Citrus Sinensis ID: 025860

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------

MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYPNSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSNRSSVLSLR

cHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEcccHHccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHcccEEcccccccHHHHHHHHHHHHccccccccc

cHHHHHHHHHHHHHHHHHHHHHccHHccHHcccccccccEEEEEEcccccEccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHccccEEEEcccccEEccccccccccccccHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHccccHHccc

MLRRSVEIAREARDMYFercsksscdsvtddripkhrpiLVAASvgsygayladgseysgnygdaitVETLKDFHRRRVQVLVEsapdliafetiPNKIEAQAYAELLEeenikipawfsfnskdgvnvvsgdSLLECASIAESCKRVVSvginctpprfISGLILIIKKvtakpiliypnsgefydadrkewvqntgvsdeDFVSYVSKWCEVGAslvggccrttpntiKGIYRTLsnrssvlslr

mlrrsveiAREArdmyfercsksscdsvtddripkhRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQVLVEsapdliafetiPNKIEAQAYAELLEEENIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYPNSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGAslvggccrttpntikgiyrtlsnrssvlslr

MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIeaqayaelleeeNIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYPNSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSNRSSVLSLR

****************F**************RIPKHRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYPNSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTL**********

*LRRSVEIAREARDMYFERCSKSSCDSVT***IPKHRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYPNSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLS*********

MLRRSVEIAREARDMYFERC*********DDRIPKHRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYPNSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSNRSSVLSLR

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		247	2.2.26 [Sep-21-2011]
P56707		338	Selenocysteine methyltran	N/A	no	0.979	0.715	0.756	1e-108
Q9M1W4		333	Homocysteine S-methyltran	yes	no	0.971	0.720	0.736	1e-105
Q9FUM9		339	Homocysteine S-methyltran	N/A	no	0.927	0.675	0.698	7e-96
Q9FUM8		338	Homocysteine S-methyltran	N/A	no	0.931	0.680	0.695	9e-96
Q4VNK0		346	Selenocysteine Se-methylt	N/A	no	0.939	0.670	0.704	9e-94
Q8LAX0		347	Homocysteine S-methyltran	no	no	0.987	0.703	0.648	2e-92
Q9FUM7		342	Homocysteine S-methyltran	N/A	no	0.927	0.669	0.609	4e-80
A4ZGQ8		326	Homocysteine S-methyltran	N/A	no	0.939	0.711	0.533	2e-72
Q9SDL7		326	Homocysteine S-methyltran	no	no	0.939	0.711	0.533	4e-71
Q9FUN0		323	Homocysteine S-methyltran	N/A	no	0.943	0.721	0.514	8e-69

>sp\|P56707\|SMTA_ASTBI Selenocysteine methyltransferase OS=Astragalus bisulcatus GN=SMTA PE=1 SV=1	Back alignment and function desciption

 Score =  392 bits (1007), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/242 (75%), Positives = 212/242 (87%)

Query: 1   MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSG 60
           +LRRSVEIAREARD+Y++RC++SS D+  D RI K RPIL+A SVGSYGAYLADGSE+SG
Sbjct: 91  LLRRSVEIAREARDLYYQRCAESSSDNGDDSRILKQRPILIAGSVGSYGAYLADGSEFSG 150

Query: 61  NYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFS 120
           NYGDAI  ETLKDFHRR+VQ+L +S  DL+AFE +PNK+EAQAYA+LLEEENI  PAWF+
Sbjct: 151 NYGDAIKSETLKDFHRRKVQILADSGVDLLAFEAVPNKLEAQAYADLLEEENIITPAWFA 210

Query: 121 FNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYP 180
           F SKDG NVVSGDS+ EC SIAESC +VV+VGINCTPPRFI  LIL++KKVTAKPI+IYP
Sbjct: 211 FTSKDGNNVVSGDSIEECGSIAESCDKVVAVGINCTPPRFIHDLILLLKKVTAKPIVIYP 270

Query: 181 NSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSNR 240
           NSGE YDA RKEW QN+GV+DEDFVSYV KWCE GASLVGGCCRTTP+TI+GIY+ LS+ 
Sbjct: 271 NSGETYDAIRKEWGQNSGVTDEDFVSYVDKWCESGASLVGGCCRTTPDTIRGIYKILSSG 330

Query: 241 SS 242
            S
Sbjct: 331 QS 332

Catalyzes the methylation of selenocysteine with S-methylmethionine as donor. Does not methylate cysteine.
Astragalus bisulcatus (taxid: 20406)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: nEC: 3

>sp\|Q9M1W4\|HMT2_ARATH Homocysteine S-methyltransferase 2 OS=Arabidopsis thaliana GN=HMT-2 PE=1 SV=1	Back alignment and function description

>sp\|Q9FUM9\|HMT2_MAIZE Homocysteine S-methyltransferase 2 OS=Zea mays GN=HMT-2 PE=2 SV=1	Back alignment and function description

>sp\|Q9FUM8\|HMT3_MAIZE Homocysteine S-methyltransferase 3 OS=Zea mays GN=HMT-3 PE=2 SV=1	Back alignment and function description

>sp\|Q4VNK0\|SMTA_BRAOT Selenocysteine Se-methyltransferase OS=Brassica oleracea var. italica GN=SMT PE=1 SV=1	Back alignment and function description

>sp\|Q8LAX0\|HMT3_ARATH Homocysteine S-methyltransferase 3 OS=Arabidopsis thaliana GN=HMT3 PE=1 SV=2	Back alignment and function description

>sp\|Q9FUM7\|HMT4_MAIZE Homocysteine S-methyltransferase 4 OS=Zea mays GN=HMT-4 PE=2 SV=1	Back alignment and function description

>sp\|A4ZGQ8\|HMT1_BRAOT Homocysteine S-methyltransferase 1 OS=Brassica oleracea var. italica GN=HMT1 PE=1 SV=1	Back alignment and function description

>sp\|Q9SDL7\|HMT1_ARATH Homocysteine S-methyltransferase 1 OS=Arabidopsis thaliana GN=HMT-1 PE=1 SV=1	Back alignment and function description

>sp\|Q9FUN0\|HMT1_MAIZE Homocysteine S-methyltransferase 1 OS=Zea mays GN=HMT-1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		247
224062371		332	homocysteine s-methyltransferase [Populu	0.991	0.737	0.812	1e-116
255567526		343	5-methyltetrahydrofolate:homocysteine me	0.995	0.717	0.788	1e-114
224085515		341	homocysteine s-methyltransferase [Populu	0.971	0.703	0.809	1e-113
452114164		351	selenocysteine methyltransferase [Camell	1.0	0.703	0.773	1e-111
94958323		351	selenocysteine methyltransferase [Camell	1.0	0.703	0.773	1e-111
356572212		333	PREDICTED: selenocysteine methyltransfer	0.983	0.729	0.778	1e-110
336359707		339	selenocysteine methyltransferase [Astrag	0.979	0.713	0.773	1e-110
359479663		335	PREDICTED: homocysteine S-methyltransfer	0.959	0.707	0.802	1e-110
256592586		337	selenocysteine methyltransferase-like pr	1.0	0.732	0.753	1e-109
256592588		337	selenocysteine methyltransferase [Astrag	1.0	0.732	0.748	1e-108

>gi\|224062371\|ref\|XP_002300824.1\| homocysteine s-methyltransferase [Populus trichocarpa] gi\|222842550\|gb\|EEE80097.1\| homocysteine s-methyltransferase [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/245 (81%), Positives = 221/245 (90%)

Query: 1   MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSG 60
           +LR+SVEIA EARD+Y+ RC + S D   D R+ KHRPILVAASVGSYGAYLADGSEYSG
Sbjct: 86  LLRKSVEIACEARDIYYGRCREGSPDGSDDGRVLKHRPILVAASVGSYGAYLADGSEYSG 145

Query: 61  NYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFS 120
           NYGDAIT+ETLKDFHRRRVQ+L ES  DLIAFET+PNK+EAQAYAELLEEE+IKIPAWFS
Sbjct: 146 NYGDAITLETLKDFHRRRVQILAESGADLIAFETVPNKVEAQAYAELLEEEDIKIPAWFS 205

Query: 121 FNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYP 180
           FNSKDG+NVVSGDSLLECASIAESCK  V+VGINCTPPRFI  LIL IKKVT KPILIYP
Sbjct: 206 FNSKDGINVVSGDSLLECASIAESCKNAVAVGINCTPPRFIHELILSIKKVTTKPILIYP 265

Query: 181 NSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSNR 240
           NSGE YD DRKEWVQNTG+SD+DFVSYV+KWCE+GA+LVGGCCRTTP+TI+ IY+TL NR
Sbjct: 266 NSGESYDGDRKEWVQNTGISDQDFVSYVNKWCEIGAALVGGCCRTTPHTIRAIYKTLPNR 325

Query: 241 SSVLS 245
           S+ LS
Sbjct: 326 SAALS 330

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255567526\|ref\|XP_002524742.1\| 5-methyltetrahydrofolate:homocysteine methyltransferase, putative [Ricinus communis] gi\|223535926\|gb\|EEF37585.1\| 5-methyltetrahydrofolate:homocysteine methyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224085515\|ref\|XP_002307602.1\| homocysteine s-methyltransferase [Populus trichocarpa] gi\|222857051\|gb\|EEE94598.1\| homocysteine s-methyltransferase [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|452114164\|gb\|AGG09240.1\| selenocysteine methyltransferase [Camellia sinensis]	Back alignment and taxonomy information

>gi\|94958323\|gb\|ABF47292.1\| selenocysteine methyltransferase [Camellia sinensis]	Back alignment and taxonomy information

>gi\|356572212\|ref\|XP_003554264.1\| PREDICTED: selenocysteine methyltransferase-like [Glycine max]	Back alignment and taxonomy information

>gi\|336359707\|gb\|AEI53593.1\| selenocysteine methyltransferase [Astragalus chrysochlorus]	Back alignment and taxonomy information

>gi\|359479663\|ref\|XP_003632324.1\| PREDICTED: homocysteine S-methyltransferase 2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|256592586\|gb\|ACV03423.1\| selenocysteine methyltransferase-like protein [Astragalus drummondii]	Back alignment and taxonomy information

