: 160 VVLASDIESIEHLNETNNGMDTATTAVSASIPTAETRSFWQGHRFLNFLLACVVFAFVLS 219

Query: 239 WLFHFNMPSS 248
           WLFHFN+PSS
Sbjct: 220 WLFHFNVPSS 229

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359806055|ref|NP_001241435.1| uncharacterized protein LOC100808666 [Glycine max] gi|255648218|gb|ACU24562.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255573945|ref|XP_002527891.1| protein binding protein, putative [Ricinus communis] gi|223532742|gb|EEF34522.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225440556|ref|XP_002273450.1| PREDICTED: uncharacterized protein LOC100252869 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356496116|ref|XP_003516916.1| PREDICTED: uncharacterized protein LOC100812277 [Glycine max] Back     alignment and taxonomy information
>gi|356504319|ref|XP_003520944.1| PREDICTED: uncharacterized protein LOC100813946 [Glycine max] Back     alignment and taxonomy information
>gi|449439944|ref|XP_004137745.1| PREDICTED: uncharacterized protein LOC101218915 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224140333|ref|XP_002323537.1| predicted protein [Populus trichocarpa] gi|222868167|gb|EEF05298.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109334|ref|XP_002333272.1| predicted protein [Populus trichocarpa] gi|222835873|gb|EEE74294.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297740275|emb|CBI30457.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
TAIR|locus:2166399204 AT5G05830 [Arabidopsis thalian 0.528 0.642 0.619 6.6e-42
TAIR|locus:2154523231 AT5G59000 "AT5G59000" [Arabido 0.443 0.476 0.504 8.8e-34
TAIR|locus:2150084206 AT5G01070 [Arabidopsis thalian 0.504 0.606 0.559 1.5e-33
TAIR|locus:2065620207 AT2G37950 [Arabidopsis thalian 0.495 0.594 0.5 8.8e-31
TAIR|locus:2040949222 AT2G34200 [Arabidopsis thalian 0.245 0.274 0.514 3e-14
TAIR|locus:2175158 494 AT5G60580 [Arabidopsis thalian 0.290 0.145 0.437 1.2e-11
TAIR|locus:2043664240 AT2G45530 [Arabidopsis thalian 0.254 0.262 0.420 5.5e-10
TAIR|locus:2081076426 AT3G06330 [Arabidopsis thalian 0.221 0.129 0.368 1.2e-07
TAIR|locus:2075064 491 AT3G09760 [Arabidopsis thalian 0.225 0.114 0.368 4.1e-07
TAIR|locus:2144890411 AT5G18760 "AT5G18760" [Arabido 0.221 0.133 0.368 1.4e-06
TAIR|locus:2166399 AT5G05830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 444 (161.4 bits), Expect = 6.6e-42, P = 6.6e-42
 Identities = 83/134 (61%), Positives = 96/134 (71%)

Query:   115 EGERDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEIC 174
             + ERDCRIC   H+ L++ + ESGVPI+LGCSCK DLAAAHK CAE WFKI+GNK CE+C
Sbjct:    74 QSERDCRIC---HMSLDAANLESGVPIELGCSCKADLAAAHKHCAETWFKIKGNKICEVC 130

Query:   175 NSIARNVAGATEIETAELSNEVXXXXXXXXXXXXXGHGETRSIWHGHRFLNFLLACMVFA 234
              SIA NV G+ E+E+ E  NE                 E RS W GHRFLNFLLACMVFA
Sbjct:   131 GSIAGNVVGSVEVESEESRNEANGVENLTLRTSGPRLVEGRSFWQGHRFLNFLLACMVFA 190

Query:   235 FVISWLFHFNMPSS 248
             FVISWLFHFN+PS+
Sbjct:   191 FVISWLFHFNVPST 204
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2154523 AT5G59000 "AT5G59000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150084 AT5G01070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065620 AT2G37950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040949 AT2G34200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043664 AT2G45530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081076 AT3G06330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075064 AT3G09760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144890 AT5G18760 "AT5G18760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0023024502
hypothetical protein (230 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 5e-13
pfam1290647 pfam12906, RINGv, RING-variant domain 4e-11
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 5e-04
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 0.002
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 0.003
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 61.5 bits (150), Expect = 5e-13
 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 122 ICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICN 175
           ICRICH     +  + G P+   C CK  L   H++C E W    GNKTCEIC 
Sbjct: 1   ICRICH-----DEGDEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.67
PHA02825162 LAP/PHD finger-like protein; Provisional 99.66
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.63
PHA02862156 5L protein; Provisional 99.6
KOG3053 293 consensus Uncharacterized conserved protein [Funct 99.58
KOG1609 323 consensus Protein involved in mRNA turnover and st 99.45
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.41
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.58
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.84
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.59
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.51
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.49
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.36
PHA02929238 N1R/p28-like protein; Provisional 96.36
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.29
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.12
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.91
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 95.73
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.49
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 95.3
PHA02926242 zinc finger-like protein; Provisional 94.74
smart0050463 Ubox Modified RING finger domain. Modified RING fi 94.56
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 94.35
KOG149384 consensus Anaphase-promoting complex (APC), subuni 94.35
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 94.19
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 92.79
COG52191525 Uncharacterized conserved protein, contains RING Z 92.16
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 90.95
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 89.84
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 89.56
PF1463444 zf-RING_5: zinc-RING finger domain 89.14
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 87.66
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 86.95
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 81.86
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 80.27
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
Probab=99.67  E-value=2.7e-17  Score=115.32  Aligned_cols=49  Identities=49%  Similarity=1.042  Sum_probs=44.0

Q ss_pred             ceeEeccCCCCCCCCCCCceeccccccCccccccHHHHHHHHHHcCCccccccc
Q 025800          122 ICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICN  175 (248)
Q Consensus       122 ~CRIC~~~~e~~~~e~g~~li~PC~CkGsl~~VH~~CL~~W~k~kgn~~CEICk  175 (248)
                      +||||++..+     .++++++||.|+|+++|||+.||++|+..+++.+||||+
T Consensus         1 ~CrIC~~~~~-----~~~~l~~PC~C~G~~~~vH~~Cl~~W~~~~~~~~C~iC~   49 (49)
T smart00744        1 ICRICHDEGD-----EGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK   49 (49)
T ss_pred             CccCCCCCCC-----CCCeeEeccccCCchhHHHHHHHHHHHHHcCCCcCCCCC
Confidence            4999998322     457899999999999999999999999999999999996

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 1e-13
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 1e-10
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 62.8 bits (153), Expect = 1e-13
 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 7/60 (11%)

Query: 117 ERDCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNS 176
           + D  +C IC+        E G      C C  +L   H+ C   W  I  N  C+IC  
Sbjct: 3   DEDVPVCWICN-------EELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGV 55
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.74
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.61
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.14
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.11
2ect_A78 Ring finger protein 126; metal binding protein, st 97.95
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.88
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.86
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.86
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.84
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.81
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.79
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.78
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.71
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.67
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.67
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.63
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.61
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.59
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.59
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.47
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.46
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.44
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.42
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.4
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.39
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.37
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.37
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.36
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.34
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.21
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 96.95
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 96.95
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.9
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 96.86
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 96.82
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.72
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.62
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.51
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.51
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.43
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.39
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.32
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.09
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.03
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 95.89
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.74
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.64
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.49
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 95.28
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 95.21
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 95.02
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 94.97
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 94.92
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 94.89
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 94.72
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 94.48
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 94.19
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 93.9
2ea5_A68 Cell growth regulator with ring finger domain prot 93.58
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 93.27
3nw0_A238 Non-structural maintenance of chromosomes element 93.19
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 93.03
2f42_A179 STIP1 homology and U-box containing protein 1; cha 92.95
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 88.7
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 86.87
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 86.71
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 85.14
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.74  E-value=7.9e-19  Score=125.89  Aligned_cols=53  Identities=30%  Similarity=0.803  Sum_probs=47.1

Q ss_pred             CceeEeccCCCCCCCCCCCceeccccccCccccccHHHHHHHHHHcCCccccccccceee
Q 025800          121 RICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARN  180 (248)
Q Consensus       121 ~~CRIC~~~~e~~~~e~g~~li~PC~CkGsl~~VH~~CL~~W~k~kgn~~CEICk~~~~n  180 (248)
                      .+||||+.+.       ++++++||+|+|++++||+.||.+|++.+++.+||||+++|+.
T Consensus         7 ~~CrIC~~~~-------~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            7 PVCWICNEEL-------GNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CEETTTTEEC-------SCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CEeEEeecCC-------CCceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            3499999863       2357899999999999999999999999999999999999974
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-04
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 37.1 bits (85), Expect = 1e-04
 Identities = 17/58 (29%), Positives = 22/58 (37%), Gaps = 7/58 (12%)

Query: 119 DCRICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNS 176
           D  +C IC+        E G      C C  +L   H+ C   W  I  N  C+IC  
Sbjct: 5   DVPVCWICN-------EELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGV 55

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.5
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.97
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.93
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.74
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.68
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.62
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.57
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.51
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.74
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.54
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 96.49
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 96.4
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.36
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 94.19
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 94.11
d2c2la280 STIP1 homology and U box-containing protein 1, STU 93.5
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 92.46
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.50  E-value=4.2e-15  Score=103.56  Aligned_cols=53  Identities=28%  Similarity=0.757  Sum_probs=47.5

Q ss_pred             CceeEeccCCCCCCCCCCCceeccccccCccccccHHHHHHHHHHcCCccccccccceee
Q 025800          121 RICRICHLCLESNSHESGVPIQLGCSCKDDLAAAHKQCAEAWFKIRGNKTCEICNSIARN  180 (248)
Q Consensus       121 ~~CRIC~~~~e~~~~e~g~~li~PC~CkGsl~~VH~~CL~~W~k~kgn~~CEICk~~~~n  180 (248)
                      ++|+||++..+       ++++.||.|+|..+++|+.||.+|++.+++.+|++|+++|+.
T Consensus         7 ~~C~IC~~~~~-------~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~   59 (60)
T d1vyxa_           7 PVCWICNEELG-------NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CEETTTTEECS-------CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCccCCccCC-------CceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence            56999998643       367899999999999999999999999999999999999974
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure