Citrus Sinensis ID: 025866
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 247 | 2.2.26 [Sep-21-2011] | |||||||
| P37545 | 255 | Uncharacterized deoxyribo | yes | no | 0.680 | 0.658 | 0.301 | 1e-14 | |
| Q148G4 | 297 | Putative deoxyribonucleas | yes | no | 0.720 | 0.599 | 0.269 | 7e-13 | |
| Q6P1N9 | 297 | Putative deoxyribonucleas | no | no | 0.720 | 0.599 | 0.265 | 3e-12 | |
| Q93075 | 761 | Putative deoxyribonucleas | no | no | 0.502 | 0.162 | 0.380 | 1e-11 | |
| Q6P8M1 | 295 | Putative deoxyribonucleas | yes | no | 0.720 | 0.603 | 0.265 | 1e-11 | |
| D8MKW4 | 261 | Tat-linked quality contro | yes | no | 0.518 | 0.490 | 0.318 | 6e-11 | |
| Q05AV0 | 270 | Putative deoxyribonucleas | N/A | no | 0.643 | 0.588 | 0.264 | 1e-10 | |
| P73335 | 261 | Uncharacterized deoxyribo | N/A | no | 0.429 | 0.406 | 0.346 | 3e-10 | |
| Q8K9J1 | 264 | Uncharacterized deoxyribo | yes | no | 0.680 | 0.636 | 0.278 | 4e-10 | |
| Q640V9 | 297 | Putative deoxyribonucleas | N/A | no | 0.720 | 0.599 | 0.265 | 4e-10 |
| >sp|P37545|YABD_BACSU Uncharacterized deoxyribonuclease YabD OS=Bacillus subtilis (strain 168) GN=yabD PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust.
Identities = 67/222 (30%), Positives = 94/222 (42%), Gaps = 54/222 (24%)
Query: 22 LKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGD 81
+KE A+GE+GLD D Q VFR Q+ LAKE+ P IH A D
Sbjct: 78 IKELSAHEKVVAIGEMGLDYHWDKSPKDI--QKEVFRNQIALAKEVNLPIIIHNRDATED 135
Query: 82 LLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQK-------VPS 134
++ I+K G G I+H + GSAE+ E K+ Y SF G + A+K +P+
Sbjct: 136 VVTILKEEGAEAVGGIMHCFTGSAEVARECMKMNFYLSFGGPVTFKNAKKPKEVVKEIPN 195
Query: 135 ERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSST 194
+R+L+ETD P FL P K
Sbjct: 196 DRLLIETDCP-----------FLT------PHPFRGKR---------------------- 216
Query: 195 LPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLF 236
N P+ + V + +A L +MT EE+A ++ NA RLF
Sbjct: 217 ------NEPSYVKYVAEQIAELKEMTFEEIASITTENAKRLF 252
|
Putative deoxyribonuclease. Bacillus subtilis (strain 168) (taxid: 224308) EC: 3EC: .EC: 1EC: .EC: 2EC: 1EC: .EC: - |
| >sp|Q148G4|TATD1_BOVIN Putative deoxyribonuclease TATDN1 OS=Bos taurus GN=TATDN1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6P1N9|TATD1_HUMAN Putative deoxyribonuclease TATDN1 OS=Homo sapiens GN=TATDN1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q93075|TATD2_HUMAN Putative deoxyribonuclease TATDN2 OS=Homo sapiens GN=TATDN2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q6P8M1|TATD1_MOUSE Putative deoxyribonuclease TATDN1 OS=Mus musculus GN=Tatdn1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|D8MKW4|TATD_ERWBE Tat-linked quality control protein TatD OS=Erwinia billingiae (strain Eb661) GN=tatD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q05AV0|TAT3A_XENLA Putative deoxyribonuclease tatdn3-A OS=Xenopus laevis GN=tatdn3-a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P73335|Y1786_SYNY3 Uncharacterized deoxyribonuclease sll1786 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1786 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8K9J1|Y343_BUCAP Uncharacterized deoxyribonuclease BUsg_343 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_343 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q640V9|TATD1_XENLA Putative deoxyribonuclease TATDN1 OS=Xenopus laevis GN=tatdn1 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 247 | ||||||
| 297807779 | 325 | hypothetical protein ARALYDRAFT_326186 [ | 0.967 | 0.735 | 0.714 | 1e-97 | |
| 18418353 | 325 | TatD related DNase [Arabidopsis thaliana | 0.967 | 0.735 | 0.706 | 4e-95 | |
| 224126133 | 308 | predicted protein [Populus trichocarpa] | 0.955 | 0.766 | 0.706 | 3e-93 | |
| 356559526 | 311 | PREDICTED: uncharacterized deoxyribonucl | 0.971 | 0.771 | 0.686 | 6e-91 | |
| 296090223 | 293 | unnamed protein product [Vitis vinifera] | 0.971 | 0.819 | 0.678 | 7e-91 | |
| 359489060 | 314 | PREDICTED: uncharacterized deoxyribonucl | 0.971 | 0.764 | 0.678 | 8e-91 | |
| 9755782 | 318 | putative protein [Arabidopsis thaliana] | 0.939 | 0.729 | 0.686 | 3e-90 | |
| 449432305 | 314 | PREDICTED: uncharacterized deoxyribonucl | 0.931 | 0.732 | 0.701 | 3e-89 | |
| 356561321 | 295 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.971 | 0.813 | 0.647 | 3e-86 | |
| 255566046 | 274 | deoxyribonuclease, putative [Ricinus com | 0.842 | 0.759 | 0.706 | 1e-81 |
| >gi|297807779|ref|XP_002871773.1| hypothetical protein ARALYDRAFT_326186 [Arabidopsis lyrata subsp. lyrata] gi|297317610|gb|EFH48032.1| hypothetical protein ARALYDRAFT_326186 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 361 bits (927), Expect = 1e-97, Method: Compositional matrix adjust.
Identities = 180/252 (71%), Positives = 207/252 (82%), Gaps = 13/252 (5%)
Query: 5 CFIFR--FVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLE 62
CF +V ER+P WF TLK FFE TP AAVGEIGLDKGSKGREIDF DQV VFRQQLE
Sbjct: 60 CFGIHPWYVAERSPQWFETLKSFFETTPTAAVGEIGLDKGSKGREIDFSDQVTVFRQQLE 119
Query: 63 LAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSG 122
LAKEL RPAS+HCVRAFGDLLEI+KSVGPFP GV++HSYLGSAE+VPE +KLGAYFSFSG
Sbjct: 120 LAKELNRPASVHCVRAFGDLLEILKSVGPFPSGVMLHSYLGSAEIVPEFAKLGAYFSFSG 179
Query: 123 FLMSMKAQK-------VPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHS 175
FLMSM +K VPS+RILLETD+PDALPKAE SL+ VDGDPSLP+E ++ ++
Sbjct: 180 FLMSMSEKKAKKMLKAVPSDRILLETDSPDALPKAESGSLYFVDGDPSLPEEGNSAQD-- 237
Query: 176 PNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRL 235
+ SAS+++ + S DS+ LPKETLNHPANIH VL YVA LLDM EELAELSY+NA+RL
Sbjct: 238 --LDSASNDKSNVSSDSTKLPKETLNHPANIHMVLGYVARLLDMKNEELAELSYQNAVRL 295
Query: 236 FSYEGSKILTEK 247
FSYEGSK+L E+
Sbjct: 296 FSYEGSKMLLER 307
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|18418353|ref|NP_568352.1| TatD related DNase [Arabidopsis thaliana] gi|124301002|gb|ABN04753.1| At5g17570 [Arabidopsis thaliana] gi|332005061|gb|AED92444.1| TatD related DNase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224126133|ref|XP_002319763.1| predicted protein [Populus trichocarpa] gi|222858139|gb|EEE95686.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356559526|ref|XP_003548050.1| PREDICTED: uncharacterized deoxyribonuclease sll1786-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296090223|emb|CBI40042.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359489060|ref|XP_002275929.2| PREDICTED: uncharacterized deoxyribonuclease YabD-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|9755782|emb|CAC01901.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449432305|ref|XP_004133940.1| PREDICTED: uncharacterized deoxyribonuclease YabD-like [Cucumis sativus] gi|449525820|ref|XP_004169914.1| PREDICTED: uncharacterized deoxyribonuclease YabD-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356561321|ref|XP_003548931.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized deoxyribonuclease sll1786-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255566046|ref|XP_002524011.1| deoxyribonuclease, putative [Ricinus communis] gi|223536738|gb|EEF38379.1| deoxyribonuclease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 247 | ||||||
| TAIR|locus:2151406 | 325 | AT5G17570 "AT5G17570" [Arabido | 0.947 | 0.72 | 0.726 | 6.7e-88 | |
| TAIR|locus:2099684 | 272 | AT3G03500 "AT3G03500" [Arabido | 0.680 | 0.617 | 0.544 | 4.8e-46 | |
| TIGR_CMR|GSU_3287 | 255 | GSU_3287 "hydrolase, TatD fami | 0.477 | 0.462 | 0.407 | 2.5e-21 | |
| UNIPROTKB|K7GLH4 | 168 | LOC100156175 "Uncharacterized | 0.356 | 0.523 | 0.333 | 1.9e-15 | |
| TIGR_CMR|CPS_2305 | 255 | CPS_2305 "hydrolase, TatD fami | 0.461 | 0.447 | 0.349 | 6.9e-14 | |
| TIGR_CMR|CBU_0502 | 255 | CBU_0502 "hydrolase, putative" | 0.506 | 0.490 | 0.359 | 1.6e-13 | |
| UNIPROTKB|Q148G4 | 297 | TATDN1 "Putative deoxyribonucl | 0.449 | 0.373 | 0.324 | 2.2e-13 | |
| UNIPROTKB|H7BZJ2 | 182 | TATDN2 "Putative deoxyribonucl | 0.497 | 0.675 | 0.407 | 2.7e-13 | |
| UNIPROTKB|I3LKU9 | 297 | TATDN1 "Uncharacterized protei | 0.449 | 0.373 | 0.324 | 3.4e-13 | |
| UNIPROTKB|E2RRK7 | 265 | TATDN1 "Uncharacterized protei | 0.449 | 0.418 | 0.333 | 3.9e-13 |
| TAIR|locus:2151406 AT5G17570 "AT5G17570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 878 (314.1 bits), Expect = 6.7e-88, P = 6.7e-88
Identities = 178/245 (72%), Positives = 204/245 (83%)
Query: 10 FVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKR 69
+V ER+P WF TLK FFE TP AAVGEIGLDKGSKGREIDF +QV VFRQQLELAKELK+
Sbjct: 67 YVAERSPQWFETLKSFFETTPTAAVGEIGLDKGSKGREIDFSEQVTVFRQQLELAKELKK 126
Query: 70 PASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSM-- 127
PAS+HCVRAFGDLLEI+KSVGPFP GV++HSYLGSAEMVPE +KLGAYFSFSGFLMSM
Sbjct: 127 PASVHCVRAFGDLLEILKSVGPFPSGVMLHSYLGSAEMVPEFAKLGAYFSFSGFLMSMSE 186
Query: 128 -KAQK----VPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSAS 182
KA+K VPS+RILLETD+PDALPKAE L+ VDGDPSLP+E ++ ++ + SAS
Sbjct: 187 KKAKKMLKAVPSDRILLETDSPDALPKAESGCLYFVDGDPSLPEEGNSAQD----LDSAS 242
Query: 183 DNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFSYEGSK 242
++ + S DS L KETLNHPANIH VL YVA LLDM EELAELSY+NA+RLFSYEGSK
Sbjct: 243 YDKPNVSSDSMKLTKETLNHPANIHIVLGYVAQLLDMKNEELAELSYQNAVRLFSYEGSK 302
Query: 243 ILTEK 247
IL ++
Sbjct: 303 ILLDR 307
|
|
| TAIR|locus:2099684 AT3G03500 "AT3G03500" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3287 GSU_3287 "hydrolase, TatD family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GLH4 LOC100156175 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2305 CPS_2305 "hydrolase, TatD family" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0502 CBU_0502 "hydrolase, putative" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q148G4 TATDN1 "Putative deoxyribonuclease TATDN1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7BZJ2 TATDN2 "Putative deoxyribonuclease TATDN2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LKU9 TATDN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RRK7 TATDN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.21 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 247 | |||
| pfam01026 | 255 | pfam01026, TatD_DNase, TatD related DNase | 2e-47 | |
| cd01310 | 251 | cd01310, TatD_DNAse, TatD like proteins; E | 3e-46 | |
| COG0084 | 256 | COG0084, TatD, Mg-dependent DNase [DNA replication | 2e-40 | |
| TIGR00010 | 252 | TIGR00010, TIGR00010, hydrolase, TatD family | 6e-32 | |
| PRK10812 | 265 | PRK10812, PRK10812, putative DNAse; Provisional | 6e-12 | |
| PRK10425 | 258 | PRK10425, PRK10425, DNase TatD; Provisional | 3e-09 | |
| COG1099 | 254 | COG1099, COG1099, Predicted metal-dependent hydrol | 3e-08 | |
| PRK11449 | 258 | PRK11449, PRK11449, putative deoxyribonuclease Yjj | 5e-07 |
| >gnl|CDD|216250 pfam01026, TatD_DNase, TatD related DNase | Back alignment and domain information |
|---|
Score = 157 bits (399), Expect = 2e-47
Identities = 73/237 (30%), Positives = 99/237 (41%), Gaps = 55/237 (23%)
Query: 10 FVQERTPNWFSTLKEF--FEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKEL 67
E + L++ E A+GEIGLD E Q VFR+QLELAKEL
Sbjct: 65 EADEASEEVLEALEKLLLAEHPKVVAIGEIGLDYYYV-DESPKEAQEEVFRRQLELAKEL 123
Query: 68 KRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSM 127
P IH A DLLEI+K G V++H + GS E E+ LG Y S SG +
Sbjct: 124 DLPVVIHTRDAEEDLLEILKEAGAPGLRVVLHCFTGSLETAKEILDLGFYISISGIVTFK 183
Query: 128 KAQK-------VPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGS 180
A+K +P +R+L+ETDAP P P G
Sbjct: 184 NAKKLREVVAEIPLDRLLVETDAPYLAPV--------------------------PYRGK 217
Query: 181 ASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRLFS 237
N PA + V + +A L +++EE+A+++ NA RLF
Sbjct: 218 R-------------------NEPAYVPYVAEKLAELKGISEEEVAKITTENAKRLFG 255
|
This family of proteins are related to a large superfamily of metalloenzymes. TatD, a member of this family has been shown experimentally to be a DNase enzyme. Length = 255 |
| >gnl|CDD|238635 cd01310, TatD_DNAse, TatD like proteins; E | Back alignment and domain information |
|---|
| >gnl|CDD|223162 COG0084, TatD, Mg-dependent DNase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|232780 TIGR00010, TIGR00010, hydrolase, TatD family | Back alignment and domain information |
|---|
| >gnl|CDD|236767 PRK10812, PRK10812, putative DNAse; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182449 PRK10425, PRK10425, DNase TatD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224024 COG1099, COG1099, Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|171118 PRK11449, PRK11449, putative deoxyribonuclease YjjV; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 247 | |||
| COG0084 | 256 | TatD Mg-dependent DNase [DNA replication, recombin | 100.0 | |
| PRK10425 | 258 | DNase TatD; Provisional | 100.0 | |
| PRK11449 | 258 | putative deoxyribonuclease YjjV; Provisional | 100.0 | |
| PF01026 | 255 | TatD_DNase: TatD related DNase The Pfam entry find | 100.0 | |
| PRK10812 | 265 | putative DNAse; Provisional | 100.0 | |
| KOG3020 | 296 | consensus TatD-related DNase [Replication, recombi | 100.0 | |
| TIGR00010 | 252 | hydrolase, TatD family. Several genomes have multi | 100.0 | |
| cd01310 | 251 | TatD_DNAse TatD like proteins; E.coli TatD is a cy | 100.0 | |
| cd00530 | 293 | PTE Phosphotriesterase (PTE) catalyzes the hydroly | 99.97 | |
| COG1099 | 254 | Predicted metal-dependent hydrolases with the TIM- | 99.94 | |
| COG1831 | 285 | Predicted metal-dependent hydrolase (urease superf | 99.8 | |
| TIGR03583 | 365 | EF_0837 probable amidohydrolase EF_0837/AHA_3915. | 99.75 | |
| PRK09875 | 292 | putative hydrolase; Provisional | 99.34 | |
| cd01295 | 422 | AdeC Adenine deaminase (AdeC) directly deaminates | 99.32 | |
| cd01307 | 338 | Met_dep_hydrolase_B Metallo-dependent hydrolases, | 99.32 | |
| PRK09237 | 380 | dihydroorotase; Provisional | 99.02 | |
| cd01292 | 275 | metallo-dependent_hydrolases Superfamily of metall | 98.68 | |
| PF02126 | 308 | PTE: Phosphotriesterase family; InterPro: IPR00155 | 98.45 | |
| PF04909 | 273 | Amidohydro_2: Amidohydrolase; InterPro: IPR006992 | 98.37 | |
| COG1735 | 316 | Php Predicted metal-dependent hydrolase with the T | 98.19 | |
| COG2159 | 293 | Predicted metal-dependent hydrolase of the TIM-bar | 97.96 | |
| TIGR01430 | 324 | aden_deam adenosine deaminase. This family include | 97.48 | |
| TIGR01975 | 389 | isoAsp_dipep isoaspartyl dipeptidase IadA. The L-i | 97.31 | |
| cd01312 | 381 | Met_dep_hydrolase_D Metallo-dependent hydrolases, | 97.25 | |
| PRK09228 | 433 | guanine deaminase; Provisional | 97.2 | |
| TIGR02967 | 401 | guan_deamin guanine deaminase. This model describe | 97.19 | |
| PRK10657 | 388 | isoaspartyl dipeptidase; Provisional | 97.18 | |
| PRK07213 | 375 | chlorohydrolase; Provisional | 97.06 | |
| TIGR01178 | 552 | ade adenine deaminase. The family described by thi | 96.99 | |
| PRK12394 | 379 | putative metallo-dependent hydrolase; Provisional | 96.92 | |
| PRK09358 | 340 | adenosine deaminase; Provisional | 96.88 | |
| cd01293 | 398 | Bact_CD Bacterial cytosine deaminase and related m | 96.86 | |
| cd01320 | 325 | ADA Adenosine deaminase (ADA) is a monomeric zinc | 96.8 | |
| PRK06687 | 419 | chlorohydrolase; Validated | 96.67 | |
| PRK08204 | 449 | hypothetical protein; Provisional | 96.59 | |
| PRK08203 | 451 | hydroxydechloroatrazine ethylaminohydrolase; Revie | 96.58 | |
| PRK09045 | 443 | N-ethylammeline chlorohydrolase; Provisional | 96.57 | |
| cd01311 | 263 | PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) | 96.53 | |
| PRK06038 | 430 | N-ethylammeline chlorohydrolase; Provisional | 96.46 | |
| cd01298 | 411 | ATZ_TRZ_like TRZ/ATZ family contains enzymes from | 96.43 | |
| cd01309 | 359 | Met_dep_hydrolase_C Metallo-dependent hydrolases, | 96.42 | |
| cd01297 | 415 | D-aminoacylase D-aminoacylases (N-acyl-D-Amino aci | 96.35 | |
| cd01296 | 371 | Imidazolone-5PH Imidazolonepropionase/imidazolone- | 96.24 | |
| PRK07228 | 445 | N-ethylammeline chlorohydrolase; Provisional | 96.23 | |
| PRK06151 | 488 | N-ethylammeline chlorohydrolase; Provisional | 96.22 | |
| cd01303 | 429 | GDEase Guanine deaminase (GDEase). Guanine deamina | 96.2 | |
| PRK08393 | 424 | N-ethylammeline chlorohydrolase; Provisional | 96.2 | |
| PRK06380 | 418 | metal-dependent hydrolase; Provisional | 96.18 | |
| PRK07583 | 438 | cytosine deaminase-like protein; Validated | 96.15 | |
| PRK07572 | 426 | cytosine deaminase; Validated | 96.13 | |
| PRK15493 | 435 | 5-methylthioadenosine/S-adenosylhomocysteine deami | 96.12 | |
| cd01305 | 263 | archeal_chlorohydrolases Predicted chlorohydrolase | 96.08 | |
| cd01299 | 342 | Met_dep_hydrolase_A Metallo-dependent hydrolases, | 95.88 | |
| PRK12393 | 457 | amidohydrolase; Provisional | 95.87 | |
| COG3964 | 386 | Predicted amidohydrolase [General function predict | 95.84 | |
| cd01313 | 418 | Met_dep_hydrolase_E Metallo-dependent hydrolases, | 95.8 | |
| cd01300 | 479 | YtcJ_like YtcJ_like metal dependent amidohydrolase | 95.74 | |
| PLN02942 | 486 | dihydropyrimidinase | 95.56 | |
| PRK08418 | 408 | chlorohydrolase; Provisional | 95.54 | |
| TIGR01224 | 377 | hutI imidazolonepropionase. This enzyme catalyzes | 95.48 | |
| PRK09356 | 406 | imidazolonepropionase; Validated | 95.39 | |
| cd01308 | 387 | Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hy | 95.23 | |
| PF07969 | 404 | Amidohydro_3: Amidohydrolase family; InterPro: IPR | 95.2 | |
| PRK07203 | 442 | putative chlorohydrolase/aminohydrolase; Validated | 95.12 | |
| COG2355 | 313 | Zn-dependent dipeptidase, microsomal dipeptidase h | 95.06 | |
| PRK06886 | 329 | hypothetical protein; Validated | 94.67 | |
| PTZ00124 | 362 | adenosine deaminase; Provisional | 94.57 | |
| PRK09229 | 456 | N-formimino-L-glutamate deiminase; Validated | 94.47 | |
| PRK06846 | 410 | putative deaminase; Validated | 94.36 | |
| cd01304 | 541 | FMDH_A Formylmethanofuran dehydrogenase (FMDH) sub | 94.36 | |
| TIGR03314 | 441 | Se_ssnA putative selenium metabolism protein SsnA. | 93.82 | |
| cd01294 | 335 | DHOase Dihydroorotase (DHOase) catalyzes the rever | 93.8 | |
| PRK10027 | 588 | cryptic adenine deaminase; Provisional | 93.78 | |
| PRK14085 | 382 | imidazolonepropionase; Provisional | 93.61 | |
| COG3618 | 279 | Predicted metal-dependent hydrolase of the TIM-bar | 93.0 | |
| TIGR02022 | 455 | hutF formiminoglutamate deiminase. In some species | 92.95 | |
| PRK09061 | 509 | D-glutamate deacylase; Validated | 92.86 | |
| PF01244 | 320 | Peptidase_M19: Membrane dipeptidase (Peptidase fam | 92.44 | |
| PRK09230 | 426 | cytosine deaminase; Provisional | 92.35 | |
| cd01306 | 325 | PhnM PhnM is believed to be a subunit of the membr | 92.32 | |
| cd00443 | 305 | ADA_AMPD Adenosine/AMP deaminase. Adenosine deamin | 92.17 | |
| cd01315 | 447 | L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinas | 91.53 | |
| PRK05985 | 391 | cytosine deaminase; Provisional | 90.55 | |
| PRK15446 | 383 | phosphonate metabolism protein PhnM; Provisional | 89.59 | |
| COG0402 | 421 | SsnA Cytosine deaminase and related metal-dependen | 89.27 | |
| PLN02795 | 505 | allantoinase | 89.18 | |
| TIGR02033 | 454 | D-hydantoinase D-hydantoinase. This model represen | 89.04 | |
| cd01317 | 374 | DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; | 88.85 | |
| TIGR03121 | 556 | one_C_dehyd_A formylmethanofuran dehydrogenase sub | 87.5 | |
| TIGR02318 | 376 | phosphono_phnM phosphonate metabolism protein PhnM | 87.19 | |
| COG1001 | 584 | AdeC Adenine deaminase [Nucleotide transport and m | 86.76 | |
| cd01301 | 309 | rDP_like renal dipeptidase (rDP), best studied in | 86.66 | |
| COG1228 | 406 | HutI Imidazolonepropionase and related amidohydrol | 86.53 | |
| cd01321 | 345 | ADGF Adenosine deaminase-related growth factors (A | 85.69 | |
| PRK08417 | 386 | dihydroorotase; Provisional | 85.1 | |
| COG1574 | 535 | Predicted metal-dependent hydrolase with the TIM-b | 84.51 | |
| TIGR03178 | 443 | allantoinase allantoinase. This enzyme carries out | 84.33 | |
| PRK13125 | 244 | trpA tryptophan synthase subunit alpha; Provisiona | 84.17 | |
| PRK08323 | 459 | phenylhydantoinase; Validated | 83.1 | |
| PRK08044 | 449 | allantoinase; Provisional | 81.81 | |
| PF00962 | 331 | A_deaminase: Adenosine/AMP deaminase immunodeficie | 80.5 |
| >COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.6e-55 Score=388.81 Aligned_cols=190 Identities=39% Similarity=0.490 Sum_probs=174.3
Q ss_pred ceeeecccccCCCChhHHHHHHHHhhc-CCceEEEeecCCCCCCCCCCCHHHHHHHHHHHHHHHHHcCCceEEeecccHH
Q 025866 2 DWVCFIFRFVQERTPNWFSTLKEFFEI-TPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFG 80 (247)
Q Consensus 2 ~~~g~hP~~~~~~~~~~l~~l~~~l~~-~~~~aIGEIGLD~~~~~~~~~~~~Q~~vf~~qL~lA~~~~lpv~lH~~~a~~ 80 (247)
..+|+||++..+..+++++.|.+++.+ ++++|||||||||++... .+++.|+++|++||++|+++++||+||+|+|++
T Consensus 59 ~~~G~HP~~~~~~~~~~~~~l~~~~~~~~~vvaIGEiGLDy~~~~~-~~~~~Q~~~F~~ql~lA~~~~lPviIH~R~A~~ 137 (256)
T COG0084 59 AAVGVHPLDADEHSEEDLEELEQLAEHHPKVVAIGEIGLDYYWDKE-PDKERQEEVFEAQLELAKELNLPVIIHTRDAHE 137 (256)
T ss_pred EEEeeCCCccccccHHHHHHHHHHHhcCCCeEEEEecccCcccccc-ccHHHHHHHHHHHHHHHHHcCCCEEEEccccHH
Confidence 368999999434458899999999986 899999999999998642 268899999999999999999999999999999
Q ss_pred HHHHHHHhcCCCCCcEEEEeCCCCHHHHHHHHHCCCeeeeccccccccccC-------CCCCceEEecCCCCCCCchhhc
Q 025866 81 DLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQK-------VPSERILLETDAPDALPKAELN 153 (247)
Q Consensus 81 ~~l~iLk~~~~~~~~~I~H~fsGs~~~~~~~l~~G~~~Si~~~i~~~~~~~-------iPldriLlETD~P~~~p~~~~~ 153 (247)
+++++|++++. +.++|+||||||.+++++++++|+||||||.+|++++.+ +|+||||+|||+||+.|.|+|
T Consensus 138 d~~~iL~~~~~-~~~gi~HcFsGs~e~a~~~~d~G~yisisG~itfk~a~~~~ev~~~iPldrLL~ETDsPyl~P~p~r- 215 (256)
T COG0084 138 DTLEILKEEGA-PVGGVLHCFSGSAEEARKLLDLGFYISISGIVTFKNAEKLREVARELPLDRLLLETDAPYLAPVPYR- 215 (256)
T ss_pred HHHHHHHhcCC-CCCEEEEccCCCHHHHHHHHHcCeEEEECceeecCCcHHHHHHHHhCCHhHeEeccCCCCCCCcCCC-
Confidence 99999999875 467899999999999999999999999999999988553 999999999999999998765
Q ss_pred cccccCCCCCCcccccccccCCCCCCCCCCcccccCCCCCCCCCcccCcchhHHHHHHHHHHccCCCHHHHHHHHHHHHH
Q 025866 154 SLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAI 233 (247)
Q Consensus 154 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~n~P~~l~~v~~~iA~~~~~s~e~l~~~~~~N~~ 233 (247)
| ++|+|+++..|++.||+++|+++++|++++++|++
T Consensus 216 -----------------------------------G---------krNeP~~v~~v~~~iAelk~~~~eeva~~t~~N~~ 251 (256)
T COG0084 216 -----------------------------------G---------KRNEPAYVRHVAEKLAELKGISAEEVAEITTENAK 251 (256)
T ss_pred -----------------------------------C---------CCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHHH
Confidence 4 89999999999999999999999999999999999
Q ss_pred HhhCC
Q 025866 234 RLFSY 238 (247)
Q Consensus 234 ~~f~~ 238 (247)
++|++
T Consensus 252 ~lf~~ 256 (256)
T COG0084 252 RLFGL 256 (256)
T ss_pred HHhcC
Confidence 99985
|
|
| >PRK10425 DNase TatD; Provisional | Back alignment and domain information |
|---|
| >PRK11449 putative deoxyribonuclease YjjV; Provisional | Back alignment and domain information |
|---|
| >PF01026 TatD_DNase: TatD related DNase The Pfam entry finds members not in the Prosite definition | Back alignment and domain information |
|---|
| >PRK10812 putative DNAse; Provisional | Back alignment and domain information |
|---|
| >KOG3020 consensus TatD-related DNase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00010 hydrolase, TatD family | Back alignment and domain information |
|---|
| >cd01310 TatD_DNAse TatD like proteins; E | Back alignment and domain information |
|---|
| >cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon | Back alignment and domain information |
|---|
| >COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >COG1831 Predicted metal-dependent hydrolase (urease superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 | Back alignment and domain information |
|---|
| >PRK09875 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine | Back alignment and domain information |
|---|
| >cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site | Back alignment and domain information |
|---|
| >PRK09237 dihydroorotase; Provisional | Back alignment and domain information |
|---|
| >cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site | Back alignment and domain information |
|---|
| >PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3 | Back alignment and domain information |
|---|
| >PF04909 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 These proteins are related to the metal-dependent hydrolase superfamily [] | Back alignment and domain information |
|---|
| >COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01430 aden_deam adenosine deaminase | Back alignment and domain information |
|---|
| >TIGR01975 isoAsp_dipep isoaspartyl dipeptidase IadA | Back alignment and domain information |
|---|
| >cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site | Back alignment and domain information |
|---|
| >PRK09228 guanine deaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR02967 guan_deamin guanine deaminase | Back alignment and domain information |
|---|
| >PRK10657 isoaspartyl dipeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK07213 chlorohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01178 ade adenine deaminase | Back alignment and domain information |
|---|
| >PRK12394 putative metallo-dependent hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09358 adenosine deaminase; Provisional | Back alignment and domain information |
|---|
| >cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases | Back alignment and domain information |
|---|
| >cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively | Back alignment and domain information |
|---|
| >PRK06687 chlorohydrolase; Validated | Back alignment and domain information |
|---|
| >PRK08204 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PRK09045 N-ethylammeline chlorohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01311 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM) | Back alignment and domain information |
|---|
| >PRK06038 N-ethylammeline chlorohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases | Back alignment and domain information |
|---|
| >cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site | Back alignment and domain information |
|---|
| >cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics | Back alignment and domain information |
|---|
| >cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate | Back alignment and domain information |
|---|
| >PRK07228 N-ethylammeline chlorohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06151 N-ethylammeline chlorohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01303 GDEase Guanine deaminase (GDEase) | Back alignment and domain information |
|---|
| >PRK08393 N-ethylammeline chlorohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06380 metal-dependent hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07583 cytosine deaminase-like protein; Validated | Back alignment and domain information |
|---|
| >PRK07572 cytosine deaminase; Validated | Back alignment and domain information |
|---|
| >PRK15493 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Provisional | Back alignment and domain information |
|---|
| >cd01305 archeal_chlorohydrolases Predicted chlorohydrolases | Back alignment and domain information |
|---|
| >cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site | Back alignment and domain information |
|---|
| >PRK12393 amidohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG3964 Predicted amidohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site | Back alignment and domain information |
|---|
| >cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases | Back alignment and domain information |
|---|
| >PLN02942 dihydropyrimidinase | Back alignment and domain information |
|---|
| >PRK08418 chlorohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01224 hutI imidazolonepropionase | Back alignment and domain information |
|---|
| >PRK09356 imidazolonepropionase; Validated | Back alignment and domain information |
|---|
| >cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid | Back alignment and domain information |
|---|
| >PF07969 Amidohydro_3: Amidohydrolase family; InterPro: IPR013108 Amidohydrolases are a diverse superfamily of enzymes which catalyse the hydrolysis of amide or amine bonds in a large number of different substrates including urea, cytosine, AMP, formylmethanofuran, etc [, ] | Back alignment and domain information |
|---|
| >PRK07203 putative chlorohydrolase/aminohydrolase; Validated | Back alignment and domain information |
|---|
| >COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06886 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PTZ00124 adenosine deaminase; Provisional | Back alignment and domain information |
|---|
| >PRK09229 N-formimino-L-glutamate deiminase; Validated | Back alignment and domain information |
|---|
| >PRK06846 putative deaminase; Validated | Back alignment and domain information |
|---|
| >cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A; Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor | Back alignment and domain information |
|---|
| >TIGR03314 Se_ssnA putative selenium metabolism protein SsnA | Back alignment and domain information |
|---|
| >cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis | Back alignment and domain information |
|---|
| >PRK10027 cryptic adenine deaminase; Provisional | Back alignment and domain information |
|---|
| >PRK14085 imidazolonepropionase; Provisional | Back alignment and domain information |
|---|
| >COG3618 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02022 hutF formiminoglutamate deiminase | Back alignment and domain information |
|---|
| >PRK09061 D-glutamate deacylase; Validated | Back alignment and domain information |
|---|
| >PF01244 Peptidase_M19: Membrane dipeptidase (Peptidase family M19); InterPro: IPR008257 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK09230 cytosine deaminase; Provisional | Back alignment and domain information |
|---|
| >cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex | Back alignment and domain information |
|---|
| >cd00443 ADA_AMPD Adenosine/AMP deaminase | Back alignment and domain information |
|---|
| >cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) | Back alignment and domain information |
|---|
| >PRK05985 cytosine deaminase; Provisional | Back alignment and domain information |
|---|
| >PRK15446 phosphonate metabolism protein PhnM; Provisional | Back alignment and domain information |
|---|
| >COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02795 allantoinase | Back alignment and domain information |
|---|
| >TIGR02033 D-hydantoinase D-hydantoinase | Back alignment and domain information |
|---|
| >cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis | Back alignment and domain information |
|---|
| >TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A | Back alignment and domain information |
|---|
| >TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM | Back alignment and domain information |
|---|
| >COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01301 rDP_like renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipeptidase, is a membrane-bound glycoprotein hydrolyzing dipeptides and is involved in hydrolytic metabolism of penem and carbapenem beta-lactam antibiotics | Back alignment and domain information |
|---|
| >COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase | Back alignment and domain information |
|---|
| >PRK08417 dihydroorotase; Provisional | Back alignment and domain information |
|---|
| >COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03178 allantoinase allantoinase | Back alignment and domain information |
|---|
| >PRK13125 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK08323 phenylhydantoinase; Validated | Back alignment and domain information |
|---|
| >PRK08044 allantoinase; Provisional | Back alignment and domain information |
|---|
| >PF00962 A_deaminase: Adenosine/AMP deaminase immunodeficiency disease (SCID); InterPro: IPR001365 Adenosine deaminase (3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 247 | ||||
| 2xio_A | 301 | Structure Of Putative Deoxyribonuclease Tatdn1 Isof | 1e-12 | ||
| 1yix_A | 265 | Crystal Structure Of Ycfh, Tatd Homolog From Escher | 1e-10 | ||
| 2gzx_A | 265 | Crystal Structure Of The Tatd Deoxyribonuclease Mw0 | 4e-09 | ||
| 1xwy_A | 264 | Crystal Structure Of Tatd Deoxyribonuclease From Es | 1e-07 | ||
| 1zzm_A | 259 | Crystal Structure Of Yjjv, Tatd Homolog From Escher | 2e-07 | ||
| 2y1h_A | 272 | Crystal Structure Of The Human Tatd-Domain Protein | 6e-07 | ||
| 3gg7_A | 254 | Crystal Structure Of An Uncharacterized Metalloprot | 2e-06 | ||
| 3rcm_A | 287 | Crystal Structure Of Efi Target 500140:tatd Family | 1e-05 | ||
| 1j6o_A | 268 | Crystal Structure Of Tatd-related Deoxyribonuclease | 3e-05 | ||
| 3ipw_A | 325 | Crystal Structure Of Hydrolase Tatd Family Protein | 2e-04 |
| >pdb|2XIO|A Chain A, Structure Of Putative Deoxyribonuclease Tatdn1 Isoform A Length = 301 | Back alignment and structure |
|
| >pdb|1YIX|A Chain A, Crystal Structure Of Ycfh, Tatd Homolog From Escherichia Coli K12, At 1.9 A Resolution Length = 265 | Back alignment and structure |
| >pdb|2GZX|A Chain A, Crystal Structure Of The Tatd Deoxyribonuclease Mw0446 From Staphylococcus Aureus. Northeast Structural Genomics Consortium Target Zr237. Length = 265 | Back alignment and structure |
| >pdb|1XWY|A Chain A, Crystal Structure Of Tatd Deoxyribonuclease From Escherichia Coli K12 At 2.0 A Resolution Length = 264 | Back alignment and structure |
| >pdb|1ZZM|A Chain A, Crystal Structure Of Yjjv, Tatd Homolog From Escherichia Coli K12, At 1.8 A Resolution Length = 259 | Back alignment and structure |
| >pdb|2Y1H|A Chain A, Crystal Structure Of The Human Tatd-Domain Protein 3 (Tatdn3) Length = 272 | Back alignment and structure |
| >pdb|3GG7|A Chain A, Crystal Structure Of An Uncharacterized Metalloprotein From Deinococcus Radiodurans Length = 254 | Back alignment and structure |
| >pdb|3RCM|A Chain A, Crystal Structure Of Efi Target 500140:tatd Family Hydrolase From Pseudomonas Putida Length = 287 | Back alignment and structure |
| >pdb|1J6O|A Chain A, Crystal Structure Of Tatd-related Deoxyribonuclease (tm0667) From Thermotoga Maritima At 1.8 A Resolution Length = 268 | Back alignment and structure |
| >pdb|3IPW|A Chain A, Crystal Structure Of Hydrolase Tatd Family Protein From Entamoeba Histolytica Length = 325 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
Score = 138 bits (350), Expect = 7e-40
Identities = 52/212 (24%), Positives = 91/212 (42%), Gaps = 35/212 (16%)
Query: 33 AVGEIGLD---KGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDLLEIMKSV 89
A+GE GLD ++ Q+ F +Q EL+++ K P +HC + + L+I K
Sbjct: 106 AIGECGLDFDRLQFCPKDT----QLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDITKRN 161
Query: 90 GPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKA-----QKVPSERILLETDAP 144
G ++HS+ G+ E L L Y F+G + +A + +PSE++++ETDAP
Sbjct: 162 RDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLKSIPSEKLMIETDAP 221
Query: 145 DALPKAELNSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPA 204
+ + A ++ K S + N P
Sbjct: 222 -----------WC------GVKSTHAGSKY------IRTAFPTKKKWESGHCLKDRNEPC 258
Query: 205 NIHNVLDYVASLLDMTKEELAELSYRNAIRLF 236
+I +L+ ++++ D ELA Y N I++F
Sbjct: 259 HIIQILEIMSAVRDEDPLELANTLYNNTIKVF 290
|
| >3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Length = 287 | Back alignment and structure |
|---|
| >2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} Length = 272 | Back alignment and structure |
|---|
| >1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Length = 264 | Back alignment and structure |
|---|
| >3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Length = 325 | Back alignment and structure |
|---|
| >3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein initiative, NEW YORK SGX research center for structural GEN nysgxrc; 1.50A {Saccharomyces cerevisiae} Length = 401 | Back alignment and structure |
|---|
| >3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} Length = 254 | Back alignment and structure |
|---|
| >1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Length = 259 | Back alignment and structure |
|---|
| >1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Length = 259 | Back alignment and structure |
|---|
| >1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Length = 268 | Back alignment and structure |
|---|
| >1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Length = 268 | Back alignment and structure |
|---|
| >2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Length = 265 | Back alignment and structure |
|---|
| >2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Length = 265 | Back alignment and structure |
|---|
| >3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Length = 261 | Back alignment and structure |
|---|
| >1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Length = 265 | Back alignment and structure |
|---|
| >1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Length = 265 | Back alignment and structure |
|---|
| >2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Length = 314 | Back alignment and structure |
|---|
| >2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Length = 330 | Back alignment and structure |
|---|
| >1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Length = 291 | Back alignment and structure |
|---|
| >3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Length = 363 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 247 | |||
| 3ipw_A | 325 | Hydrolase TATD family protein; niaid, ssgcid, seat | 100.0 | |
| 3rcm_A | 287 | TATD family hydrolase; HET: CIT; 2.05A {Pseudomona | 100.0 | |
| 3e2v_A | 401 | 3'-5'-exonuclease; structural genomics, hydrolase, | 100.0 | |
| 3gg7_A | 254 | Uncharacterized metalloprotein; structural genomic | 100.0 | |
| 2xio_A | 301 | Putative deoxyribonuclease tatdn1; hydrolase; 1.19 | 100.0 | |
| 1zzm_A | 259 | Putative deoxyribonuclease YJJV; hydrolaze, zinc, | 100.0 | |
| 1xwy_A | 264 | DNAse TATD, deoxyribonuclease TATD; TIM barrael, z | 100.0 | |
| 2y1h_A | 272 | Putative deoxyribonuclease tatdn3; hydrolase; 2.50 | 100.0 | |
| 1j6o_A | 268 | TATD-related deoxyribonuclease; structural genomic | 100.0 | |
| 3guw_A | 261 | Uncharacterized protein AF_1765; alpha-beta protei | 100.0 | |
| 1yix_A | 265 | Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW | 100.0 | |
| 2gzx_A | 265 | Putative TATD related DNAse; deoxyribonuclease, NE | 100.0 | |
| 2ob3_A | 330 | Parathion hydrolase; metalloenzyme, TIM barrel, ne | 99.97 | |
| 3rhg_A | 365 | Putative phophotriesterase; hydrolase, amidohydrol | 99.97 | |
| 3k2g_A | 364 | Resiniferatoxin-binding, phosphotriesterase- relat | 99.97 | |
| 3gtx_A | 339 | Organophosphorus hydrolase; mutant, amidohydrolase | 99.97 | |
| 2vc7_A | 314 | Aryldialkylphosphatase; phosphotriesterase, promis | 99.95 | |
| 3pnz_A | 330 | Phosphotriesterase family protein; amidohydrolase | 99.95 | |
| 1bf6_A | 291 | Phosphotriesterase homology protein; hypothetical | 99.95 | |
| 3ovg_A | 363 | Amidohydrolase; structural genomics, PSI-2, protei | 99.94 | |
| 3tn4_A | 360 | Phosphotriesterase; lactonase, hydrolase; HET: KCX | 99.88 | |
| 3cjp_A | 272 | Predicted amidohydrolase, dihydroorotase family; s | 99.86 | |
| 2f6k_A | 307 | Metal-dependent hydrolase; metal dependent hydroly | 99.76 | |
| 4i6k_A | 294 | Amidohydrolase family protein; enzyme function ini | 99.75 | |
| 2ffi_A | 288 | 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; | 99.72 | |
| 2dvt_A | 327 | Thermophilic reversible gamma-resorcylate decarbo; | 99.72 | |
| 3irs_A | 291 | Uncharacterized protein BB4693; structural genomic | 99.69 | |
| 2gwg_A | 350 | 4-oxalomesaconate hydratase; TIM-barrel like prote | 99.63 | |
| 2wm1_A | 336 | 2-amino-3-carboxymuconate-6-semialdehyde decarboxy | 99.47 | |
| 4do7_A | 303 | Amidohydrolase 2; enzyme function initiative, EFI, | 99.26 | |
| 2hbv_A | 334 | 2-amino-3-carboxymuconate 6-semialdehyde decarbox; | 99.26 | |
| 3nqb_A | 608 | Adenine deaminase 2; PSI-II, structural genomics, | 99.25 | |
| 2qpx_A | 376 | Predicted metal-dependent hydrolase of the TIM-BA; | 99.12 | |
| 2ics_A | 379 | Adenine deaminase; TIM barrel, binuclear zinc, ade | 98.96 | |
| 4f0r_A | 447 | 5-methylthioadenosine/S-adenosylhomocysteine DEAM; | 98.76 | |
| 3nur_A | 357 | Amidohydrolase; TIM barrel; 1.75A {Staphylococcus | 98.74 | |
| 3hm7_A | 448 | Allantoinase; metallo-dependent hydrolase, protein | 98.72 | |
| 4inf_A | 373 | Metal-dependent hydrolase; amidohydrolase, metal b | 98.54 | |
| 3ooq_A | 396 | Amidohydrolase; structural genomics, protein struc | 98.49 | |
| 3ij6_A | 312 | Uncharacterized metal-dependent hydrolase; structu | 98.44 | |
| 2vun_A | 386 | Enamidase; nicotinate degradation, binuclear metal | 98.21 | |
| 2z00_A | 426 | Dihydroorotase; zinc binding protein, hydrolase, m | 98.2 | |
| 3lnp_A | 468 | Amidohydrolase family protein OLEI01672_1_465; TIM | 97.98 | |
| 3gnh_A | 403 | L-lysine, L-arginine carboxypeptidase CC2672; N-me | 97.98 | |
| 2qt3_A | 403 | N-isopropylammelide isopropyl amidohydrolase; N-is | 97.68 | |
| 3be7_A | 408 | Zn-dependent arginine carboxypeptidase; unknown so | 97.62 | |
| 3feq_A | 423 | Putative amidohydrolase; unknown source, sargasso | 97.6 | |
| 4dyk_A | 451 | Amidohydrolase; adenosine deaminase, nysgrc, struc | 97.57 | |
| 4dzh_A | 472 | Amidohydrolase; adenosine deaminase, nysgrc, struc | 97.54 | |
| 3h4u_A | 479 | Amidohydrolase; signature of Zn ligands, structura | 97.53 | |
| 4dzi_A | 423 | Putative TIM-barrel metal-dependent hydrolase; ami | 97.44 | |
| 2ogj_A | 417 | Dihydroorotase; TIM barrel, binuclear zinc, imidaz | 97.38 | |
| 2r8c_A | 426 | Putative amidohydrolase; unknown source, sargasso | 97.37 | |
| 3mpg_A | 428 | Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus | 97.37 | |
| 3ls9_A | 456 | Triazine hydrolase; atrazine chlorohydrolase TRZN; | 97.21 | |
| 2q09_A | 416 | Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio | 97.13 | |
| 4d9a_A | 303 | 2-pyrone-4,6-dicarbaxylate hydrolase; structural g | 96.91 | |
| 4aql_A | 476 | Guanine deaminase; hydrolase, purine metabolism; H | 96.58 | |
| 3sfw_A | 461 | Dihydropyrimidinase; hydrolase, zinc binding; HET: | 96.54 | |
| 2qs8_A | 418 | XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p | 96.49 | |
| 2i9u_A | 439 | Cytosine/guanine deaminase related protein; protei | 96.39 | |
| 2vm8_A | 501 | Dihydropyrimidinase-related protein 2; neurogenesi | 96.14 | |
| 1gkr_A | 458 | Hydantoinase, non-ATP dependent L-selective hydant | 96.02 | |
| 2ftw_A | 521 | Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba | 95.99 | |
| 3pao_A | 326 | Adenosine deaminase; structural genomics, PSI-2, p | 95.86 | |
| 2imr_A | 420 | Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, | 95.71 | |
| 2puz_A | 419 | Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino | 95.63 | |
| 2ood_A | 475 | BLR3880 protein; PSI-II, PSI-2, guanine deaminase, | 95.56 | |
| 3v7p_A | 427 | Amidohydrolase family protein; iron binding site, | 95.5 | |
| 2p9b_A | 458 | Possible prolidase; protein structure initiative I | 95.48 | |
| 3rys_A | 343 | Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 | 95.32 | |
| 1gkp_A | 458 | Hydantoinase; hydrolase, dihydropyrimidinase, cycl | 95.15 | |
| 3icj_A | 534 | Uncharacterized metal-dependent hydrolase; structu | 95.1 | |
| 2pgf_A | 371 | Adenosine deaminase; metallo-dependent hydrolase, | 94.99 | |
| 2paj_A | 492 | Putative cytosine/guanine deaminase; NYSGXRC, PSI- | 94.97 | |
| 3mdu_A | 453 | N-formimino-L-glutamate iminohydrolase; amonohydra | 94.88 | |
| 2bb0_A | 421 | Imidazolonepropionase; TIM barrel, hydrolase; 2.00 | 94.7 | |
| 1ra0_A | 430 | Cytosine deaminase; alpha-beta barrel, hexamer, co | 94.67 | |
| 2i5g_A | 325 | Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, stru | 94.57 | |
| 3iar_A | 367 | Adenosine deaminase; purine metabolism structural | 93.12 | |
| 3gri_A | 424 | Dihydroorotase, dhoase; hydrolase, IDP00795, metal | 92.21 | |
| 4f0l_A | 458 | Amidohydrolase; ssgcid, structural genomics, seatt | 91.65 | |
| 2vr2_A | 541 | Dihydropyrimidinase; hydantoinase, metal-binding, | 91.57 | |
| 3neh_A | 318 | Renal dipeptidase family protein; structural genom | 90.63 | |
| 3dc8_A | 490 | Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K | 90.28 | |
| 4gxw_A | 380 | Adenosine deaminase; amidohydrolase, COG1816, EFI, | 89.84 | |
| 1itu_A | 369 | Renal dipeptidase; glycoprotein, membrane-bound, z | 89.36 | |
| 1p1m_A | 406 | Hypothetical protein TM0936; putative metal depend | 88.54 | |
| 1onw_A | 390 | Isoaspartyl dipeptidase; amidohydrolase, hydrolase | 88.54 | |
| 3e74_A | 473 | Allantoinase; (beta/alpha)8-barrel domain, small b | 88.33 | |
| 2rag_A | 417 | Dipeptidase; aminohydrolase, structural genomics, | 88.18 | |
| 1o12_A | 376 | N-acetylglucosamine-6-phosphate deacetylase; struc | 88.06 | |
| 2z26_A | 347 | Dihydroorotase, dhoase; TIM barrel, hydrolase; HET | 88.0 | |
| 1xrt_A | 467 | Dihydroorotase, dhoase; amidohydrolase, metalloenz | 87.91 | |
| 3id7_A | 400 | Dipeptidase; streptomyces coelicolor A3(2), hydrol | 86.9 | |
| 3gip_A | 480 | N-acyl-D-glutamate deacylase; amidohydrolase famil | 86.86 | |
| 1yrr_A | 382 | N-acetylglucosamine-6-phosphate deacetylase; (beta | 85.91 | |
| 3b40_A | 417 | PVDM, probable dipeptidase; structural genomics, h | 84.89 | |
| 3vni_A | 294 | Xylose isomerase domain protein TIM barrel; D-psic | 81.71 | |
| 3pnu_A | 359 | Dihydroorotase; TIM barrel, zinc binding, hydrolas | 80.23 |
| >3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-51 Score=377.25 Aligned_cols=214 Identities=20% Similarity=0.228 Sum_probs=179.0
Q ss_pred eeeecccccCCCChh-HHHHHHHHhhcC--CceEEEeecCCCCCCCCCCCHHHHHHHHHHHHHHHHH-cCCceEEeeccc
Q 025866 3 WVCFIFRFVQERTPN-WFSTLKEFFEIT--PAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKE-LKRPASIHCVRA 78 (247)
Q Consensus 3 ~~g~hP~~~~~~~~~-~l~~l~~~l~~~--~~~aIGEIGLD~~~~~~~~~~~~Q~~vf~~qL~lA~~-~~lpv~lH~~~a 78 (247)
.+|+|||++.+..++ +++.|++++.++ +++|||||||||++. ...+++.|+++|++||+||++ +++||+||+|+|
T Consensus 100 ~~GiHP~~~~~~~~~~~l~~L~~l~~~~~~~vvAIGEiGLD~~~~-~~~~~~~Q~~~F~~ql~lA~e~~~lPviiH~r~A 178 (325)
T 3ipw_A 100 TIGVHPTRTNELKQEGYLDELLLLCEKNIDKVVAIGEIGLDYERL-QFSDKETQLSGYRTLSILHQKYPYLPFFFHCRKS 178 (325)
T ss_dssp EECCCGGGGGGGGSTTHHHHHHHHHHHTGGGEEEEEEEEEETTCC-SSSCHHHHHHHHHHTHHHHHHCTTCCEEEEEESC
T ss_pred EEEECcchhhcCCchHHHHHHHHHHhcCCCCEEEEEeeecCCCcC-CCCCHHHHHHHHHHHHHHHHHhhCCeEEEEeCch
Confidence 689999999887665 899999999764 799999999999863 246899999999999999999 999999999999
Q ss_pred HHHHHHHHHhcCCCCCcEEEEeCCCCHHHHHHHHHCCCeeeeccccccccc------cCCCCCceEEecCCCCCCCchhh
Q 025866 79 FGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKA------QKVPSERILLETDAPDALPKAEL 152 (247)
Q Consensus 79 ~~~~l~iLk~~~~~~~~~I~H~fsGs~~~~~~~l~~G~~~Si~~~i~~~~~------~~iPldriLlETD~P~~~p~~~~ 152 (247)
.++++++|++++....++|||||+|+.+++++++++|+||||+|.+ +++. +.+|+||||||||+||+.|.+.+
T Consensus 179 ~~d~l~iL~~~~~~~~~gViH~FsGs~e~a~~~l~lG~yis~~G~~-~k~~~~~~~v~~iPldrlLlETDaP~l~~~~~~ 257 (325)
T 3ipw_A 179 WSDLCQLNKELGYNGCKGVVHCFDGTEEEMNQILNEGWDIGVTGNS-LQSIELLNVMKQIPIERLHIETDCPYCGIKKTS 257 (325)
T ss_dssp HHHHHHHHHHTTCTTSCEEECSCCCCHHHHHHHHHTTCEEEECSGG-GSSHHHHHHHTTSCGGGEEECCCTTSCCCCTTS
T ss_pred HHHHHHHHHhcCCCCCcEEEEECCCCHHHHHHHHhcCcEEeeCccc-cCcHHHHHHHHhCCcccEEEeCCCccccccccc
Confidence 9999999999875445689999999999999999999999999974 3322 23999999999999999988776
Q ss_pred ccccccCCCCCCcccccccccCCCCCCCCCCcccccCCCCCCCCCcccCcchhHHHHHHHHHHccCCCHHHHHHHHHHHH
Q 025866 153 NSLFLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNA 232 (247)
Q Consensus 153 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~n~P~~l~~v~~~iA~~~~~s~e~l~~~~~~N~ 232 (247)
.++.|+....+.. ++ .|+....+.+.||+|++|+.|++.||+++|+++++|++++++|+
T Consensus 258 ~~~~~~~~p~p~r----------~~-----------~k~~~~~~~g~rNeP~~v~~v~~~iA~l~g~~~eeva~~t~~Na 316 (325)
T 3ipw_A 258 AGFKYLKEKDFGV----------KV-----------EKYQRNKYVQRRNEPSNIIDIAIIMSSIKHISLFEFVNKVYSNS 316 (325)
T ss_dssp GGGGGCSSCCCCB----------CG-----------GGCCTTSCBTTCCCGGGHHHHHHHHHHHHTCCHHHHHHHHHHHH
T ss_pred cchhcccccCccc----------cc-----------cccccccccCCcCcHHHHHHHHHHHHHhhCcCHHHHHHHHHHHH
Confidence 6777765322110 00 01111223347999999999999999999999999999999999
Q ss_pred HHhhCCC
Q 025866 233 IRLFSYE 239 (247)
Q Consensus 233 ~~~f~~~ 239 (247)
.++|++.
T Consensus 317 ~~lF~~~ 323 (325)
T 3ipw_A 317 MNMYFPT 323 (325)
T ss_dssp HHHHSCC
T ss_pred HHHhCcC
Confidence 9999864
|
| >3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein initiative, NEW YORK SGX research center for structural GEN nysgxrc; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} SCOP: c.1.9.0 | Back alignment and structure |
|---|
| >2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 | Back alignment and structure |
|---|
| >1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 | Back alignment and structure |
|---|
| >2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 | Back alignment and structure |
|---|
| >3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} | Back alignment and structure |
|---|
| >1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 | Back alignment and structure |
|---|
| >2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... | Back alignment and structure |
|---|
| >3rhg_A Putative phophotriesterase; hydrolase, amidohydrolase, zinc binding site, enzyme functio initiative, EFI; HET: SO4; 1.53A {Proteus mirabilis} | Back alignment and structure |
|---|
| >3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* | Back alignment and structure |
|---|
| >2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* | Back alignment and structure |
|---|
| >3pnz_A Phosphotriesterase family protein; amidohydrolase fold; HET: KCX; 1.60A {Listeria monocytogenes serotype 4b strorganism_taxid} SCOP: c.1.9.0 | Back alignment and structure |
|---|
| >1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 | Back alignment and structure |
|---|
| >3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* | Back alignment and structure |
|---|
| >3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A* | Back alignment and structure |
|---|
| >3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 | Back alignment and structure |
|---|
| >4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii} | Back alignment and structure |
|---|
| >2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; TIM-barrel protein., structural genomics, PSI, protein struc initiative; 2.61A {Pseudomonas putida} SCOP: c.1.9.15 | Back alignment and structure |
|---|
| >2dvt_A Thermophilic reversible gamma-resorcylate decarbo; TIM barrel, lyase; 1.70A {Rhizobium SP} SCOP: c.1.9.15 PDB: 2dvu_A* 2dvx_A* 3s4t_A* | Back alignment and structure |
|---|
| >3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A | Back alignment and structure |
|---|
| >2gwg_A 4-oxalomesaconate hydratase; TIM-barrel like protein, structural genomics, PSI, protein S initiative; 1.80A {Rhodopseudomonas palustris} SCOP: c.1.9.15 | Back alignment and structure |
|---|
| >2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4do7_A Amidohydrolase 2; enzyme function initiative, EFI, structural TIM-barrel fold, putative lactonase; 1.70A {Burkholderia multivorans} PDB: 4dlm_A 4dnm_A* 4dlf_A | Back alignment and structure |
|---|
| >2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarbox; ACMSD, TIM-barrel, decarboxylase, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A | Back alignment and structure |
|---|
| >3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A | Back alignment and structure |
|---|
| >2qpx_A Predicted metal-dependent hydrolase of the TIM-BA; YP_805737.1, putative metal-dependent hydrolase; HET: KCX MSE; 1.40A {Lactobacillus casei} | Back alignment and structure |
|---|
| >2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 | Back alignment and structure |
|---|
| >4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* | Back alignment and structure |
|---|
| >3nur_A Amidohydrolase; TIM barrel; 1.75A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4inf_A Metal-dependent hydrolase; amidohydrolase, metal binding site, enzyme functi initiative, EFI; 1.48A {Novosphingobium aromaticivorans} PDB: 4ing_A* | Back alignment and structure |
|---|
| >3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} | Back alignment and structure |
|---|
| >2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* | Back alignment and structure |
|---|
| >3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* | Back alignment and structure |
|---|
| >4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4dzi_A Putative TIM-barrel metal-dependent hydrolase; amidohydrolase, bimetal binding site, enzyme FUNC initiative, EFI; HET: SO4; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* | Back alignment and structure |
|---|
| >3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* | Back alignment and structure |
|---|
| >2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* | Back alignment and structure |
|---|
| >4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A | Back alignment and structure |
|---|
| >3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* | Back alignment and structure |
|---|
| >2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 | Back alignment and structure |
|---|
| >2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 | Back alignment and structure |
|---|
| >2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A | Back alignment and structure |
|---|
| >1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 | Back alignment and structure |
|---|
| >2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 | Back alignment and structure |
|---|
| >3pao_A Adenosine deaminase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: ADE; 2.49A {Pseudomonas aeruginosa} PDB: 3pan_A* 3ou8_A* 3pbm_A* | Back alignment and structure |
|---|
| >2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 | Back alignment and structure |
|---|
| >2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A | Back alignment and structure |
|---|
| >2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 | Back alignment and structure |
|---|
| >3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} | Back alignment and structure |
|---|
| >2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 | Back alignment and structure |
|---|
| >3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} SCOP: c.1.9.0 | Back alignment and structure |
|---|
| >1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* | Back alignment and structure |
|---|
| >3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* | Back alignment and structure |
|---|
| >2pgf_A Adenosine deaminase; metallo-dependent hydrolase, structural genomics, medical ST genomics of pathogenic protozoa consortium, MSGPP; HET: MSE ADN; 1.89A {Plasmodium vivax} PDB: 2pgr_A* 2qvn_A* 3ewc_A* 3ewd_A* 2amx_A | Back alignment and structure |
|---|
| >2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 | Back alignment and structure |
|---|
| >3mdu_A N-formimino-L-glutamate iminohydrolase; amonohydralase family, N-formimino-L-glutamate iminohydrolas guanidino-L-glutamate; HET: NGQ; 1.40A {Pseudomonas aeruginosa} PDB: 3mdw_A* | Back alignment and structure |
|---|
| >2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A | Back alignment and structure |
|---|
| >1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A | Back alignment and structure |
|---|
| >2i5g_A Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, structural genomics, protein structure initiative; 2.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3iar_A Adenosine deaminase; purine metabolism structural genomics, structural genomics consortium, SGC, D mutation, hereditary hemolytic anemia, hydrolase; HET: 3D1; 1.52A {Homo sapiens} SCOP: c.1.9.1 PDB: 2bgn_E* 1w1i_E* 1qxl_A* 1krm_A* 1vfl_A 1ndv_A* 1ndy_A* 1ndz_A* 1o5r_A* 1uml_A* 1v79_A* 1v7a_A* 1ndw_A 1wxy_A* 1wxz_A* 2e1w_A* 2z7g_A* 2ada_A* 3mvi_A 1a4l_A* ... | Back alignment and structure |
|---|
| >3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4f0l_A Amidohydrolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3neh_A Renal dipeptidase family protein; structural genomics, nysgrc, dipeptide L-Leu-D-Ala, PSI-2, P structure initiative; HET: L3A; 1.64A {Listeria monocytogenes} PDB: 3lu2_A | Back alignment and structure |
|---|
| >3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4gxw_A Adenosine deaminase; amidohydrolase, COG1816, EFI, structural genomics, hydrolase; 1.30A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1itu_A Renal dipeptidase; glycoprotein, membrane-bound, zinc protease BET lactamase, cilastatin, complex (hydrolase-inhibitor), hydro; HET: NAG CIL; 2.00A {Homo sapiens} SCOP: c.1.9.7 PDB: 1itq_A* | Back alignment and structure |
|---|
| >1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A | Back alignment and structure |
|---|
| >1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* | Back alignment and structure |
|---|
| >3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2rag_A Dipeptidase; aminohydrolase, structural genomics, NYSGXRC, target 9257A, protein structure initiative; 2.00A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 | Back alignment and structure |
|---|
| >2z26_A Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX DOR NCD; 1.29A {Escherichia coli} PDB: 2z24_A* 2z25_A* 2eg6_A* 1xge_A* 2eg7_A* 2eg8_A* 2z27_A* 2e25_A* 2z28_A* 2z29_A* 3mjm_A* 2z2a_A* 1j79_A* 2z2b_A* 3ihn_A* 3jze_A* | Back alignment and structure |
|---|
| >1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* | Back alignment and structure |
|---|
| >3id7_A Dipeptidase; streptomyces coelicolor A3(2), hydrolase; 1.30A {Streptomyces coelicolor} PDB: 3isi_X* 3itc_A* 3k5x_A* 3s2j_A* 3s2l_A* 3s2m_A* 3s2n_A* | Back alignment and structure |
|---|
| >3gip_A N-acyl-D-glutamate deacylase; amidohydrolase family, hydrolase; 1.50A {Bordetella bronchiseptica} PDB: 3giq_A* | Back alignment and structure |
|---|
| >1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* | Back alignment and structure |
|---|
| >3b40_A PVDM, probable dipeptidase; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* | Back alignment and structure |
|---|
| >3pnu_A Dihydroorotase; TIM barrel, zinc binding, hydrolase, structu genomics, center for structural genomics of infectious DISE csgid; HET: KCX; 2.40A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 247 | ||||
| d1j6oa_ | 260 | c.1.9.12 (A:) Hypothetical protein TM0667 {Thermot | 1e-19 | |
| d1yixa1 | 265 | c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH | 2e-18 | |
| d1zzma1 | 259 | c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV | 8e-18 | |
| d1xwya1 | 260 | c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) { | 3e-13 | |
| d1bf6a_ | 291 | c.1.9.3 (A:) Phosphotriesterase homology protein { | 2e-11 | |
| d1i0da_ | 331 | c.1.9.3 (A:) Phosphotriesterase (parathion hydrola | 4e-06 |
| >d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Length = 260 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Metallo-dependent hydrolases family: TatD Mg-dependent DNase-like domain: Hypothetical protein TM0667 species: Thermotoga maritima [TaxId: 2336]
Score = 82.7 bits (203), Expect = 1e-19
Identities = 47/242 (19%), Positives = 87/242 (35%), Gaps = 54/242 (22%)
Query: 3 WVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLE 62
V +E ++ L++F + A+GE GLD + +V F +Q+E
Sbjct: 62 SVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRV--FVEQIE 119
Query: 63 LAKELKRPASIHCVRAFGDLLEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSG 122
LA +L P +H A+ + EI+++ +IH++ E + LG G
Sbjct: 120 LAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGG 179
Query: 123 FLMSMK-------AQKVPSERILLETDAPDALPKAELNSLFLVDGDPSLPQELSAKEEHS 175
+ K ++V E I+LETD P P+
Sbjct: 180 PVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQP------------------------- 214
Query: 176 PNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRL 235
+ N P + V++ ++ +L + + ++ E + NA R+
Sbjct: 215 --------------------FRGKRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRI 254
Query: 236 FS 237
F
Sbjct: 255 FL 256
|
| >d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Length = 265 | Back information, alignment and structure |
|---|
| >d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Length = 260 | Back information, alignment and structure |
|---|
| >d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Length = 291 | Back information, alignment and structure |
|---|
| >d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Length = 331 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 247 | |||
| d1j6oa_ | 260 | Hypothetical protein TM0667 {Thermotoga maritima [ | 100.0 | |
| d1xwya1 | 260 | Deoxyribonuclease TatD (MttC) {Escherichia coli [T | 100.0 | |
| d1yixa1 | 265 | Putative deoxyribonuclease YcfH {Escherichia coli | 100.0 | |
| d1zzma1 | 259 | Putative deoxyribonuclease YjjV {Escherichia coli | 100.0 | |
| d1bf6a_ | 291 | Phosphotriesterase homology protein {Escherichia c | 100.0 | |
| d1i0da_ | 331 | Phosphotriesterase (parathion hydrolase, PTE) {Pse | 99.73 | |
| d2dvta1 | 325 | Thermophilic reversible gamma-resorcylate decarbox | 97.91 | |
| d2ffia1 | 271 | Putative 2-pyrone-4,6-dicarboxylic acid hydrolase | 97.87 | |
| d2f6ka1 | 306 | Putative amidohydrolase LP2961 {Lactobacillus plan | 97.66 | |
| d2gwga1 | 342 | 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas | 97.53 | |
| d2hbva1 | 331 | 2-amino-3-carboxymuconate 6-semialdehyde decarboxy | 96.98 | |
| d2uz9a2 | 313 | Guanine deaminase {Human (Homo sapiens) [TaxId: 96 | 96.5 | |
| d1p1ma2 | 281 | Hypothetical protein TM0936, probable catalytic do | 96.0 | |
| d2i9ua2 | 310 | Guanine deaminase {Clostridium acetobutylicum [Tax | 93.65 | |
| d1onwa2 | 284 | Isoaspartyl dipeptidase, catalytic domain {Escheri | 93.36 | |
| d1a4ma_ | 349 | Adenosine deaminase (ADA) {Mouse (Mus musculus) [T | 92.81 | |
| d1itua_ | 369 | Renal dipeptidase {Human (Homo sapiens) [TaxId: 96 | 91.83 | |
| d1kcxa2 | 334 | Dihydropyrimidinase related protein-1 {Mouse (Mus | 91.33 | |
| d2q09a2 | 301 | Probable 4-imidazolone-5-propanoate amidohydrolase | 90.61 | |
| d2bb0a2 | 300 | Imidazolonepropionase {Bacillus subtilis [TaxId: 1 | 90.1 | |
| d1j5sa_ | 451 | Uronate isomerase TM0064 {Thermotoga maritima [Tax | 89.3 | |
| d2amxa1 | 357 | Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI | 88.48 | |
| d2imra2 | 308 | Hypothetical protein DR0824 {Deinococcus radiodura | 87.15 | |
| d2puza2 | 301 | Imidazolonepropionase {Agrobacterium tumefaciens [ | 86.78 | |
| d2ftwa2 | 334 | Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli | 86.21 | |
| d1nfga2 | 330 | D-hydantoinase {Burkholderia pickettii [TaxId: 329 | 84.44 | |
| d1gkra2 | 325 | L-hydantoinase {Arthrobacter aurescens [TaxId: 436 | 83.72 | |
| d1gkpa2 | 335 | D-hydantoinase {Thermus sp. [TaxId: 275]} | 80.48 |
| >d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Metallo-dependent hydrolases family: TatD Mg-dependent DNase-like domain: Hypothetical protein TM0667 species: Thermotoga maritima [TaxId: 2336]
Probab=100.00 E-value=1.1e-53 Score=378.11 Aligned_cols=188 Identities=26% Similarity=0.319 Sum_probs=175.1
Q ss_pred eeeecccccCCCChhHHHHHHHHhhcCCceEEEeecCCCCCCCCCCCHHHHHHHHHHHHHHHHHcCCceEEeecccHHHH
Q 025866 3 WVCFIFRFVQERTPNWFSTLKEFFEITPAAAVGEIGLDKGSKGREIDFMDQVGVFRQQLELAKELKRPASIHCVRAFGDL 82 (247)
Q Consensus 3 ~~g~hP~~~~~~~~~~l~~l~~~l~~~~~~aIGEIGLD~~~~~~~~~~~~Q~~vf~~qL~lA~~~~lpv~lH~~~a~~~~ 82 (247)
.+|+|||++.+...++++.++.++.+++++|||||||||++ ...+.+.|+++|++||++|+++++||+||||++.+++
T Consensus 62 a~GiHP~~~~~~~~~~~~~l~~~~~~~~vvaIGEiGLD~~~--~~~~~~~Q~~vF~~ql~lA~~~~lPviiH~r~a~~~~ 139 (260)
T d1j6oa_ 62 SVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFR--NISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEA 139 (260)
T ss_dssp EECCCGGGGGGCCTTHHHHHHHHTTSTTEEEEEEEEEETTT--CSSCHHHHHHHHHHHHHHHHHHTCCEEEEEESCHHHH
T ss_pred ccccChhhcccccchhhhhhHHHHhhCCeeeEeeccccccc--cccHHHHHHHHHHHHHHHHHhcCcceEEeeccchHHH
Confidence 68999999999888889999999999999999999999986 3567899999999999999999999999999999999
Q ss_pred HHHHHhcCCCCCcEEEEeCCCCHHHHHHHHHCCCeeeeccccccccccC-------CCCCceEEecCCCCCCCchhhccc
Q 025866 83 LEIMKSVGPFPDGVIIHSYLGSAEMVPELSKLGAYFSFSGFLMSMKAQK-------VPSERILLETDAPDALPKAELNSL 155 (247)
Q Consensus 83 l~iLk~~~~~~~~~I~H~fsGs~~~~~~~l~~G~~~Si~~~i~~~~~~~-------iPldriLlETD~P~~~p~~~~~~~ 155 (247)
+++|++++..+.++|+|||+|+.+++++++++|+||||+|.+++.++.+ +|+||||+|||+||+.|.+.+
T Consensus 140 ~~il~~~~~~~~~~i~H~fsG~~~~~~~~l~~g~~is~~g~~~~~~~~~~~~~v~~iPldrlllETD~P~l~p~~~~--- 216 (260)
T d1j6oa_ 140 YEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFR--- 216 (260)
T ss_dssp HHHHHHSCCCSSCEEETTCCSCHHHHHHHHHHTEEEEECGGGGCTTCHHHHHHHHHHCGGGEEECCCBTSCCCGGGT---
T ss_pred HHHHHhhcCCCCCeeeeccccCHHHHHHHHhCCCceeeccccccchHHHHHHHHHhcccceEEEecCCCCCCCcccC---
Confidence 9999999766667999999999999999999999999999998865542 999999999999999987764
Q ss_pred cccCCCCCCcccccccccCCCCCCCCCCcccccCCCCCCCCCcccCcchhHHHHHHHHHHccCCCHHHHHHHHHHHHHHh
Q 025866 156 FLVDGDPSLPQELSAKEEHSPNVGSASDNQFHASKDSSTLPKETLNHPANIHNVLDYVASLLDMTKEELAELSYRNAIRL 235 (247)
Q Consensus 156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~n~P~~l~~v~~~iA~~~~~s~e~l~~~~~~N~~~~ 235 (247)
| .+|+|++|+.|++.+|+++|++.++|++++++|+.|+
T Consensus 217 ---------------------------------~---------~~n~P~~l~~v~~~iA~~~~~~~~ev~~~~~~N~~rl 254 (260)
T d1j6oa_ 217 ---------------------------------G---------KRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRI 254 (260)
T ss_dssp ---------------------------------T---------SCCCGGGHHHHHHHHHHHHTSCHHHHHHHHHHHHHHH
T ss_pred ---------------------------------C---------CCCChHHHHHHHHHHHHHhCcCHHHHHHHHHHHHHHH
Confidence 3 7999999999999999999999999999999999999
Q ss_pred hC
Q 025866 236 FS 237 (247)
Q Consensus 236 f~ 237 (247)
|+
T Consensus 255 F~ 256 (260)
T d1j6oa_ 255 FL 256 (260)
T ss_dssp HH
T ss_pred HH
Confidence 96
|
| >d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} | Back information, alignment and structure |
|---|
| >d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} | Back information, alignment and structure |
|---|
| >d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2uz9a2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a4ma_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcxa2 c.1.9.6 (A:67-400) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2q09a2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} | Back information, alignment and structure |
|---|
| >d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j5sa_ c.1.9.8 (A:) Uronate isomerase TM0064 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2puza2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ftwa2 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} | Back information, alignment and structure |
|---|
| >d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} | Back information, alignment and structure |
|---|
| >d1gkpa2 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]} | Back information, alignment and structure |
|---|