>gi\|256592588\|gb\|ACV03424.1\| selenocysteine methyltransferase [Astragalus leptocarpus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		247
TAIR\|locus:2077234		333	HMT2 "homocysteine methyltrans	0.971	0.720	0.699	3.1e-90
UNIPROTKB\|Q4VNK0		346	SMT "Selenocysteine Se-methylt	0.971	0.693	0.665	3e-85
TAIR\|locus:2094419		347	HMT3 "homocysteine S-methyltra	0.987	0.703	0.608	2.6e-79
UNIPROTKB\|A4ZGQ8		326	HMT1 "Homocysteine S-methyltra	0.939	0.711	0.491	4.3e-61
TAIR\|locus:2092120		326	HMT-1 [Arabidopsis thaliana (t	0.939	0.711	0.491	1e-59
UNIPROTKB\|Q47690		310	mmuM [Escherichia coli K-12 (t	0.874	0.696	0.364	1.1e-34
FB\|FBgn0032727		331	CG10623 [Drosophila melanogast	0.886	0.661	0.308	9.8e-32
ZFIN\|ZDB-GENE-030131-9545		311	zgc:172121 "zgc:172121" [Danio	0.866	0.688	0.353	1.2e-28
FB\|FBgn0032726		331	CG10621 [Drosophila melanogast	0.902	0.673	0.282	3.9e-28
CGD\|CAL0004923		311	SAM4 [Candida albicans (taxid:	0.785	0.623	0.315	2.7e-20

TAIR\|locus:2077234 HMT2 "homocysteine methyltransferase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 900 (321.9 bits), Expect = 3.1e-90, P = 3.1e-90
 Identities = 170/243 (69%), Positives = 199/243 (81%)

Query:     1 MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSG 60
             +L++SVEIA EAR+ Y+++C  SS     DD+I K RPILVAASVGSYGAYLADGSEYSG
Sbjct:    94 LLKKSVEIATEARNSYYDKCGTSSS---MDDKILKKRPILVAASVGSYGAYLADGSEYSG 150

Query:    61 NYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIXXXXXXXXXXXXNIKIPAWFS 120
              YGD+IT+E LKDFHRRR+QVL ES  DLIAFETIPNKI            ++KIP WFS
Sbjct:   151 IYGDSITLEKLKDFHRRRLQVLAESGADLIAFETIPNKIEAQAFADLLEEGDVKIPGWFS 210

Query:   121 FNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYP 180
             FNSKDGVNVVSGDS+ EC SIAE+C++VV+VGINCTPPRFI GL+L I+KVT+KPIL+YP
Sbjct:   211 FNSKDGVNVVSGDSIKECISIAENCEKVVAVGINCTPPRFIEGLVLEIEKVTSKPILVYP 270

Query:   181 NSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSNR 240
             NSGE YDADRKEWV+NTGV DEDFVSYV KW + G SL+GGCCRTTP TI+ I++ L NR
Sbjct:   271 NSGESYDADRKEWVENTGVGDEDFVSYVEKWMDAGVSLLGGCCRTTPTTIRAIHKRLVNR 330

Query:   241 SSV 243
              S+
Sbjct:   331 RSL 333

GO:0005737 "cytoplasm" evidence=ISM

GO:0008898 "homocysteine S-methyltransferase activity" evidence=IEA;ISS;IDA

GO:0009086 "methionine biosynthetic process" evidence=RCA;IDA

GO:0033528 "S-methylmethionine cycle" evidence=IMP

GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA

GO:0006260 "DNA replication" evidence=RCA

GO:0006306 "DNA methylation" evidence=RCA

GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA

GO:0008283 "cell proliferation" evidence=RCA

GO:0009616 "virus induced gene silencing" evidence=RCA

GO:0010050 "vegetative phase change" evidence=RCA

GO:0043687 "post-translational protein modification" evidence=RCA

GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA

GO:0051567 "histone H3-K9 methylation" evidence=RCA

UNIPROTKB\|Q4VNK0 SMT "Selenocysteine Se-methyltransferase" [Brassica oleracea var. italica (taxid:36774)]	Back alignment and assigned GO terms

TAIR\|locus:2094419 HMT3 "homocysteine S-methyltransferase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|A4ZGQ8 HMT1 "Homocysteine S-methyltransferase 1" [Brassica oleracea var. italica (taxid:36774)]	Back alignment and assigned GO terms

TAIR\|locus:2092120 HMT-1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q47690 mmuM [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

FB\|FBgn0032727 CG10623 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-9545 zgc:172121 "zgc:172121" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

FB\|FBgn0032726 CG10621 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

CGD\|CAL0004923 SAM4 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9M1W4	HMT2_ARATH	2, ., 1, ., 1, ., 1, 0	0.7366	0.9716	0.7207	yes	no
P56707	SMTA_ASTBI	2, ., 1, ., 1, ., n, 3	0.7561	0.9797	0.7159	N/A	no
Q4VNK0	SMTA_BRAOT	2, ., 1, ., 1, ., n, 3	0.7046	0.9392	0.6705	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1	0.963
4th Layer	2.1.1.10	0.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	HMT1	homocysteine s-methyltransferase (EC-2.1.1.10) (332 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	eugene3.00880022	RecName- Full=Adenosylhomocysteinase; EC=3.3.1.1; (485 aa)	•	•	0.928
	estExt_Genewise1_v1.C_LG_I3343	adenosylhomocysteinase/s-adenosyl-l-homocysteine hydrolase (EC-3.3.1.1) (485 aa)	•	•	0.928
	AdoMet5	s-adenosylmethionine synthetase 5 (EC-2.5.1.6); Catalyzes the formation of S-adenosylmethionine [...] (392 aa)	•	•	0.927
	METK3	RecName- Full=S-adenosylmethionine synthetase; EC=2.5.1.6;; Catalyzes the formation of S-adenos [...] (396 aa)	•	•	0.927
	AdoMet3	s-adenosylmethionine synthetase 3 (EC-2.5.1.6); Catalyzes the formation of S-adenosylmethionine [...] (395 aa)	•	•	0.927
	METK4	RecName- Full=S-adenosylmethionine synthetase; EC=2.5.1.6;; Catalyzes the formation of S-adenos [...] (391 aa)	•	•	0.927
	METK2	RecName- Full=S-adenosylmethionine synthetase; EC=2.5.1.6;; Catalyzes the formation of S-adenos [...] (393 aa)	•	•	0.926
	METK1	RecName- Full=S-adenosylmethionine synthetase; EC=2.5.1.6;; Catalyzes the formation of S-adenos [...] (393 aa)	•	•	0.926
	AMT7	aminotransferase family protein (EC-2.6.1.5) (407 aa)	•		0.899
	fgenesh4_pg.C_LG_III001784	methionine gamma-lyase (EC-4.4.1.11) (417 aa)	•		0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		247
PLN02489		335	PLN02489, PLN02489, homocysteine S-methyltransfera	1e-169
PRK09485		304	PRK09485, mmuM, homocysteine methyltransferase; Pr	1e-97
pfam02574		303	pfam02574, S-methyl_trans, Homocysteine S-methyltr	4e-66
COG2040		300	COG2040, MHT1, Homocysteine/selenocysteine methyla	2e-56
PRK08645		612	PRK08645, PRK08645, bifunctional homocysteine S-me	4e-21
COG0646		311	COG0646, MetH, Methionine synthase I (cobalamin-de	1e-17
TIGR02082		1178	TIGR02082, metH, 5-methyltetrahydrofolate--homocys	2e-11
PRK09490		1229	PRK09490, metH, B12-dependent methionine synthase;	3e-06
PRK07534		336	PRK07534, PRK07534, methionine synthase I; Validat	0.003

>gnl\|CDD\|215269 PLN02489, PLN02489, homocysteine S-methyltransferase	Back alignment and domain information

 Score =  469 bits (1210), Expect = e-169
 Identities = 179/241 (74%), Positives = 210/241 (87%), Gaps = 2/241 (0%)

Query: 1   MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSG 60
           +LR+SVEIA EARD+++++C K S       R   +RPILVAAS+GSYGAYLADGSEYSG
Sbjct: 97  LLRKSVEIACEARDIFWDKCQKGST--SRPGRELSYRPILVAASIGSYGAYLADGSEYSG 154

Query: 61  NYGDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFS 120
           +YG ++T+E LKDFHRRR+QVL E+ PDLIAFETIPNK+EAQAY ELLEEENIKIPAW S
Sbjct: 155 DYGPSVTLEKLKDFHRRRLQVLAEAGPDLIAFETIPNKLEAQAYVELLEEENIKIPAWIS 214

Query: 121 FNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYP 180
           FNSKDGVNVVSGDSLLECASIA+SCK+VV+VGINCTPPRFI GLIL I+KVT+KPI++YP
Sbjct: 215 FNSKDGVNVVSGDSLLECASIADSCKKVVAVGINCTPPRFIHGLILSIRKVTSKPIVVYP 274

Query: 181 NSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSNR 240
           NSGE YD + KEWV++TGVSDEDFVSYV+KW + GASL+GGCCRTTPNTI+ I + LS R
Sbjct: 275 NSGETYDGEAKEWVESTGVSDEDFVSYVNKWRDAGASLIGGCCRTTPNTIRAISKALSER 334

Query: 241 S 241
            
Sbjct: 335 L 335

Length = 335

>gnl\|CDD\|181899 PRK09485, mmuM, homocysteine methyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|217114 pfam02574, S-methyl_trans, Homocysteine S-methyltransferase	Back alignment and domain information

>gnl\|CDD\|224951 COG2040, MHT1, Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|236321 PRK08645, PRK08645, bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|223719 COG0646, MetH, Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233714 TIGR02082, metH, 5-methyltetrahydrofolate--homocysteine methyltransferase	Back alignment and domain information

>gnl\|CDD\|236539 PRK09490, metH, B12-dependent methionine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|236045 PRK07534, PRK07534, methionine synthase I; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		247
PLN02489		335	homocysteine S-methyltransferase	100.0
PRK09485		304	mmuM homocysteine methyltransferase; Provisional	100.0
KOG1579		317	consensus Homocysteine S-methyltransferase [Amino	100.0
COG2040		300	MHT1 Homocysteine/selenocysteine methylase (S-meth	100.0
PRK07534		336	methionine synthase I; Validated	100.0
PF02574		305	S-methyl_trans: Homocysteine S-methyltransferase;	100.0
COG0646		311	MetH Methionine synthase I (cobalamin-dependent),	100.0
PRK08645		612	bifunctional homocysteine S-methyltransferase/5,10	100.0
PRK09490		1229	metH B12-dependent methionine synthase; Provisiona	100.0
TIGR02082		1178	metH 5-methyltetrahydrofolate--homocysteine methyl	100.0
COG0646		311	MetH Methionine synthase I (cobalamin-dependent),	97.61
TIGR02082		1178	metH 5-methyltetrahydrofolate--homocysteine methyl	96.91
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	96.89
PRK03620		303	5-dehydro-4-deoxyglucarate dehydratase; Provisiona	96.69
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	96.6
PRK09485		304	mmuM homocysteine methyltransferase; Provisional	96.59
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	96.29
PRK09490		1229	metH B12-dependent methionine synthase; Provisiona	96.22
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	96.19
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	95.97
PRK07534		336	methionine synthase I; Validated	95.94
PF00490		324	ALAD: Delta-aminolevulinic acid dehydratase; Inter	95.87
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	95.86
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	95.78
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	95.73
PRK13384		322	delta-aminolevulinic acid dehydratase; Provisional	95.69
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	95.62
PRK08645		612	bifunctional homocysteine S-methyltransferase/5,10	95.59
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	95.5
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	95.49
cd04823		320	ALAD_PBGS_aspartate_rich Porphobilinogen synthase	95.47
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	95.44
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	95.41
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	95.37
PRK09283		323	delta-aminolevulinic acid dehydratase; Validated	95.35
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	95.3
PRK09250		348	fructose-bisphosphate aldolase; Provisional	95.2
TIGR00683		290	nanA N-acetylneuraminate lyase. N-acetylneuraminat	95.14
cd04824		320	eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas	95.09
PF00701		289	DHDPS: Dihydrodipicolinate synthetase family; Inte	95.03
TIGR03249		296	KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh	94.97
PRK14042		596	pyruvate carboxylase subunit B; Provisional	94.96
PRK06852		304	aldolase; Validated	94.94
PLN02489		335	homocysteine S-methyltransferase	94.93
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	94.92
cd00384		314	ALAD_PBGS Porphobilinogen synthase (PBGS), which i	94.88
cd00951		289	KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also	94.85
cd00952		309	CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate	94.81
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	94.72
COG0113		330	HemB Delta-aminolevulinic acid dehydratase [Coenzy	94.61
TIGR00742		318	yjbN tRNA dihydrouridine synthase A. Members of th	94.54
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	94.47
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	94.41
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	94.36
cd00958		235	DhnA Class I fructose-1,6-bisphosphate (FBP) aldol	94.36
PRK12581		468	oxaloacetate decarboxylase; Provisional	94.28
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	94.27
TIGR00222		263	panB 3-methyl-2-oxobutanoate hydroxymethyltransfer	94.26
PRK00865		261	glutamate racemase; Provisional	94.16
PRK14040		593	oxaloacetate decarboxylase; Provisional	94.14
cd02911		233	arch_FMN Archeal FMN-binding domain. This family o	94.08
TIGR02127		261	pyrF_sub2 orotidine 5'-phosphate decarboxylase, su	94.06
PRK13523		337	NADPH dehydrogenase NamA; Provisional	93.92
cd00950		284	DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke	93.91
PRK03170		292	dihydrodipicolinate synthase; Provisional	93.87
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	93.87
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	93.79
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	93.68
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	93.67
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	93.55
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	93.52
KOG2335		358	consensus tRNA-dihydrouridine synthase [Translatio	93.51
PLN02274		505	inosine-5'-monophosphate dehydrogenase	93.47
cd06557		254	KPHMT-like Ketopantoate hydroxymethyltransferase (	93.46
PF02574		305	S-methyl_trans: Homocysteine S-methyltransferase;	93.43
cd00954		288	NAL N-Acetylneuraminic acid aldolase, also called	93.41
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	93.41
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	93.34
cd08210		364	RLP_RrRLP Ribulose bisphosphate carboxylase like p	93.3
TIGR00674		285	dapA dihydrodipicolinate synthase. Dihydrodipicoli	93.24
PRK04147		293	N-acetylneuraminate lyase; Provisional	93.21
cd00465		306	URO-D_CIMS_like The URO-D_CIMS_like protein superf	93.19
PRK11815		333	tRNA-dihydrouridine synthase A; Provisional	93.17
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	93.16
PF01207		309	Dus: Dihydrouridine synthase (Dus); InterPro: IPR0	93.14
PLN02617		538	imidazole glycerol phosphate synthase hisHF	92.92
PRK11613		282	folP dihydropteroate synthase; Provisional	92.91
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	92.91
PRK02412		253	aroD 3-dehydroquinate dehydratase; Provisional	92.76
PRK15452		443	putative protease; Provisional	92.68
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	92.66
COG0407		352	HemE Uroporphyrinogen-III decarboxylase [Coenzyme	92.62
PRK05581		220	ribulose-phosphate 3-epimerase; Validated	92.6
TIGR02313		294	HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac	92.57
PRK00311		264	panB 3-methyl-2-oxobutanoate hydroxymethyltransfer	92.43
PF03437		254	BtpA: BtpA family; InterPro: IPR005137 Photosystem	92.42
cd07944		266	DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-	92.12
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	92.1
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	92.02
COG0821		361	gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat	91.85
PF01487		224	DHquinase_I: Type I 3-dehydroquinase; InterPro: IP	91.83
COG5016		472	Pyruvate/oxaloacetate carboxyltransferase [Energy	91.83
PRK09282		592	pyruvate carboxylase subunit B; Validated	91.79
PLN02591		250	tryptophan synthase	91.69
TIGR01235		1143	pyruv_carbox pyruvate carboxylase. This enzyme pla	91.69
PF01729		169	QRPTase_C: Quinolinate phosphoribosyl transferase,	91.65
PRK15063		428	isocitrate lyase; Provisional	91.47
PRK12330		499	oxaloacetate decarboxylase; Provisional	91.3
TIGR00612		346	ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho	91.28
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	91.2
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	91.06
TIGR01108		582	oadA oxaloacetate decarboxylase alpha subunit. Thi	90.97
cd08205		367	RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l	90.72
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	90.72
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	90.71
PRK12999		1146	pyruvate carboxylase; Reviewed	90.69
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	90.69
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	90.53
PRK08227		264	autoinducer 2 aldolase; Validated	90.4
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	90.38
PRK12331		448	oxaloacetate decarboxylase; Provisional	90.24
PRK14041		467	oxaloacetate decarboxylase; Provisional	90.0
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	89.92
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	89.87
PRK11320		292	prpB 2-methylisocitrate lyase; Provisional	89.73
PRK08385		278	nicotinate-nucleotide pyrophosphorylase; Provision	89.62
COG2513		289	PrpB PEP phosphonomutase and related enzymes [Carb	89.61
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	89.6
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	89.53
PRK12858		340	tagatose 1,6-diphosphate aldolase; Reviewed	89.49
PLN02417		280	dihydrodipicolinate synthase	89.41
PF02548		261	Pantoate_transf: Ketopantoate hydroxymethyltransfe	89.3
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	89.15
TIGR02317		285	prpB methylisocitrate lyase. Members of this famil	89.11
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	89.09
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	89.0
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	88.98
TIGR01093		228	aroD 3-dehydroquinate dehydratase, type I. Type II	88.93
PRK07896		289	nicotinate-nucleotide pyrophosphorylase; Provision	88.92
cd00502		225	DHQase_I Type I 3-dehydroquinase, (3-dehydroquinat	88.87
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	88.85
PRK00366		360	ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s	88.84
PRK02048		611	4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha	88.52
TIGR02151		333	IPP_isom_2 isopentenyl-diphosphate delta-isomerase	88.52
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	88.47
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	88.39
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	88.34
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	88.34
TIGR01463		340	mtaA_cmuA methyltransferase, MtaA/CmuA family. Thi	88.31
PLN02925		733	4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha	88.23
PRK15063		428	isocitrate lyase; Provisional	88.21
PRK02506		310	dihydroorotate dehydrogenase 1A; Reviewed	88.0
PRK05848		273	nicotinate-nucleotide pyrophosphorylase; Provision	87.93
TIGR02319		294	CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos	87.93
COG0826		347	Collagenase and related proteases [Posttranslation	87.77
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	87.72
cd02930		353	DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin	87.64
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	87.29
COG1038		1149	PycA Pyruvate carboxylase [Energy production and c	87.13
PF04551		359	GcpE: GcpE protein; InterPro: IPR004588 This prote	87.12
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	87.09
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	86.92
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	86.87
PRK12858		340	tagatose 1,6-diphosphate aldolase; Reviewed	86.85
cd06556		240	ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup	86.76
cd02931		382	ER_like_FMN Enoate reductase (ER)-like FMN-binding	86.76
PRK06096		284	molybdenum transport protein ModD; Provisional	86.73
TIGR02660		365	nifV_homocitr homocitrate synthase NifV. This fami	86.72
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	86.71
TIGR01949		258	AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep	86.71
PF01208		343	URO-D: Uroporphyrinogen decarboxylase (URO-D); Int	86.6
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	86.56
PRK00694		606	4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha	86.47
PRK07428		288	nicotinate-nucleotide pyrophosphorylase; Provision	86.45
PRK05692		287	hydroxymethylglutaryl-CoA lyase; Provisional	86.4
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	86.36
cd00953		279	KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas	86.16
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	85.66
PLN02433		345	uroporphyrinogen decarboxylase	85.29
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	85.2
COG0434		263	SgcQ Predicted TIM-barrel enzyme [General function	85.08
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	85.02
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	84.97
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	84.94
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	84.93
PRK00115		346	hemE uroporphyrinogen decarboxylase; Validated	84.87
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	84.77
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	84.52
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	84.45
PRK00125		278	pyrF orotidine 5'-phosphate decarboxylase; Reviewe	84.38
TIGR00259		257	thylakoid_BtpA membrane complex biogenesis protein	84.23
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	83.97
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	83.88
TIGR01334		277	modD putative molybdenum utilization protein ModD.	83.82
COG0042		323	tRNA-dihydrouridine synthase [Translation, ribosom	83.75
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	83.66
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	83.57
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	83.56
cd00717		335	URO-D Uroporphyrinogen decarboxylase (URO-D) is a	83.48
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	83.21
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	82.95
PRK14024		241	phosphoribosyl isomerase A; Provisional	82.93
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	82.83
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	82.72
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	82.71
TIGR01036		335	pyrD_sub2 dihydroorotate dehydrogenase, subfamily	82.68
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	82.59
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	82.39
PLN02424		332	ketopantoate hydroxymethyltransferase	82.12
cd06556		240	ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup	82.12
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	81.89
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	81.7
PRK09016		296	quinolinate phosphoribosyltransferase; Validated	81.6
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	81.53
cd07938		274	DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase,	81.5
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	81.49
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	81.37
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	81.32
PRK06106		281	nicotinate-nucleotide pyrophosphorylase; Provision	81.3
cd03307		326	Mta_CmuA_like MtaA_CmuA_like family. MtaA/CmuA, al	80.92
TIGR02990		239	ectoine_eutA ectoine utilization protein EutA. Mem	80.77
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	80.58
PLN02520		529	bifunctional 3-dehydroquinate dehydratase/shikimat	80.51
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	80.5
PRK06498		531	isocitrate lyase; Provisional	80.36
PF13714		238	PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB	80.25
PLN02746		347	hydroxymethylglutaryl-CoA lyase	80.1
cd02811		326	IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di	80.04

>PLN02489 homocysteine S-methyltransferase	Back alignment and domain information

Probab=100.00  E-value=6.5e-61  Score=436.07  Aligned_cols=237  Identities=75%  Similarity=1.239  Sum_probs=208.9

Q ss_pred             CHHHHHHHHHHHHHHHHhhccCCCCCCCCCCCCCCCCCeEEEEecCCcccCcCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q 025860            1 MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQ   80 (247)
Q Consensus         1 l~~~av~lA~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~VaGsiGP~g~~l~~g~eY~g~y~~~~s~~e~~~~~~~q~~   80 (247)
                      |+++||+||++|+++|..+++..++  .+..+...+++++|+|||||+|+++.+|+||+|+|++++++++++++|++|++
T Consensus        97 l~~~av~lA~~a~~~~~~~~~~~~~--~~~~~~~~~~~~~VaGsiGP~g~~l~~g~ey~g~y~~~~~~~e~~~~~~~qi~  174 (335)
T PLN02489         97 LLRKSVEIACEARDIFWDKCQKGST--SRPGRELSYRPILVAASIGSYGAYLADGSEYSGDYGPSVTLEKLKDFHRRRLQ  174 (335)
T ss_pred             HHHHHHHHHHHHHHHHhhhcccccc--cccccccCCCCcEEEEEcCCccccccCCcccCCCCccCCCHHHHHHHHHHHHH
Confidence            5789999999999987543211100  01112233457999999999999999999999999977899999999999999


Q ss_pred             HHhcCCCCEEEEecCCCHHHHHHHHHHHHhhCCCCcEEEEEEEcCCCcccCCCcHHHHHHHHHhCCCCeEEEEcCCChhH
Q 025860           81 VLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCTPPRF  160 (247)
Q Consensus        81 ~l~~~gvD~i~~ET~~~~~E~~aa~~~~~~~~~~~pv~is~~~~~~~~l~~G~~~~~~~~~~~~~~~~~avG~NC~~p~~  160 (247)
                      .|+++|||+|+|||||++.|++++++++++.+.++|+|+||+++++++|.+|+++.+++..+.+..++++||+||++|+.
T Consensus       175 ~l~~~gvD~i~~ET~~~l~E~~a~~~~~~~~~~~~p~~iS~t~~~~~~l~~G~~~~~~~~~~~~~~~~~~iGiNC~~p~~  254 (335)
T PLN02489        175 VLAEAGPDLIAFETIPNKLEAQAYVELLEEENIKIPAWISFNSKDGVNVVSGDSLLECASIADSCKKVVAVGINCTPPRF  254 (335)
T ss_pred             HHHhCCCCEEEEeccCChHHHHHHHHHHHHcCCCCeEEEEEEeCCCCccCCCCcHHHHHHHHHhcCCceEEEecCCCHHH
Confidence            99999999999999999999999999999875569999999999999999999999999988754578999999999999


Q ss_pred             HHHHHHHHHhhcCCCEEEEeCCCCcccccccccccCCCCChHHHHHHHHHHHHcCCeEEeecCCCChHHHHHHHHHhhC
Q 025860          161 ISGLILIIKKVTAKPILIYPNSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSN  239 (247)
Q Consensus       161 ~~~~l~~l~~~~~~pl~vyPNaG~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~iIGGCCGt~P~hI~al~~~l~~  239 (247)
                      +.++|+.++...+.||++|||+|.+|+...+.|......+|++|++++++|++.|++||||||||||+||++|++.|++
T Consensus       255 ~~~~l~~l~~~~~~pl~vyPNaG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ga~iIGGCCgt~P~hI~al~~~l~~  333 (335)
T PLN02489        255 IHGLILSIRKVTSKPIVVYPNSGETYDGEAKEWVESTGVSDEDFVSYVNKWRDAGASLIGGCCRTTPNTIRAISKALSE  333 (335)
T ss_pred             HHHHHHHHHhhcCCcEEEECCCCCCCCCccCcccCCCCCCHHHHHHHHHHHHHCCCcEEeeCCCCCHHHHHHHHHHHhc
Confidence            9999999998888999999999999988777887554567999999999999999999999999999999999999874

>PRK09485 mmuM homocysteine methyltransferase; Provisional	Back alignment and domain information

>KOG1579 consensus Homocysteine S-methyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG2040 MHT1 Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK07534 methionine synthase I; Validated	Back alignment and domain information

>PF02574 S-methyl_trans: Homocysteine S-methyltransferase; InterPro: IPR003726 S-methylmethionine: homocysteine methyltransferase 2	Back alignment and domain information

>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed	Back alignment and domain information

>PRK09490 metH B12-dependent methionine synthase; Provisional	Back alignment and domain information

>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase	Back alignment and domain information

>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK09485 mmuM homocysteine methyltransferase; Provisional	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>PRK09490 metH B12-dependent methionine synthase; Provisional	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>PRK07534 methionine synthase I; Validated	Back alignment and domain information

>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway []	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>PRK13384 delta-aminolevulinic acid dehydratase; Provisional	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>cd04823 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>PRK09283 delta-aminolevulinic acid dehydratase; Validated	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>PRK09250 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR00683 nanA N-acetylneuraminate lyase	Back alignment and domain information

>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll	Back alignment and domain information

>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants	Back alignment and domain information

>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase	Back alignment and domain information

>PRK14042 pyruvate carboxylase subunit B; Provisional	Back alignment and domain information

>PRK06852 aldolase; Validated	Back alignment and domain information

>PLN02489 homocysteine S-methyltransferase	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll	Back alignment and domain information

>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases	Back alignment and domain information

>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA)	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism]	Back alignment and domain information

>TIGR00742 yjbN tRNA dihydrouridine synthase A	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea	Back alignment and domain information

>PRK12581 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase	Back alignment and domain information

>PRK00865 glutamate racemase; Provisional	Back alignment and domain information

>PRK14040 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>cd02911 arch_FMN Archeal FMN-binding domain	Back alignment and domain information

>TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase, subfamily 2	Back alignment and domain information

>PRK13523 NADPH dehydrogenase NamA; Provisional	Back alignment and domain information

>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis	Back alignment and domain information

>PRK03170 dihydrodipicolinate synthase; Provisional	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway	Back alignment and domain information

>PF02574 S-methyl_trans: Homocysteine S-methyltransferase; InterPro: IPR003726 S-methylmethionine: homocysteine methyltransferase 2	Back alignment and domain information

>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid)	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R	Back alignment and domain information

>TIGR00674 dapA dihydrodipicolinate synthase	Back alignment and domain information

>PRK04147 N-acetylneuraminate lyase; Provisional	Back alignment and domain information

>cd00465 URO-D_CIMS_like The URO-D_CIMS_like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases, as well as cobalamine (B12) independent methionine synthases	Back alignment and domain information

>PRK11815 tRNA-dihydrouridine synthase A; Provisional	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>PRK11613 folP dihydropteroate synthase; Provisional	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional	Back alignment and domain information

>PRK15452 putative protease; Provisional	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>COG0407 HemE Uroporphyrinogen-III decarboxylase [Coenzyme metabolism]	Back alignment and domain information

>PRK05581 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed	Back alignment and domain information

>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane	Back alignment and domain information

>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism]	Back alignment and domain information

>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4	Back alignment and domain information

>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>PRK09282 pyruvate carboxylase subunit B; Validated	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>TIGR01235 pyruv_carbox pyruvate carboxylase	Back alignment and domain information

>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2	Back alignment and domain information

>PRK15063 isocitrate lyase; Provisional	Back alignment and domain information

>PRK12330 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit	Back alignment and domain information

>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>PRK12999 pyruvate carboxylase; Reviewed	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK08227 autoinducer 2 aldolase; Validated	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>PRK12331 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK14041 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK11320 prpB 2-methylisocitrate lyase; Provisional	Back alignment and domain information

>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed	Back alignment and domain information

>PLN02417 dihydrodipicolinate synthase	Back alignment and domain information

>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>TIGR02317 prpB methylisocitrate lyase	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR01093 aroD 3-dehydroquinate dehydratase, type I	Back alignment and domain information

>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>cd00502 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed	Back alignment and domain information

>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional	Back alignment and domain information

>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>TIGR01463 mtaA_cmuA methyltransferase, MtaA/CmuA family	Back alignment and domain information

>PLN02925 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase	Back alignment and domain information

>PRK15063 isocitrate lyase; Provisional	Back alignment and domain information

>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed	Back alignment and domain information

>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase	Back alignment and domain information

>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>COG1038 PycA Pyruvate carboxylase [Energy production and conversion]	Back alignment and domain information

>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed	Back alignment and domain information

>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds	Back alignment and domain information

>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain	Back alignment and domain information

>PRK06096 molybdenum transport protein ModD; Provisional	Back alignment and domain information

>TIGR02660 nifV_homocitr homocitrate synthase NifV	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>PF01208 URO-D: Uroporphyrinogen decarboxylase (URO-D); InterPro: IPR000257 Uroporphyrinogen decarboxylase (URO-D), the fifth enzyme of the haem biosynthetic pathway, catalyses the sequential decarboxylation of the four acetyl side chains of uroporphyrinogen to yield coproporphyrinogen []	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated	Back alignment and domain information

>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PLN02433 uroporphyrinogen decarboxylase	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only]	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>PRK00115 hemE uroporphyrinogen decarboxylase; Validated	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>PRK00125 pyrF orotidine 5'-phosphate decarboxylase; Reviewed	Back alignment and domain information

>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>TIGR01334 modD putative molybdenum utilization protein ModD	Back alignment and domain information

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd00717 URO-D Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02424 ketopantoate hydroxymethyltransferase	Back alignment and domain information

>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>PRK09016 quinolinate phosphoribosyltransferase; Validated	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>cd03307 Mta_CmuA_like MtaA_CmuA_like family	Back alignment and domain information

>TIGR02990 ectoine_eutA ectoine utilization protein EutA	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>PRK06498 isocitrate lyase; Provisional	Back alignment and domain information

>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B	Back alignment and domain information

>PLN02746 hydroxymethylglutaryl-CoA lyase	Back alignment and domain information

>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		247
1q7m_A		566	Cobalamin-Dependent Methionine Synthase (Meth) From		3e-08
1q85_A		566	Cobalamin-Dependent Methionine Synthase (1-566) Fro		1e-07

>pdb|1Q7M|A Chain A, Cobalamin-Dependent Methionine Synthase (Meth) From Thermotoga Maritima (Oxidized, Monoclinic) Length = 566

Back alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 47/188 (25%), Positives = 86/188 (45%), Gaps = 18/188 (9%) Query: 63 GDAITVETLKDFHRRRVQVLVESAPDLIAFETIPN--KIXXXXXXXXXXXXNIKIPAWFS 120 G + E ++F R V+++VE D I FET + ++ ++ + A + Sbjct: 117 GSTLFEEFYENF-RETVEIMVEEGVDGIIFETFSDILELKAAVLAAREVSRDVFLIAHMT 175 Query: 121 FNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCT-PPRFISGLILIIKKVTAKPILIY 179 F+ K G ++ D + E + ++GINC+ P I + + + T K +++ Sbjct: 176 FDEK-GRSLTGTDPANFAITFDEL--DIDALGINCSLGPEEILPIFQELSQYTDKFLVVE 232 Query: 180 PNSGEFYDADRKEWVQNTG----VSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYR 235 PN+G K V+N + DF ++ + E+G ++ GGCC TTP +K + Sbjct: 233 PNAG-------KPIVENGKTVYPLKPHDFAVHIDSYYELGVNIFGGCCGTTPEHVKLFRK 285 Query: 236 TLSNRSSV 243 L NR + Sbjct: 286 VLGNRKPL 293

PyMOL of 1q7m

>pdb|1Q85|A Chain A, Cobalamin-Dependent Methionine Synthase (1-566) From Thermotoga Maritima (Cd2+ Complex, Se-Met) Length = 566

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		247
1lt8_A		406	Betaine-homocysteine methyltransferase; homocystei	5e-27
1q7z_A		566	5-methyltetrahydrofolate S-homocysteine methyltran	9e-18

>1lt8_A Betaine-homocysteine methyltransferase; homocysteine metabolism, homocysteinemia, zinc, thiol alkyl transfer; HET: CBH CIT; 2.05A {Homo sapiens} SCOP: c.1.26.1 PDB: 1lt7_A* 1umy_A Length = 406	Back alignment and structure

 Score =  106 bits (266), Expect = 5e-27
 Identities = 44/258 (17%), Positives = 81/258 (31%), Gaps = 51/258 (19%)

Query: 3   RRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSGNY 62
             + +IAR+  D                         LVA  V    +YL+  SE     
Sbjct: 101 EAAADIARQVAD---------------------EGDALVAGGVSQTPSYLSAKSE----- 134

Query: 63  GDAITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFN 122
                   +K    ++++V ++   D +  E   +  EA    E L       P   +  
Sbjct: 135 ------TEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGK--PVAATM- 185

Query: 123 SKDGVNVVSGDSLLECASIAESCKRVVSVGINC-TPPRFISGLILIIKKVTAK-----PI 176
           +      + G    E A           +G+NC   P      + ++K+          +
Sbjct: 186 AIGPEGDLHGVPPGEAAVRLVKA-GASIIGVNCHFDPTISLKTVKLMKEGLEAAQLKAHL 244

Query: 177 LIYPNSGEFYDADRKEWVQNT---------GVSDEDFVSYVSKWCEVGASLVGGCCRTTP 227
           +  P +    DA+++ ++              +  D   Y  +   +G   +GGCC   P
Sbjct: 245 MSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEP 304

Query: 228 NTIKGIYRTLSNRSSVLS 245
             I+ I   L+     L 
Sbjct: 305 YHIRAIAEELAPERGFLP 322

PyMOL of 1lt8

>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Length = 566	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		247
1q7z_A		566	5-methyltetrahydrofolate S-homocysteine methyltran	100.0
1lt8_A		406	Betaine-homocysteine methyltransferase; homocystei	100.0
1lt8_A		406	Betaine-homocysteine methyltransferase; homocystei	96.89
1z41_A		338	YQJM, probable NADH-dependent flavin oxidoreductas	96.55
2ehh_A		294	DHDPS, dihydrodipicolinate synthase; structural ge	96.51
3si9_A		315	DHDPS, dihydrodipicolinate synthase; structural ge	96.46
3cpr_A		304	Dihydrodipicolinate synthetase; (beta/alpha)8-barr	96.22
1q7z_A		566	5-methyltetrahydrofolate S-homocysteine methyltran	96.18
3qfe_A		318	Putative dihydrodipicolinate synthase family PROT;	96.15
3fkr_A		309	L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f	96.07
2ojp_A		292	DHDPS, dihydrodipicolinate synthase; dimer, lysine	96.02
2vc6_A		292	MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar	96.01
1f76_A		336	Dihydroorotate dehydrogenase; monomer, alpha-beta-	95.97
1o5k_A		306	DHDPS, dihydrodipicolinate synthase; TM1521, struc	95.95
3dz1_A		313	Dihydrodipicolinate synthase; lysine biosynthesis,	95.93
2e6f_A		314	Dihydroorotate dehydrogenase; chagas disease, pyri	95.91
2qjg_A		273	Putative aldolase MJ0400; beta-alpha barrel, lyase	95.88
1xky_A		301	Dihydrodipicolinate synthase; TIM barrel, , lysine	95.85
2r8w_A		332	AGR_C_1641P; APC7498, dihydrodipicolinate synthase	95.83
3na8_A		315	Putative dihydrodipicolinate synthetase; lyase; HE	95.74
2yxg_A		289	DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b	95.73
3a5f_A		291	Dihydrodipicolinate synthase; TIM barrel, enzyme,	95.68
3flu_A		297	DHDPS, dihydrodipicolinate synthase; TIM barrel, b	95.66
3m5v_A		301	DHDPS, dihydrodipicolinate synthase; TIM barrel, c	95.62
2wkj_A		303	N-acetylneuraminate lyase; directed evolution, sia	95.61
3tak_A		291	DHDPS, dihydrodipicolinate synthase; TIM barrel, l	95.61
2v9d_A		343	YAGE; dihydrodipicolinic acid synthase, N-acetyl n	95.59
3qze_A		314	DHDPS, dihydrodipicolinate synthase; alpha beta ba	95.5
3e96_A		316	Dihydrodipicolinate synthase; structural genomics,	95.46
2rfg_A		297	Dihydrodipicolinate synthase; beta barrel, amino-a	95.45
3eb2_A		300	Putative dihydrodipicolinate synthetase; lysine bi	95.41
3l21_A		304	DHDPS, dihydrodipicolinate synthase; DAPA, dimer,	95.41
3d0c_A		314	Dihydrodipicolinate synthase; lysine biosynthesis,	95.4
3b4u_A		294	Dihydrodipicolinate synthase; structural genomics,	95.32
3s5o_A		307	4-hydroxy-2-oxoglutarate aldolase, mitochondrial;	95.31
3daq_A		292	DHDPS, dihydrodipicolinate synthase; lysine biosyn	95.23
1f6k_A		293	N-acetylneuraminate lyase; beta barrel; 1.60A {Hae	95.21
1jub_A		311	Dihydroorotate dehydrogenase A; homodimer, alpha-b	95.03
3i4e_A		439	Isocitrate lyase; structural genomics, seattle str	94.93
2nuw_A		288	2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a	94.82
3eol_A		433	Isocitrate lyase; seattle structural center for in	94.66
2r91_A		286	2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM	94.58
1to3_A		304	Putative aldolase YIHT; beta-alpha barrel, structu	94.57
3b0p_A		350	TRNA-dihydrouridine synthase; TIM barrel, oxidored	94.52
3lg3_A		435	Isocitrate lyase; conserved, CD, proteomics eviden	94.42
1w3i_A		293	EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m	94.35
2hmc_A		344	AGR_L_411P, dihydrodipicolinate synthase; alpha-be	94.25
3h5d_A		311	DHDPS, dihydrodipicolinate synthase; lysine biosyn	93.96
1w1z_A		328	Delta-aminolevulinic acid dehydratase; synthase, t	93.96
3gr7_A		340	NADPH dehydrogenase; flavin, FMN, beta-alpha-barre	93.92
2nx9_A		464	Oxaloacetate decarboxylase 2, subunit alpha; carbo	93.87
4h3d_A		258	3-dehydroquinate dehydratase; structural genomics,	93.85
1ydn_A		295	Hydroxymethylglutaryl-COA lyase; TIM-barrel protei	93.65
4fo4_A		366	Inosine 5'-monophosphate dehydrogenase; structural	93.28
3obk_A		356	Delta-aminolevulinic acid dehydratase; ssgcid, str	93.27
4dpp_A		360	DHDPS 2, dihydrodipicolinate synthase 2, chloropla	93.21
1ps9_A		671	2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel	93.1
3noy_A		366	4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth;	93.07
1jub_A		311	Dihydroorotate dehydrogenase A; homodimer, alpha-b	92.98
1vhn_A		318	Putative flavin oxidoreducatase; structural genomi	92.92
1rqb_A		539	Transcarboxylase 5S subunit; TIM-barrel, carbamyla	92.74
4ef8_A		354	Dihydroorotate dehydrogenase; phenyl isothiocyanat	92.66
3eoo_A		298	Methylisocitrate lyase; seattle structural genomic	92.57
1h7n_A		342	5-aminolaevulinic acid dehydratase; lyase, aldolas	92.49
3o1n_A		276	3-dehydroquinate dehydratase; structural genomics,	92.46
3igs_A		232	N-acetylmannosamine-6-phosphate 2-epimerase 2; ene	92.28
1l6s_A		323	Porphobilinogen synthase; dehydratase, lyase; HET:	92.25
1zlp_A		318	PSR132, petal death protein; TIM-barrel, helix swa	92.12
1xg4_A		295	Probable methylisocitrate lyase; 2-methylisocitrat	92.03
1aj0_A		282	DHPS, dihydropteroate synthase; antibiotic, resist	91.95
1f8m_A		429	Isocitrate lyase, ICL; alpha-beta barrel, helix-sw	91.73
1vzw_A		244	Phosphoribosyl isomerase A; histidine biosynthesis	91.68
2gzm_A		267	Glutamate racemase; enzyme, isomerase; HET: DGL; 1	91.68
3q58_A		229	N-acetylmannosamine-6-phosphate 2-epimerase; TIM b	91.55
4h3d_A		258	3-dehydroquinate dehydratase; structural genomics,	91.23
1sfl_A		238	3-dehydroquinate dehydratase; 3-dehydroquinase, en	91.22
3lye_A		307	Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre	91.2
4hb7_A		270	Dihydropteroate synthase; transferase; 1.95A {Stap	91.17
3f4w_A		211	Putative hexulose 6 phosphate synthase; humps, mal	90.99
3ih1_A		305	Methylisocitrate lyase; alpha-beta structure, TIM-	90.88
1s2w_A		295	Phosphoenolpyruvate phosphomutase; phosphonopyruva	90.76
1w5q_A		337	Delta-aminolevulinic acid dehydratase; synthase, e	90.49
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	90.05
2qf7_A		1165	Pyruvate carboxylase protein; multi-domain, multi-	90.0
2hjp_A		290	Phosphonopyruvate hydrolase; phosporus-Ca cleavage	89.93
3r89_A		290	Orotidine 5'-phosphate decarboxylase; PSI-biology,	89.92
3oix_A		345	Putative dihydroorotate dehydrogenase; dihydrooro	89.9
4gj1_A		243	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me	89.88
2yr1_A		257	3-dehydroquinate dehydratase; amino acid biosynthe	89.65
3oix_A		345	Putative dihydroorotate dehydrogenase; dihydrooro	89.24
3hgj_A		349	Chromate reductase; TIM barrel, oxidoreductase; HE	89.15
3zwt_A		367	Dihydroorotate dehydrogenase (quinone), mitochond;	89.13
1pv8_A		330	Delta-aminolevulinic acid dehydratase; porphobilin	88.93
1zuw_A		272	Glutamate racemase 1; (R)-glutamate, peptidoglycan	88.92
1icp_A		376	OPR1, 12-oxophytodienoate reductase 1; beta-alpha-	88.89
2e6f_A		314	Dihydroorotate dehydrogenase; chagas disease, pyri	88.86
1tx2_A		297	DHPS, dihydropteroate synthase; folate biosynthesi	88.67
3o1n_A		276	3-dehydroquinate dehydratase; structural genomics,	88.44
4ay7_A		348	Methylcobalamin\: coenzyme M methyltransferase; TI	88.42
4g9p_A		406	4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth;	88.41
3iv3_A		332	Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p	88.32
4fxs_A		496	Inosine-5'-monophosphate dehydrogenase; structural	87.98
1vrd_A		494	Inosine-5'-monophosphate dehydrogenase; TM1347, st	87.94
1f76_A		336	Dihydroorotate dehydrogenase; monomer, alpha-beta-	87.9
3qja_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	87.83
3ffs_A		400	Inosine-5-monophosphate dehydrogenase; beta-alpha	87.59
1thf_D		253	HISF protein; thermophIle, TIM-barrel, histidine b	87.56
3hbl_A		1150	Pyruvate carboxylase; TIM barrel, ligase; HET: BTI	87.41
2hsa_B		402	12-oxophytodienoate reductase 3; alpha beta 8 barr	87.21
3fa4_A		302	2,3-dimethylmalate lyase; alpha/beta barrel, helix	86.92
4avf_A		490	Inosine-5'-monophosphate dehydrogenase; oxidoreduc	86.92
1b73_A		254	Glutamate racemase; isomerase; 2.30A {Aquifex pyro	86.83
2dwu_A		276	Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba	86.58
1w8s_A		263	FBP aldolase, fructose-bisphosphate aldolase class	86.56
2ze3_A		275	DFA0005; organic waste LEFT-OVER decomposition, al	86.51
1f8m_A		429	Isocitrate lyase, ICL; alpha-beta barrel, helix-sw	86.46
1ep3_A		311	Dihydroorotate dehydrogenase B (PYRD subunit); het	86.18
1mzh_A		225	Deoxyribose-phosphate aldolase; alpha-beta barrel,	86.02
3f4w_A		211	Putative hexulose 6 phosphate synthase; humps, mal	86.01
1h5y_A		253	HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py	85.64
2jfq_A		286	Glutamate racemase; cell WALL, isomerase, cell sha	85.63
3glc_A		295	Aldolase LSRF; TIM barrel, lyase, schiff base; HET	85.59
1jcn_A		514	Inosine monophosphate dehydrogenase I; IMPD, IMPDH	85.49
1eep_A		404	Inosine 5'-monophosphate dehydrogenase; alpha-beta	85.44
2eja_A		338	URO-D, UPD, uroporphyrinogen decarboxylase; dimer,	85.41
3hgj_A		349	Chromate reductase; TIM barrel, oxidoreductase; HE	85.28
1eye_A		280	DHPS 1, dihydropteroate synthase I; alpha-beta bar	85.21
2cw6_A		298	Hydroxymethylglutaryl-COA lyase, mitochondrial; HM	85.17
1qo2_A		241	Molecule: N-((5-phosphoribosyl)-formimino)-5-amino	84.99
3dxi_A		320	Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX	84.94
3tr9_A		314	Dihydropteroate synthase; biosynthesis of cofactor	84.91
3fok_A		307	Uncharacterized protein CGL0159; CGL0159 ,brevibac	84.77
1z41_A		338	YQJM, probable NADH-dependent flavin oxidoreductas	84.66
1p0k_A		349	Isopentenyl-diphosphate delta-isomerase; terpene b	84.62
2pcq_A		283	Putative dihydrodipicolinate synthase; lyase, lysi	84.41
3cyv_A		354	URO-D, UPD, uroporphyrinogen decarboxylase; alpha/	84.13
3khj_A		361	Inosine-5-monophosphate dehydrogenase; enzyme-inhi	84.08
1y0e_A		223	Putative N-acetylmannosamine-6-phosphate 2-epimer;	84.0
3ist_A		269	Glutamate racemase; structural genomics, cell WALL	83.78
3ovp_A		228	Ribulose-phosphate 3-epimerase; iron binding, isom	83.72
1rd5_A		262	Tryptophan synthase alpha chain, chloroplast; hydr	83.57
1ka9_F		252	Imidazole glycerol phosphtate synthase; riken stru	83.17
3nav_A		271	Tryptophan synthase alpha chain; alpha subunit, st	83.14
2vvt_A		290	Glutamate racemase; isomerase, peptidoglycan synth	83.13
3lg3_A		435	Isocitrate lyase; conserved, CD, proteomics eviden	82.3
3bg3_A		718	Pyruvate carboxylase, mitochondrial; TIM barrel, A	82.28
2ftp_A		302	Hydroxymethylglutaryl-COA lyase; structural genomi	82.13
1tv5_A		443	Dhodehase, dihydroorotate dehydrogenase homolog, m	81.94
1tv5_A		443	Dhodehase, dihydroorotate dehydrogenase homolog, m	81.94
2vp8_A		318	Dihydropteroate synthase 2; RV1207 transferase, fo	81.77
3tdn_A		247	FLR symmetric alpha-beta TIM barrel; symmetric sup	81.68
1geq_A		248	Tryptophan synthase alpha-subunit; hyperthermophIl	81.66
3gr7_A		340	NADPH dehydrogenase; flavin, FMN, beta-alpha-barre	81.56
3b8i_A		287	PA4872 oxaloacetate decarboxylase; alpha/beta barr	81.41
2y88_A		244	Phosphoribosyl isomerase A; aromatic amino acid bi	81.4
2yw3_A		207	4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox	81.36
2yr1_A		257	3-dehydroquinate dehydratase; amino acid biosynthe	81.14
1nvm_A		345	HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered	81.07
2w6r_A		266	Imidazole glycerol phosphate synthase subunit HISF	80.9
1j93_A		353	UROD, uroporphyrinogen decarboxylase; beta barrel,	80.82
2inf_A		359	URO-D, UPD, uroporphyrinogen decarboxylase; (alpha	80.63
2xed_A		273	Putative maleate isomerase; nicotinic acid catabol	80.58
1qpo_A		284	Quinolinate acid phosphoribosyl transferase; type	80.16
1o94_A		729	Tmadh, trimethylamine dehydrogenase; electron tran	80.12

>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A	Back alignment and structure

Probab=100.00  E-value=1e-50  Score=390.30  Aligned_cols=206  Identities=25%  Similarity=0.404  Sum_probs=185.2

Q ss_pred             CHHHHHHHHHHHHHHHHhhccCCCCCCCCCCCCCCCCCeEEEEecCCcccCcCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q 025860            1 MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQ   80 (247)
Q Consensus         1 l~~~av~lA~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~VaGsiGP~g~~l~~g~eY~g~y~~~~s~~e~~~~~~~q~~   80 (247)
                      |+++||+|||+|+++                      + +|||||||+|.++       ++|++ +++++++++|++|++
T Consensus        85 l~~~av~lAr~a~~~----------------------~-~VAGsiGP~g~~~-------~~~~~-~~~~e~~~~~~~qi~  133 (566)
T 1q7z_A           85 IVRNAVRIARRAAGE----------------------K-LVFGDIGPTGELP-------YPLGS-TLFEEFYENFRETVE  133 (566)
T ss_dssp             HHHHHHHHHHHHHTT----------------------S-EEEEEECCCSCCB-------TTTSS-BCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhC----------------------C-eEEEeCCCcccCC-------CCCCC-CCHHHHHHHHHHHHH
Confidence            589999999999742                      3 9999999999865       24554 799999999999999


Q ss_pred             HHhcCCCCEEEEecCCCHHHHHHHHHHHHhhCCCCcEEEEEEEcCCCcccCCCcHHHHHHHHHhCCCCeEEEEcCC-Chh
Q 025860           81 VLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCT-PPR  159 (247)
Q Consensus        81 ~l~~~gvD~i~~ET~~~~~E~~aa~~~~~~~~~~~pv~is~~~~~~~~l~~G~~~~~~~~~~~~~~~~~avG~NC~-~p~  159 (247)
                      .|+++|||+|++||++++.|++++++++++...++|+|+|||+.+++++++|+++++++..+.+ .++++||+||+ +|+
T Consensus       134 ~l~~~gvD~l~~ET~~~~~Ea~aa~~a~~~~~~~~Pv~vS~t~~~~g~~~~G~~~~~~~~~l~~-~~~~avG~NC~~gp~  212 (566)
T 1q7z_A          134 IMVEEGVDGIIFETFSDILELKAAVLAAREVSRDVFLIAHMTFDEKGRSLTGTDPANFAITFDE-LDIDALGINCSLGPE  212 (566)
T ss_dssp             HHHHTTCSEEEEEEECCHHHHHHHHHHHHHHCSSSCEEEEECCCTTSCCTTSCCHHHHHHHHHT-SSCSEEEEESSSCHH
T ss_pred             HHHhCCCCEEEEeccCCHHHHHHHHHHHHHhCCCCcEEEEEEEcCCCeeCCCCcHHHHHHHhhc-cCCCEEEEeCCCCHH
Confidence            9999999999999999999999999999985337999999999999999999999999999987 58999999996 899


Q ss_pred             HHHHHHHHHHhhcCCCEEEEeCCCCcc--cccccccccCCCCChHHHHHHHHHHHHcCCeEEeecCCCChHHHHHHHHHh
Q 025860          160 FISGLILIIKKVTAKPILIYPNSGEFY--DADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTL  237 (247)
Q Consensus       160 ~~~~~l~~l~~~~~~pl~vyPNaG~~~--d~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~iIGGCCGt~P~hI~al~~~l  237 (247)
                      .|.++|+.+....+.|+++|||+|.++  +.. ..|.    .+|++|++++++|++.|++||||||||||+||++|++.+
T Consensus       213 ~~~~~l~~l~~~~~~p~~vyPNaG~p~~~~~~-~~~~----~~p~~~a~~~~~~~~~G~~iiGGCCGTtP~hI~aia~~~  287 (566)
T 1q7z_A          213 EILPIFQELSQYTDKFLVVEPNAGKPIVENGK-TVYP----LKPHDFAVHIDSYYELGVNIFGGCCGTTPEHVKLFRKVL  287 (566)
T ss_dssp             HHHHHHHHHHHTCCSEEEEECCSSSCEEETTE-EECC----CCHHHHHTTHHHHHHTTCSEECCCTTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCCCEEEEEcCCCCCcccCCc-cccC----CCHHHHHHHHHHHHHcCCcEEccccCCCHHHHHHHHHHh
Confidence            999999999998999999999999876  432 3453    469999999999999999999999999999999999999


Q ss_pred             hCCCCC
Q 025860          238 SNRSSV  243 (247)
Q Consensus       238 ~~~~~~  243 (247)
                      ++.+|.
T Consensus       288 ~~~~p~  293 (566)
T 1q7z_A          288 GNRKPL  293 (566)
T ss_dssp             CSCCCC
T ss_pred             cCCCCC
Confidence            876654

PyMOL of 1q7z

>1lt8_A Betaine-homocysteine methyltransferase; homocysteine metabolism, homocysteinemia, zinc, thiol alkyl transfer; HET: CBH CIT; 2.05A {Homo sapiens} SCOP: c.1.26.1 PDB: 1lt7_A* 1umy_A	Back alignment and structure

>1lt8_A Betaine-homocysteine methyltransferase; homocysteine metabolism, homocysteinemia, zinc, thiol alkyl transfer; HET: CBH CIT; 2.05A {Homo sapiens} SCOP: c.1.26.1 PDB: 1lt7_A* 1umy_A	Back alignment and structure

>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A*	Back alignment and structure

>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus}	Back alignment and structure

>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae}	Back alignment and structure

>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum}	Back alignment and structure

>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A	Back alignment and structure

>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis}	Back alignment and structure

>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A	Back alignment and structure

>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A	Back alignment and structure

>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti}	Back alignment and structure

>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1	Back alignment and structure

>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A	Back alignment and structure

>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0	Back alignment and structure

>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A*	Back alignment and structure

>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A	Back alignment and structure

>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A*	Back alignment and structure

>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str}	Back alignment and structure

>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa}	Back alignment and structure

>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661}	Back alignment and structure

>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A*	Back alignment and structure

>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0	Back alignment and structure

>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A*	Back alignment and structure

>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A	Back alignment and structure

>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A	Back alignment and structure

>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A*	Back alignment and structure

>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A	Back alignment and structure

>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0	Back alignment and structure

>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis}	Back alignment and structure

>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0	Back alignment and structure

>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A	Back alignment and structure

>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831}	Back alignment and structure

>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str}	Back alignment and structure

>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A	Back alignment and structure

>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A	Back alignment and structure

>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A*	Back alignment and structure

>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A*	Back alignment and structure

>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei}	Back alignment and structure

>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A	Back alignment and structure

>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A*	Back alignment and structure

>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A	Back alignment and structure

>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1	Back alignment and structure

>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C*	Back alignment and structure

>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A	Back alignment and structure

>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A*	Back alignment and structure

>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str}	Back alignment and structure

>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae}	Back alignment and structure

>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A*	Back alignment and structure

>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A*	Back alignment and structure

>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae}	Back alignment and structure

>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A*	Back alignment and structure

>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis}	Back alignment and structure

>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A	Back alignment and structure

>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49}	Back alignment and structure

>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A*	Back alignment and structure

>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1	Back alignment and structure

>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus}	Back alignment and structure

>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A*	Back alignment and structure

>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1	Back alignment and structure

>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A*	Back alignment and structure

>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A*	Back alignment and structure

>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7	Back alignment and structure

>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A	Back alignment and structure

>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A*	Back alignment and structure

>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0	Back alignment and structure

>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A	Back alignment and structure

>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus}	Back alignment and structure

>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A	Back alignment and structure

>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A	Back alignment and structure

>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A	Back alignment and structure

>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A	Back alignment and structure

>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis}	Back alignment and structure

>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp}	Back alignment and structure

>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A*	Back alignment and structure

>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A*	Back alignment and structure

>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A	Back alignment and structure

>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A*	Back alignment and structure

>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0	Back alignment and structure

>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A	Back alignment and structure

>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A*	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A*	Back alignment and structure

>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A	Back alignment and structure

>3r89_A Orotidine 5'-phosphate decarboxylase; PSI-biology, midwest center for structural genomics, MCSG, O 5-phosphate decarboxylase, lyase; 1.84A {Anaerococcus prevotii}	Back alignment and structure

>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans}	Back alignment and structure

>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp}	Back alignment and structure

>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus}	Back alignment and structure

>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans}	Back alignment and structure

>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A*	Back alignment and structure

>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ...	Back alignment and structure

>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A	Back alignment and structure

>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis}	Back alignment and structure

>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A*	Back alignment and structure

>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A*	Back alignment and structure

>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ...	Back alignment and structure

>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A*	Back alignment and structure

>4ay7_A Methylcobalamin\: coenzyme M methyltransferase; TIM barrel; 1.80A {Methanosarcina mazei} PDB: 4ay8_A	Back alignment and structure

>4g9p_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; oxidoreductase, isoprenoid biosynthesis, non mevalonate PATH iron-sulphur-cluster; HET: CDI MES; 1.55A {Thermus thermophilus} PDB: 2y0f_A*	Back alignment and structure

>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A	Back alignment and structure

>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor}	Back alignment and structure

>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1	Back alignment and structure

>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1	Back alignment and structure

>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A*	Back alignment and structure

>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum}	Back alignment and structure

>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A	Back alignment and structure

>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A*	Back alignment and structure

>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A*	Back alignment and structure

>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A	Back alignment and structure

>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A*	Back alignment and structure

>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis}	Back alignment and structure

>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A	Back alignment and structure

>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus}	Back alignment and structure

>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A	Back alignment and structure

>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A*	Back alignment and structure

>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1	Back alignment and structure

>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0	Back alignment and structure

>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1	Back alignment and structure

>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus}	Back alignment and structure

>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O	Back alignment and structure

>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A*	Back alignment and structure

>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1	Back alignment and structure

>2eja_A URO-D, UPD, uroporphyrinogen decarboxylase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.90A {Aquifex aeolicus}	Back alignment and structure

>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A*	Back alignment and structure

>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1	Back alignment and structure

>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A*	Back alignment and structure

>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A	Back alignment and structure

>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii}	Back alignment and structure

>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum}	Back alignment and structure

>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A*	Back alignment and structure

>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A*	Back alignment and structure

>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus}	Back alignment and structure

>3cyv_A URO-D, UPD, uroporphyrinogen decarboxylase; alpha/beta barrel, cytoplasm, lyase, porphyrin biosynthesis; 2.80A {Shigella flexneri}	Back alignment and structure

>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum}	Back alignment and structure

>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5	Back alignment and structure

>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A*	Back alignment and structure

>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A	Back alignment and structure

>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A	Back alignment and structure

>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1	Back alignment and structure

>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4	Back alignment and structure

>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A*	Back alignment and structure

>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A	Back alignment and structure

>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A	Back alignment and structure

>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1	Back alignment and structure

>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1	Back alignment and structure

>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis}	Back alignment and structure

>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A	Back alignment and structure

>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A*	Back alignment and structure

>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A*	Back alignment and structure

>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A	Back alignment and structure

>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus}	Back alignment and structure

>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5	Back alignment and structure

>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima}	Back alignment and structure

>1j93_A UROD, uroporphyrinogen decarboxylase; beta barrel, plastidial enzyme, crystallographic dimer, lyase; 2.30A {Nicotiana tabacum} SCOP: c.1.22.1	Back alignment and structure

>2inf_A URO-D, UPD, uroporphyrinogen decarboxylase; (alpha-beta)8 barrel, eight parallel beta strands surrounded by eight alpha helices, lyase; 2.30A {Bacillus subtilis}	Back alignment and structure

>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A	Back alignment and structure

>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A*	Back alignment and structure

>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		247
d3bofa2		300	c.1.26.1 (A:1-300) Cobalamin-dependent methionine	9e-22
d1lt7a_		361	c.1.26.1 (A:) Betaine-homocysteine S-methyltransfe	5e-16

>d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 300	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Homocysteine S-methyltransferase
family: Homocysteine S-methyltransferase
domain: Cobalamin-dependent methionine synthase MetH, N-terminal domain
species: Thermotoga maritima [TaxId: 2336]

 Score = 89.7 bits (221), Expect = 9e-22
 Identities = 38/175 (21%), Positives = 69/175 (39%), Gaps = 3/175 (1%)

Query: 66  ITVETLKDFHRRRVQVLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFNSKD 125
              E   +  R  V+++VE   D I FET  + +E +A      E +  +         +
Sbjct: 119 TLFEEFYENFRETVEIMVEEGVDGIIFETFSDILELKAAVLAAREVSRDVFLIAHMTFDE 178

