Citrus Sinensis ID: 025912

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MNIYGNSLHTTLHNHSQFTMSGRRVLREPPLSTRALPPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIMEKNIISVAQQIERLQAELANAEKRARAAAAAAAVNPSIYSLF
cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
ccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcc
mniygnslhttlhnhsqftmsgrrvlrepplstralppqhspslhhleDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECekknrasnHEQREIMEKNIISVAQQIERLQAELANAEKRARAAAAAAAvnpsiyslf
mniygnslhttlhnhsqftMSGRRVLREPPLSTRALPPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEkslkldaelRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIeterqeihkgraaiecekknrasnheqrEIMEKNIISVAQQIERLQAELANAEKRARAAAAaaavnpsiyslf
MNIYGNSLHTTLHNHSQFTMSGRRVLREPPLSTRALPPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIMEKNIISVAQQIERLQaelanaekraraaaaaaaVNPSIYSLF
*******************************************************************LAATHVAL******************************ELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEIN*********************************************************************************************
******************************************************************************************************************************************************************************************************************************************************
MNIYGNSLHTTLHNHSQFTMSGRRVLREPPLSTRALPPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIMEKNIISVAQQIERLQAELA**************VNPSIYSLF
MNIYGNSLHTTLHNHS*******RV******STRALPPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIMEKNIISVAQQIERLQAELANAEKRARAAA*******S*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIYGNSLHTTLHNHSQFTMSGRRVLREPPLSTRALPPQHSPSLHHLEDRIAIQHSDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIHKGRAAIECEKKNRASNHEQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAAVNPSIYSLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
255560349274 conserved hypothetical protein [Ricinus 0.845 0.759 0.564 1e-53
224103867288 predicted protein [Populus trichocarpa] 0.784 0.670 0.615 2e-53
449454989305 PREDICTED: uncharacterized protein LOC10 0.715 0.577 0.607 8e-51
449531685270 PREDICTED: uncharacterized LOC101204259, 0.715 0.651 0.607 3e-50
224059867284 predicted protein [Populus trichocarpa] 0.825 0.714 0.528 3e-49
359478523314 PREDICTED: uncharacterized protein LOC10 0.853 0.668 0.504 6e-49
359386140302 structural maintenance of chromosomes do 0.825 0.672 0.475 5e-47
357491069286 hypothetical protein MTR_5g072760 [Medic 0.735 0.632 0.535 7e-47
116782366309 unknown [Picea sitchensis] gi|116787652| 0.833 0.663 0.492 3e-46
255580849315 conserved hypothetical protein [Ricinus 0.833 0.650 0.473 9e-46
>gi|255560349|ref|XP_002521190.1| conserved hypothetical protein [Ricinus communis] gi|223539604|gb|EEF41190.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 164/218 (75%), Gaps = 10/218 (4%)

Query: 20  MSGRRVLREPPLSTRALP---PQ---HSPSLHH----LEDRIAIQHSDIQSLLQDNQRLA 69
           M+GR  L    L  R +P   P+     P LHH    LEDRIAIQH +IQ+LL DNQ+L 
Sbjct: 1   MAGRNNLPPNTLKHRQVPVDDPRLHNRVPRLHHPSTILEDRIAIQHREIQTLLLDNQQLT 60

Query: 70  ATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELD 129
           ATH+ALKQ+L+L + ELRHLS+ AA VKA+RD +VRE+YE+SLKLDAE+R I+++ AEL 
Sbjct: 61  ATHLALKQDLALVDDELRHLSAAAADVKAQRDDQVREVYERSLKLDAEVRSIDALRAELV 120

Query: 130 RVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIEC 189
           +V AD+EKL V +QE+  +L  IN D+AKAR E++ +AAI+A+I+T ++EI +GRAAIE 
Sbjct: 121 QVTADVEKLSVHRQELTAELRAINSDVAKARTEAQQVAAIEADIQTMQKEIQRGRAAIEN 180

Query: 190 EKKNRASNHEQREIMEKNIISVAQQIERLQAELANAEK 227
           EKK  ASN E  + ME+N+I+VA++IE+L AELAN EK
Sbjct: 181 EKKLYASNLEHGQTMEQNMIAVAREIEKLHAELANLEK 218

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224103867|ref|XP_002313225.1| predicted protein [Populus trichocarpa] gi|222849633|gb|EEE87180.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449454989|ref|XP_004145236.1| PREDICTED: uncharacterized protein LOC101204475 [Cucumis sativus] gi|449471289|ref|XP_004153266.1| PREDICTED: uncharacterized protein LOC101204259 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449531685|ref|XP_004172816.1| PREDICTED: uncharacterized LOC101204259, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|224059867|ref|XP_002300004.1| predicted protein [Populus trichocarpa] gi|222847262|gb|EEE84809.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359478523|ref|XP_002278199.2| PREDICTED: uncharacterized protein LOC100258756 [Vitis vinifera] gi|297745841|emb|CBI15897.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359386140|gb|AEV43359.1| structural maintenance of chromosomes domain-containing protein [Citrus sinensis] Back     alignment and taxonomy information
>gi|357491069|ref|XP_003615822.1| hypothetical protein MTR_5g072760 [Medicago truncatula] gi|355517157|gb|AES98780.1| hypothetical protein MTR_5g072760 [Medicago truncatula] Back     alignment and taxonomy information
>gi|116782366|gb|ABK22481.1| unknown [Picea sitchensis] gi|116787652|gb|ABK24593.1| unknown [Picea sitchensis] gi|116793930|gb|ABK26936.1| unknown [Picea sitchensis] gi|224286832|gb|ACN41119.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|255580849|ref|XP_002531244.1| conserved hypothetical protein [Ricinus communis] gi|223529163|gb|EEF31141.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
TAIR|locus:2089616331 AT3G14750 "AT3G14750" [Arabido 0.768 0.570 0.425 3.4e-38
TAIR|locus:2060848288 AT2G30120 [Arabidopsis thalian 0.699 0.597 0.494 1.1e-37
TAIR|locus:2035751283 AT1G55170 "AT1G55170" [Arabido 0.853 0.742 0.339 1.6e-29
TAIR|locus:2033681 359 AT1G67170 "AT1G67170" [Arabido 0.776 0.532 0.321 7.3e-27
TAIR|locus:2156146238 AT5G61920 "AT5G61920" [Arabido 0.731 0.756 0.276 6.7e-17
FB|FBgn0264695 1962 Mhc "Myosin heavy chain" [Dros 0.678 0.085 0.251 2.9e-06
ASPGD|ASPL0000061296 1258 AN0317 [Emericella nidulans (t 0.715 0.139 0.276 2e-05
WB|WBGene00003515 1969 myo-3 [Caenorhabditis elegans 0.686 0.085 0.254 2.6e-05
UNIPROTKB|P12844 1969 myo-3 "Myosin-3" [Caenorhabdit 0.686 0.085 0.254 2.6e-05
UNIPROTKB|A7E2Y1 1941 MYH7B "Myosin-7B" [Homo sapien 0.686 0.087 0.269 3.3e-05
TAIR|locus:2089616 AT3G14750 "AT3G14750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 409 (149.0 bits), Expect = 3.4e-38, P = 3.4e-38
 Identities = 83/195 (42%), Positives = 133/195 (68%)

Query:    27 REPP--LSTRALPPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQ 84
             REP   +  R LPPQ S     LEDR+A Q+ D+Q LL DNQRLAATHVALKQEL +A+ 
Sbjct:    52 REPQFRVDARGLPPQFSI----LEDRLAAQNQDVQGLLADNQRLAATHVALKQELEVAQH 107

Query:    85 ELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQE 144
             EL+ +     S++AE +  +RE+Y+KS++ + ELR +++M AE+ ++RADI++    +QE
Sbjct:   108 ELQRIMHYIDSLRAEEEIMMREMYDKSMRSEMELREVDAMRAEIQKIRADIKEFTSGRQE 167

Query:   145 MIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIM 204
             +   ++ +  DLA+   + + +  + AEIE  +QE+ + RAAI+ EKK  A N+E  +IM
Sbjct:   168 LTSQVHLMTQDLARLTADLQQIPTLTAEIENTKQELQRARAAIDYEKKGYAENYEHGKIM 227

Query:   205 EKNIISVAQQIERLQ 219
             E  ++++A+++E+L+
Sbjct:   228 EHKLVAMARELEKLR 242
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:2060848 AT2G30120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035751 AT1G55170 "AT1G55170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033681 AT1G67170 "AT1G67170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156146 AT5G61920 "AT5G61920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0264695 Mhc "Myosin heavy chain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061296 AN0317 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
WB|WBGene00003515 myo-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P12844 myo-3 "Myosin-3" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A7E2Y1 MYH7B "Myosin-7B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
pfam08317321 pfam08317, Spc7, Spc7 kinetochore protein 5e-04
COG4372 499 COG4372, COG4372, Uncharacterized protein conserve 6e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
smart00787312 smart00787, Spc7, Spc7 kinetochore protein 0.002
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information 
 Score = 50.1 bits (120), Expect = 5e-07
 Identities = 48/211 (22%), Positives = 89/211 (42%), Gaps = 15/211 (7%)

Query: 37  PPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASV 96
                  L  L +R+     ++ SL  + +R+      L QELS A +++  +      +
Sbjct: 669 SRSEPAELQRLRERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEIEKEIEQL 728

Query: 97  KAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLN------ 150
           + E +     L E    L +  + IE++ +EL  + A IE+L     ++ + LN      
Sbjct: 729 EQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEELEEDLHKLEEALNDLEARL 788

Query: 151 ------EINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIM 204
                 EI  +L+K  +E   + A   EIE +   +   +  +E E +      EQR  +
Sbjct: 789 SHSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQEL---QEQRIDL 845

Query: 205 EKNIISVAQQIERLQAELANAEKRARAAAAA 235
           ++ I S+ ++IE L  +    E+      AA
Sbjct: 846 KEQIKSIEKEIENLNGKKEELEEELEELEAA 876

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1164
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 246
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.79
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.71
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.63
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.56
PF00038312 Filament: Intermediate filament protein; InterPro: 97.43
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 97.39
PRK09039 343 hypothetical protein; Validated 97.15
PRK11637 428 AmiB activator; Provisional 97.13
PRK11637 428 AmiB activator; Provisional 97.11
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.05
PRK02224 880 chromosome segregation protein; Provisional 97.04
PF00038 312 Filament: Intermediate filament protein; InterPro: 96.93
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 96.89
KOG0933 1174 consensus Structural maintenance of chromosome pro 96.84
PRK03918 880 chromosome segregation protein; Provisional 96.81
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.78
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.74
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.57
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.57
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 96.44
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.37
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 96.32
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.2
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.18
PRK02224 880 chromosome segregation protein; Provisional 96.04
PF05701522 WEMBL: Weak chloroplast movement under blue light; 95.97
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 95.97
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 95.91
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.9
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.83
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 95.76
PRK03918 880 chromosome segregation protein; Provisional 95.66
PRK04863 1486 mukB cell division protein MukB; Provisional 95.62
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 95.54
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 95.38
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 95.23
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 94.9
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 94.82
PRK04778 569 septation ring formation regulator EzrA; Provision 94.82
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 94.8
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 94.62
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 94.6
PF06160 560 EzrA: Septation ring formation regulator, EzrA ; I 94.57
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 94.5
PHA02562 562 46 endonuclease subunit; Provisional 94.37
COG4372 499 Uncharacterized protein conserved in bacteria with 94.3
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.15
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 94.1
PHA02562 562 46 endonuclease subunit; Provisional 94.07
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 93.89
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 93.86
PF09787 511 Golgin_A5: Golgin subfamily A member 5; InterPro: 93.83
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 93.81
PF13514 1111 AAA_27: AAA domain 93.72
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.62
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 93.52
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 93.45
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 93.39
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 93.21
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 92.93
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 92.85
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 92.84
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 92.64
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 92.64
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 92.56
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 92.54
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 92.43
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 92.43
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 92.4
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 92.4
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.29
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 92.22
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.22
PRK09039343 hypothetical protein; Validated 92.2
COG4942 420 Membrane-bound metallopeptidase [Cell division and 92.15
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 91.98
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 91.88
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 91.62
PF10186 302 Atg14: UV radiation resistance protein and autopha 91.6
KOG0996 1293 consensus Structural maintenance of chromosome pro 91.59
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 91.38
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 91.21
KOG4809 654 consensus Rab6 GTPase-interacting protein involved 91.08
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 90.98
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 90.81
PRK11546143 zraP zinc resistance protein; Provisional 90.74
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 90.67
PRK11519 719 tyrosine kinase; Provisional 90.34
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 90.18
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 89.98
KOG0933 1174 consensus Structural maintenance of chromosome pro 89.83
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 89.55
PRK10884206 SH3 domain-containing protein; Provisional 89.43
PF15294278 Leu_zip: Leucine zipper 89.16
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 88.94
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 88.86
KOG0249 916 consensus LAR-interacting protein and related prot 88.85
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 88.79
KOG3478120 consensus Prefoldin subunit 6, KE2 family [Posttra 88.73
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 88.63
KOG1937 521 consensus Uncharacterized conserved protein [Funct 88.6
PF13851201 GAS: Growth-arrest specific micro-tubule binding 88.6
PLN03229762 acetyl-coenzyme A carboxylase carboxyl transferase 88.5
KOG4673961 consensus Transcription factor TMF, TATA element m 88.38
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 88.01
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 87.93
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 87.41
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 87.04
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 86.41
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 86.28
PF1259257 DUF3763: Protein of unknown function (DUF3763); In 86.22
PRK04863 1486 mukB cell division protein MukB; Provisional 86.2
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 86.19
COG2433 652 Uncharacterized conserved protein [Function unknow 86.1
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 86.01
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 85.82
PF13514 1111 AAA_27: AAA domain 85.53
PF07794790 DUF1633: Protein of unknown function (DUF1633); In 85.16
KOG4603201 consensus TBP-1 interacting protein [Signal transd 85.07
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 84.91
COG3206458 GumC Uncharacterized protein involved in exopolysa 84.61
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 84.49
PRK10246 1047 exonuclease subunit SbcC; Provisional 84.34
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 84.32
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 84.22
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 84.17
PF10186302 Atg14: UV radiation resistance protein and autopha 84.14
PF0891269 Rho_Binding: Rho Binding; InterPro: IPR015008 Rho 84.02
KOG0964 1200 consensus Structural maintenance of chromosome pro 84.0
COG4942 420 Membrane-bound metallopeptidase [Cell division and 83.92
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 83.86
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 83.29
PF14817 632 HAUS5: HAUS augmin-like complex subunit 5 83.27
PF09787 511 Golgin_A5: Golgin subfamily A member 5; InterPro: 83.09
PRK15178434 Vi polysaccharide export inner membrane protein Ve 82.98
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 82.94
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 82.67
PF06120 301 Phage_HK97_TLTM: Tail length tape measure protein; 82.67
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 82.57
KOG0971 1243 consensus Microtubule-associated protein dynactin 82.56
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 82.53
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 82.47
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 82.3
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 82.17
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 82.06
PRK01156 895 chromosome segregation protein; Provisional 82.0
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 81.78
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 81.77
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 81.7
PF11221144 Med21: Subunit 21 of Mediator complex; InterPro: I 81.69
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 81.15
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 80.87
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 80.72
KOG1962216 consensus B-cell receptor-associated protein and r 80.6
PF13805271 Pil1: Eisosome component PIL1; PDB: 3PLT_B. 80.48
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 80.4
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 80.29
TIGR02231 525 conserved hypothetical protein. This family consis 80.25
TIGR03794 421 NHPM_micro_HlyD NHPM bacteriocin system secretion 80.01
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information 
Probab=97.79  E-value=0.017  Score=59.31  Aligned_cols=80  Identities=13%  Similarity=0.142  Sum_probs=40.5

Q ss_pred             CCccccccccCCCCCCCCCCCCC-CCchHhHHHHHHhhHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q 025912           18 FTMSGRRVLREPPLSTRALPPQH-SPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASV   96 (246)
Q Consensus        18 ~~~~~r~~~~~~~~~~~~~p~p~-~p~~~~LEe~La~Q~~EiqrLl~dNqRLAatHvaLrQeL~aaq~El~~l~~~i~~i   96 (246)
                      -|.+|=.+.+.|.++.|....+. .........+|.....++..|-.+-..+-.....+.+++...+.++..+...+..+
T Consensus       642 vTldG~~~~~~G~~tgG~~~~~~~~~~~~~~~~~l~~l~~~l~~l~~~l~~l~~~~~~~~~~l~~l~~~~~~~~~~~~~l  721 (1164)
T TIGR02169       642 VTLEGELFEKSGAMTGGSRAPRGGILFSRSEPAELQRLRERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEI  721 (1164)
T ss_pred             EEeCceeEcCCcCccCCCCCCCCCcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45666666666666655421110 00000113455555566666665555555555555666655555555554444444


Q ss_pred             h
Q 025912           97 K   97 (246)
Q Consensus        97 ~   97 (246)
                      +
T Consensus       722 ~  722 (1164)
T TIGR02169       722 E  722 (1164)
T ss_pred             H
Confidence            3

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK11546 zraP zinc resistance protein; Provisional Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF12592 DUF3763: Protein of unknown function (DUF3763); InterPro: IPR022547 This domain is found in bacterial regulartory ATPases 3 Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF07794 DUF1633: Protein of unknown function (DUF1633); InterPro: IPR012436 This family contains sequences derived from a group of hypothetical proteins expressed by Arabidopsis thaliana (Mouse-ear cress) Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF08912 Rho_Binding: Rho Binding; InterPro: IPR015008 Rho is responsible for the recognition and binding of Rho binding domain-containing proteins (such as ROCK) to Rho, resulting in activation of the GTPase which in turn modulates the phosphorylation of various signalling proteins Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF14817 HAUS5: HAUS augmin-like complex subunit 5 Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF11221 Med21: Subunit 21 of Mediator complex; InterPro: IPR021384 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-09
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 9e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-07
1qzv_F 154 Plant photosystem I: subunit PSAF; photosynthesis, 5e-05
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 56.4 bits (136), Expect = 2e-09
 Identities = 34/186 (18%), Positives = 72/186 (38%), Gaps = 6/186 (3%)

Query: 47   LEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRE 106
            +ED I I       L ++ + L      L   L+  E++ ++L+ +    ++    E+  
Sbjct: 988  MEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMIS-ELEV 1046

Query: 107  LYEKSLKLDAEL-RVIESMHAELDRVRADIEKLCVIKQEMIKDL----NEINGDLAKARD 161
              +K  K   EL ++   +  E   +   I +L     E+   L     E+   LA+  D
Sbjct: 1047 RLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLED 1106

Query: 162  ESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIMEKNIISVAQQIERLQAE 221
            E+        +I      I   +  +E EK  R    +Q+  + + + ++  ++E     
Sbjct: 1107 ETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDT 1166

Query: 222  LANAEK 227
             A  ++
Sbjct: 1167 TATQQE 1172
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.33
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 96.51
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 96.34
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.3
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 96.3
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.79
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.74
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.7
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.59
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 94.27
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 93.83
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 93.07
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 92.39
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.03
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 91.96
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 91.06
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 90.64
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 90.38
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 88.76
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 88.65
1ykh_B132 RNA polymerase II holoenzyme component SRB7; gene 88.35
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 88.07
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 88.06
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 87.77
2v4h_A110 NF-kappa-B essential modulator; transcription, met 87.65
1yke_B151 RNA polymerase II holoenzyme component SRB7; gene 87.59
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 87.04
3lay_A175 Zinc resistance-associated protein; salmonella typ 86.01
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 85.77
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 85.33
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 83.95
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 82.59
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 82.46
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 82.28
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 82.1
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 81.9
4e61_A106 Protein BIM1; EB1-like motif, coiled-coil, spindle 81.11
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 81.02
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 80.99
3bas_A89 Myosin heavy chain, striated muscle/general contro 80.91
4fla_A152 Regulation of nuclear PRE-mRNA domain-containing 1 80.73
1jcd_A52 Major outer membrane lipoprotein; protein folding, 80.03
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=97.33  E-value=0.042  Score=44.03  Aligned_cols=7  Identities=14%  Similarity=0.121  Sum_probs=2.5

Q ss_pred             HHHHHHH
Q 025912           55 HSDIQSL   61 (246)
Q Consensus        55 ~~EiqrL   61 (246)
                      ..+|..+
T Consensus        12 ~~~~~~~   18 (284)
T 1c1g_A           12 KLDKENA   18 (284)
T ss_dssp             HHHHHHH
T ss_pred             HHhHHHH
Confidence            3333333
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>1ykh_B RNA polymerase II holoenzyme component SRB7; gene regulation; 3.00A {Saccharomyces cerevisiae} SCOP: a.252.1.1 Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>1yke_B RNA polymerase II holoenzyme component SRB7; gene regulation; 3.30A {Saccharomyces cerevisiae} SCOP: a.252.1.1 Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>4e61_A Protein BIM1; EB1-like motif, coiled-coil, spindle orientation, mitosis, K phosphorylation, mitotic spindle, microtubules, cell cycle; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00