Query: 126 GVNVVSGDSLLECASIAESCKRVVSVGINCTPPRFISGLILIIKKVTAKPILIYPNSGEF 185
               ++G      A   +              P  I  +   + + T K +++ PN+G+ 
Sbjct: 179 KGRSLTGTDPANFAITFDELDIDALGINCSLGPEEILPIFQELSQYTDKFLVVEPNAGKP 238

Query: 186 YDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSNR 240
              + K       +   DF  ++  + E+G ++ GGCC TTP  +K   + L NR
Sbjct: 239 IVENGKTV---YPLKPHDFAVHIDSYYELGVNIFGGCCGTTPEHVKLFRKVLGNR 290

PyMOL of d3bofa2

>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 361	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		247
d3bofa2		300	Cobalamin-dependent methionine synthase MetH, N-te	100.0
d1lt7a_		361	Betaine-homocysteine S-methyltransferase {Human (H	100.0
d1lt7a_		361	Betaine-homocysteine S-methyltransferase {Human (H	96.78
d1xkya1		292	Dihydrodipicolinate synthase {Bacillus anthracis [	96.24
d1xxxa1		296	Dihydrodipicolinate synthase {Mycobacterium tuberc	95.96
d1o5ka_		295	Dihydrodipicolinate synthase {Thermotoga maritima	94.75
d1f74a_		293	N-acetylneuraminate lyase {Haemophilus influenzae	94.27
d2fdsa1		324	Protozoan orotidine monophosphate decarboxylase {P	94.07
d2a6na1		292	Dihydrodipicolinate synthase {Escherichia coli [Ta	93.65
d2c1ha1		319	5-aminolaevulinate dehydratase, ALAD (porphobilino	93.56
d1m3ua_		262	Ketopantoate hydroxymethyltransferase PanB {Escher	93.45
d1l6sa_		323	5-aminolaevulinate dehydratase, ALAD (porphobilino	93.16
d1w3ia_		293	2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus	92.93
d1vhna_		305	Putative flavin oxidoreducatase TM0096 {Thermotoga	92.78
d1geha1		307	Ribulose 1,5-bisphosphate carboxylase-oxygenase {A	92.57
d1o66a_		260	Ketopantoate hydroxymethyltransferase PanB {Neisse	92.35
d3bofa2		300	Cobalamin-dependent methionine synthase MetH, N-te	92.3
d1gqna_		252	Type I 3-dehydroquinate dehydratase {Salmonella ty	92.1
d1hl2a_		295	N-acetylneuraminate lyase {Escherichia coli [TaxId	91.69
d1gqna_		252	Type I 3-dehydroquinate dehydratase {Salmonella ty	91.54
d1j93a_		343	Uroporphyrinogen decarboxylase, UROD {Tobacco (Nic	91.37
d1pv8a_		320	5-aminolaevulinate dehydratase, ALAD (porphobilino	91.31
d1gzga_		329	5-aminolaevulinate dehydratase, ALAD (porphobilino	90.81
d2ffca1		332	Orotidine 5'-monophosphate decarboxylase (OMP deca	90.74
d2d69a1		291	Ribulose 1,5-bisphosphate carboxylase-oxygenase {A	90.07
d1ad1a_		264	Dihydropteroate synthetase {Staphylococcus aureus	89.81
d1h5ya_		252	Cyclase subunit (or domain) of imidazoleglycerolph	88.78
d1gtea2		312	Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su	88.75
d2csua3		163	Acetate-CoA ligase alpha chain, AcdA, domains 2 an	87.82
d1h7na_		340	5-aminolaevulinate dehydratase, ALAD (porphobilino	87.47
d1rqba2		303	Transcarboxylase 5S subunit, N-terminal domain {Pr	87.09
d1gtea2		312	Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su	85.83
d1tx2a_		273	Dihydropteroate synthetase {Bacillus anthracis [Ta	85.32
d2q8za1		323	Protozoan orotidine monophosphate decarboxylase {P	85.07
d1jvna1		323	Cyclase subunit (or domain) of imidazoleglycerolph	84.41
d1muma_		289	2-methylisocitrate lyase {Escherichia coli [TaxId:	81.5
d1ykwa1		283	Ribulose 1,5-bisphosphate carboxylase-oxygenase {C	81.21
d1eyea_		270	Dihydropteroate synthetase {Mycobacterium tubercul	81.06

>d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Homocysteine S-methyltransferase
family: Homocysteine S-methyltransferase
domain: Cobalamin-dependent methionine synthase MetH, N-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=6e-47  Score=335.76  Aligned_cols=209  Identities=25%  Similarity=0.388  Sum_probs=182.6

Q ss_pred             CHHHHHHHHHHHHHHHHhhccCCCCCCCCCCCCCCCCCeEEEEecCCcccCcCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q 025860            1 MLRRSVEIAREARDMYFERCSKSSCDSVTDDRIPKHRPILVAASVGSYGAYLADGSEYSGNYGDAITVETLKDFHRRRVQ   80 (247)
Q Consensus         1 l~~~av~lA~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~VaGsiGP~g~~l~~g~eY~g~y~~~~s~~e~~~~~~~q~~   80 (247)
                      ++++||++|++|+++                       ..|+||+||+|.+..       ++. ..+.+++.++|++|++
T Consensus        85 ~~~~Av~la~~a~~~-----------------------~~~~g~i~~~g~~~~-------~~~-~~~~~~~~~~~~~~~~  133 (300)
T d3bofa2          85 IVRNAVRIARRAAGE-----------------------KLVFGDIGPTGELPY-------PLG-STLFEEFYENFRETVE  133 (300)
T ss_dssp             HHHHHHHHHHHHHTT-----------------------SEEEEEECCCSCCBT-------TTS-SBCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhhh-----------------------ccccceEeccccccC-------ccc-cccHHHHHHHHHHHHH
Confidence            478999999999742                       478999999987542       222 2689999999999999


Q ss_pred             HHhcCCCCEEEEecCCCHHHHHHHHHHHHhhCCCCcEEEEEEEcCCCcccCCCcHHHHHHHHHhCCCCeEEEEcCC-Chh
Q 025860           81 VLVESAPDLIAFETIPNKIEAQAYAELLEEENIKIPAWFSFNSKDGVNVVSGDSLLECASIAESCKRVVSVGINCT-PPR  159 (247)
Q Consensus        81 ~l~~~gvD~i~~ET~~~~~E~~aa~~~~~~~~~~~pv~is~~~~~~~~l~~G~~~~~~~~~~~~~~~~~avG~NC~-~p~  159 (247)
                      +|.++|||+|+||||+++.|++++++++++.+...|++++|++++++++.+|+++.+++..+.+ .+++++|+||+ .|.
T Consensus       134 ~l~~~gvD~i~~ET~~~~~E~~~~~~~~~~~~~~~~~~~s~~~~~~g~~~~G~~~~~~~~~~~~-~~~~~~~inc~~~~~  212 (300)
T d3bofa2         134 IMVEEGVDGIIFETFSDILELKAAVLAAREVSRDVFLIAHMTFDEKGRSLTGTDPANFAITFDE-LDIDALGINCSLGPE  212 (300)
T ss_dssp             HHHHTTCSEEEEEEECCHHHHHHHHHHHHHHCSSSCEEEEECCCTTSCCTTCCCHHHHHHHHHT-SSCSEEEEESSSCHH
T ss_pred             HHHhcCcceeeeeeeecHHHHHHHHHhHHhhccccceEEEEEecCCCCcccccchhHHHhhhcc-cccchHhhccccccc
Confidence            9999999999999999999999999999998655667777778888999999999999998877 58999999997 799


Q ss_pred             HHHHHHHHHHhhcCCCEEEEeCCCCcccccccccccCCCCChHHHHHHHHHHHHcCCeEEeecCCCChHHHHHHHHHhhC
Q 025860          160 FISGLILIIKKVTAKPILIYPNSGEFYDADRKEWVQNTGVSDEDFVSYVSKWCEVGASLVGGCCRTTPNTIKGIYRTLSN  239 (247)
Q Consensus       160 ~~~~~l~~l~~~~~~pl~vyPNaG~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~iIGGCCGt~P~hI~al~~~l~~  239 (247)
                      .+..+++.+....+.|+++|||+|.++....+.|.+   .+|++|++++++|+++|++||||||||||+||++|++.|++
T Consensus       213 ~~~~~~~~~~~~~~~~~~vypN~g~~~~~~~~~~~~---~~p~~f~~~~~~w~~~Ga~iIGGCCgt~P~hI~~l~~~l~~  289 (300)
T d3bofa2         213 EILPIFQELSQYTDKFLVVEPNAGKPIVENGKTVYP---LKPHDFAVHIDSYYELGVNIFGGCCGTTPEHVKLFRKVLGN  289 (300)
T ss_dssp             HHHHHHHHHHHTCCSEEEEECCSSSCEEETTEEECC---CCHHHHHTTHHHHHHTTCSEECCCTTCCHHHHHHHHHHHCS
T ss_pred             chhhhhhhhhccccccccccCCCCCCEeCCCcccCC---CCHHHHHHHHHHHHHCCCCEEEEcCCCCHHHHHHHHHHHhC
Confidence            999999999999999999999999876554344433   57999999999999999999999999999999999999998


Q ss_pred             CCCCC
Q 025860          240 RSSVL  244 (247)
Q Consensus       240 ~~~~~  244 (247)
                      .+|..
T Consensus       290 ~~p~~  294 (300)
T d3bofa2         290 RKPLQ  294 (300)
T ss_dssp             CCCCC
T ss_pred             CCCCC
Confidence            88864

PyMOL of d3bofa2

>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2fdsa1 c.1.2.3 (A:1-324) Protozoan orotidine monophosphate decarboxylase {Plasmodium berghei [TaxId: 5821]}	Back information, alignment and structure

>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]}	Back information, alignment and structure

>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]}	Back information, alignment and structure

>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]}	Back information, alignment and structure

>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]}	Back information, alignment and structure

>d1j93a_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Tobacco (Nicotiana tabacum), UROD-III [TaxId: 4097]}	Back information, alignment and structure

>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2ffca1 c.1.2.3 (A:20-351) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Plasmodium vivax [TaxId: 5855]}	Back information, alignment and structure

>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}	Back information, alignment and structure

>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d2q8za1 c.1.2.3 (A:1-323) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}	Back information, alignment and structure

>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}	Back information, alignment and structure

>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure