Citrus Sinensis ID: 025927

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MSTGSLCSSTTQINGFTGGFMLQKTNLNQPSSLSFTRRRIQTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVPNI
cccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHccccccccccEEEcHHHHHHHHcHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHcccccccccEEEccccccccHHHHHHccccEEEEccccccccccHHHHHHHHHccccEEEEEcccccHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccc
ccccHccccccEEccccccccHHHHccccccEEEEcccccEEEEccccHHHHccccccEEccEHHHccHHHHHHHHHHHHHcccccEEEEEEEccccccEcccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEEcccccHHHHccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHcc
mstgslcssttqingftggfmlqktnlnqpsslsfTRRRIQTIVKASArvdkfsksdiivspsiLSANFAKLGEQVKAVELagcdwihvdvmdgrfvpnitigplvvdalrpvtdlpldvhlmivepeqrvpdfIKAGADIVSVHCEQSSTIHLHRTLNQIKDLgakagvvlnpatslsaIECVLDVVDLVLIMsvnpgfggqsfIESQVKKISDLRRMCLekgvnpwievdggvgpknaykvpni
mstgslcsstTQINGFTGGFMLQKTNlnqpsslsftRRRIQTIVkasarvdkfsksdiivspsILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVnpgfggqsfIESQVKKISDLRRMCLEKgvnpwievdggvgpknaykvpni
MSTGSLCSSTTQINGFTGGFMLQKTNLNQPSSLSFTRRRIQTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVPNI
************INGFTGGFMLQKT*******LSFTRRRIQTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVG**********
**************GFTGG****************************************VSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVPNI
*********TTQINGFTGGFMLQKTNLNQPSSLSFTRRRIQTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVPNI
**********TQINGFTGGFMLQKTNLNQPSSLSFTRRRIQTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVPNI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTGSLCSSTTQINGFTGGFMLQKTNLNQPSSLSFTRRRIQTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVPNI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query246 2.2.26 [Sep-21-2011]
Q43157285 Ribulose-phosphate 3-epim N/A no 0.987 0.852 0.850 1e-119
Q43843280 Ribulose-phosphate 3-epim N/A no 0.971 0.853 0.842 1e-117
Q9ZTP5274 Ribulose-phosphate 3-epim yes no 0.857 0.770 0.890 1e-107
P74061230 Ribulose-phosphate 3-epim N/A no 0.760 0.813 0.679 6e-72
O34557217 Ribulose-phosphate 3-epim yes no 0.735 0.834 0.630 2e-58
P40117241 Ribulose-phosphate 3-epim yes no 0.747 0.763 0.510 3e-47
Q04539241 Ribulose-phosphate 3-epim no no 0.764 0.780 0.494 7e-47
O67098222 Ribulose-phosphate 3-epim yes no 0.735 0.815 0.491 2e-45
Q8K940228 Ribulose-phosphate 3-epim yes no 0.747 0.807 0.481 3e-45
P0AG10225 Ribulose-phosphate 3-epim yes no 0.727 0.795 0.505 5e-45
>sp|Q43157|RPE_SPIOL Ribulose-phosphate 3-epimerase, chloroplastic OS=Spinacia oleracea GN=RPE PE=1 SV=1 Back     alignment and function desciption
 Score =  427 bits (1097), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/247 (85%), Positives = 226/247 (91%), Gaps = 4/247 (1%)

Query: 1   MSTGSLCSST--TQINGFTGGFMLQKT--NLNQPSSLSFTRRRIQTIVKASARVDKFSKS 56
           MS  SLC ST  +QINGF GG  ++K   + + P+SL+FTRR++QT+VKA++RVDKFSKS
Sbjct: 1   MSAASLCQSTLQSQINGFCGGLNIRKLQPSTSSPNSLTFTRRKVQTLVKATSRVDKFSKS 60

Query: 57  DIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDL 116
           DIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDL
Sbjct: 61  DIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDL 120

Query: 117 PLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPAT 176
           PLDVHLMIVEPEQRVPDFIKAGADIVSVHCE +STIHLHRT+NQIK LGAKAGVVLNP T
Sbjct: 121 PLDVHLMIVEPEQRVPDFIKAGADIVSVHCELASTIHLHRTVNQIKSLGAKAGVVLNPGT 180

Query: 177 SLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVG 236
            LS IE VLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLR+MC+EKGVNPWIEVDGGV 
Sbjct: 181 PLSTIEYVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRKMCVEKGVNPWIEVDGGVT 240

Query: 237 PKNAYKV 243
           P NAYKV
Sbjct: 241 PANAYKV 247
Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.
Spinacia oleracea (taxid: 3562)
EC: 5EC: .EC: 1EC: .EC: 3EC: .EC: 1
>sp|Q43843|RPE_SOLTU Ribulose-phosphate 3-epimerase, chloroplastic (Fragment) OS=Solanum tuberosum PE=1 SV=1 Back     alignment and function description
>sp|Q9ZTP5|RPE_ORYSJ Ribulose-phosphate 3-epimerase, chloroplastic OS=Oryza sativa subsp. japonica GN=RPE PE=1 SV=2 Back     alignment and function description
>sp|P74061|RPE_SYNY3 Ribulose-phosphate 3-epimerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpe PE=1 SV=3 Back     alignment and function description
>sp|O34557|RPE_BACSU Ribulose-phosphate 3-epimerase OS=Bacillus subtilis (strain 168) GN=rpe PE=3 SV=1 Back     alignment and function description
>sp|P40117|RPEC_CUPNH Ribulose-phosphate 3-epimerase, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEC PE=3 SV=1 Back     alignment and function description
>sp|Q04539|RPEP_CUPNH Ribulose-phosphate 3-epimerase, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEP PE=3 SV=1 Back     alignment and function description
>sp|O67098|RPE_AQUAE Ribulose-phosphate 3-epimerase OS=Aquifex aeolicus (strain VF5) GN=rpe PE=3 SV=1 Back     alignment and function description
>sp|Q8K940|RPE_BUCAP Ribulose-phosphate 3-epimerase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpe PE=3 SV=1 Back     alignment and function description
>sp|P0AG10|RPE_SHIFL Ribulose-phosphate 3-epimerase OS=Shigella flexneri GN=rpe PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
449439289283 PREDICTED: ribulose-phosphate 3-epimeras 0.987 0.858 0.869 1e-120
356511994280 PREDICTED: ribulose-phosphate 3-epimeras 0.967 0.85 0.872 1e-118
224124194286 predicted protein [Populus trichocarpa] 0.979 0.842 0.864 1e-118
225457361282 PREDICTED: ribulose-phosphate 3-epimeras 0.983 0.858 0.865 1e-117
2833386285 RecName: Full=Ribulose-phosphate 3-epime 0.987 0.852 0.850 1e-117
297733953290 unnamed protein product [Vitis vinifera] 0.983 0.834 0.865 1e-117
15240250281 D-ribulose-5-phosphate-3-epimerase [Arab 0.975 0.854 0.859 1e-117
3264790285 ribulose-phosphate 3-epimerase transit f 0.987 0.852 0.846 1e-117
147817756312 hypothetical protein VITISV_031724 [Viti 0.983 0.775 0.865 1e-116
297797095281 hypothetical protein ARALYDRAFT_919384 [ 0.975 0.854 0.863 1e-116
>gi|449439289|ref|XP_004137418.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Cucumis sativus] gi|449486996|ref|XP_004157465.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 213/245 (86%), Positives = 225/245 (91%), Gaps = 2/245 (0%)

Query: 1   MSTGSLCSST--TQINGFTGGFMLQKTNLNQPSSLSFTRRRIQTIVKASARVDKFSKSDI 58
           M+  SLC ST  +Q++GF GG   QK   +QPSSL+ +RRR + +VKASARVDKFSKSDI
Sbjct: 1   MAVASLCQSTMKSQVSGFIGGLTFQKPPNSQPSSLTVSRRRFRNVVKASARVDKFSKSDI 60

Query: 59  IVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPL 118
           IVSPSILSANF+KLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPL
Sbjct: 61  IVSPSILSANFSKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPL 120

Query: 119 DVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSL 178
           DVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRT+NQIK LGAKAGVVLNPATSL
Sbjct: 121 DVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTVNQIKSLGAKAGVVLNPATSL 180

Query: 179 SAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPK 238
           S IE VLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRR+C EKGVNPWIEVDGGVGP 
Sbjct: 181 STIEYVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRLCAEKGVNPWIEVDGGVGPA 240

Query: 239 NAYKV 243
           NAYKV
Sbjct: 241 NAYKV 245

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356511994|ref|XP_003524706.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224124194|ref|XP_002330128.1| predicted protein [Populus trichocarpa] gi|222871262|gb|EEF08393.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225457361|ref|XP_002284772.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|2833386|sp|Q43157.1|RPE_SPIOL RecName: Full=Ribulose-phosphate 3-epimerase, chloroplastic; AltName: Full=Pentose-5-phosphate 3-epimerase; Short=PPE; AltName: Full=R5P3E; Short=RPE; Flags: Precursor gi|1162980|gb|AAC41677.1| ribulose-5-phosphate 3-epimerase [Spinacia oleracea] gi|3264788|gb|AAC24708.1| ribulose-phosphate 3-epimerase [Spinacia oleracea] gi|1587969|prf||2207382A D-ribulose-5-phosphate 3-epimerase Back     alignment and taxonomy information
>gi|297733953|emb|CBI15200.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15240250|ref|NP_200949.1| D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|30697525|ref|NP_851240.1| D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|4102703|gb|AAD09954.1| ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|9757862|dbj|BAB08496.1| ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|15027997|gb|AAK76529.1| putative ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|20259209|gb|AAM14320.1| putative ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|332010080|gb|AED97463.1| D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|332010081|gb|AED97464.1| D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3264790|gb|AAC24709.1| ribulose-phosphate 3-epimerase transit form [Expression vector pFL505] Back     alignment and taxonomy information
>gi|147817756|emb|CAN66664.1| hypothetical protein VITISV_031724 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297797095|ref|XP_002866432.1| hypothetical protein ARALYDRAFT_919384 [Arabidopsis lyrata subsp. lyrata] gi|297312267|gb|EFH42691.1| hypothetical protein ARALYDRAFT_919384 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
UNIPROTKB|Q43157285 RPE "Ribulose-phosphate 3-epim 0.987 0.852 0.850 2.1e-107
TAIR|locus:2163228281 RPE "D-ribulose-5-phosphate-3- 0.975 0.854 0.859 5.1e-106
UNIPROTKB|Q43843280 Q43843 "Ribulose-phosphate 3-e 0.971 0.853 0.842 2.2e-105
TIGR_CMR|GSU_3374221 GSU_3374 "ribulose-phosphate 3 0.739 0.823 0.603 9.9e-55
TIGR_CMR|BA_3998214 BA_3998 "ribulose-phosphate 3- 0.735 0.845 0.601 4.3e-54
TIGR_CMR|SPO_0779229 SPO_0779 "ribulose-phosphate 3 0.723 0.777 0.491 3.1e-44
TIGR_CMR|ECH_0082228 ECH_0082 "ribulose-phosphate 3 0.776 0.837 0.494 2.2e-43
TIGR_CMR|APH_0002236 APH_0002 "ribulose-phosphate 3 0.747 0.779 0.483 2.8e-43
TIGR_CMR|CHY_1476219 CHY_1476 "ribulose-phosphate 3 0.727 0.817 0.497 3.5e-43
TIGR_CMR|NSE_0336220 NSE_0336 "ribulose-phosphate 3 0.735 0.822 0.480 7.3e-43
UNIPROTKB|Q43157 RPE "Ribulose-phosphate 3-epimerase, chloroplastic" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
 Score = 1062 (378.9 bits), Expect = 2.1e-107, P = 2.1e-107
 Identities = 210/247 (85%), Positives = 226/247 (91%)

Query:     1 MSTGSLCSST--TQINGFTGGFMLQKT--NLNQPSSLSFTRRRIQTIVKASARVDKFSKS 56
             MS  SLC ST  +QINGF GG  ++K   + + P+SL+FTRR++QT+VKA++RVDKFSKS
Sbjct:     1 MSAASLCQSTLQSQINGFCGGLNIRKLQPSTSSPNSLTFTRRKVQTLVKATSRVDKFSKS 60

Query:    57 DIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDL 116
             DIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDL
Sbjct:    61 DIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDL 120

Query:   117 PLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPAT 176
             PLDVHLMIVEPEQRVPDFIKAGADIVSVHCE +STIHLHRT+NQIK LGAKAGVVLNP T
Sbjct:   121 PLDVHLMIVEPEQRVPDFIKAGADIVSVHCELASTIHLHRTVNQIKSLGAKAGVVLNPGT 180

Query:   177 SLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVG 236
              LS IE VLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLR+MC+EKGVNPWIEVDGGV 
Sbjct:   181 PLSTIEYVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRKMCVEKGVNPWIEVDGGVT 240

Query:   237 PKNAYKV 243
             P NAYKV
Sbjct:   241 PANAYKV 247
GO:0004750 "ribulose-phosphate 3-epimerase activity" evidence=IDA
GO:0006098 "pentose-phosphate shunt" evidence=NAS
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0019253 "reductive pentose-phosphate cycle" evidence=NAS
TAIR|locus:2163228 RPE "D-ribulose-5-phosphate-3-epimerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q43843 Q43843 "Ribulose-phosphate 3-epimerase, chloroplastic" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3374 GSU_3374 "ribulose-phosphate 3-epimerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3998 BA_3998 "ribulose-phosphate 3-epimerase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0779 SPO_0779 "ribulose-phosphate 3-epimerase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0082 ECH_0082 "ribulose-phosphate 3-epimerase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0002 APH_0002 "ribulose-phosphate 3-epimerase" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1476 CHY_1476 "ribulose-phosphate 3-epimerase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0336 NSE_0336 "ribulose-phosphate 3-epimerase" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P44756RPE_HAEIN5, ., 1, ., 3, ., 10.50540.72760.7991yesno
P0AG08RPE_ECOL65, ., 1, ., 3, ., 10.50540.72760.7955yesno
O34557RPE_BACSU5, ., 1, ., 3, ., 10.63040.73570.8341yesno
P40117RPEC_CUPNH5, ., 1, ., 3, ., 10.51050.74790.7634yesno
P0AG10RPE_SHIFL5, ., 1, ., 3, ., 10.50540.72760.7955yesno
Q43157RPE_SPIOL5, ., 1, ., 3, ., 10.85020.98780.8526N/Ano
Q43843RPE_SOLTU5, ., 1, ., 3, ., 10.84290.97150.8535N/Ano
Q9ZTP5RPE_ORYSJ5, ., 1, ., 3, ., 10.89090.85770.7700yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.1.3.10.979
3rd Layer5.1.30.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
PLN02334229 PLN02334, PLN02334, ribulose-phosphate 3-epimerase 1e-120
PRK05581220 PRK05581, PRK05581, ribulose-phosphate 3-epimerase 1e-110
cd00429211 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RP 1e-108
pfam00834201 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 ep 1e-103
COG0036220 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Car 1e-100
TIGR01163210 TIGR01163, rpe, ribulose-phosphate 3-epimerase 8e-99
PRK08745223 PRK08745, PRK08745, ribulose-phosphate 3-epimerase 2e-61
PTZ00170228 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epime 6e-59
PRK09722229 PRK09722, PRK09722, allulose-6-phosphate 3-epimera 1e-58
PRK08883220 PRK08883, PRK08883, ribulose-phosphate 3-epimerase 5e-58
PRK08005210 PRK08005, PRK08005, epimerase; Validated 1e-23
PRK08091228 PRK08091, PRK08091, ribulose-phosphate 3-epimerase 1e-16
PRK14057254 PRK14057, PRK14057, epimerase; Provisional 2e-16
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 2e-15
>gnl|CDD|215192 PLN02334, PLN02334, ribulose-phosphate 3-epimerase Back     alignment and domain information 
 Score =  341 bits (878), Expect = e-120
 Identities = 119/195 (61%), Positives = 139/195 (71%), Gaps = 6/195 (3%)

Query: 51  DKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDAL 110
           DKFSK+D I++PSILSA+FA L E+ K V  AG DW+HVDVMDG FVPN+TIGP VV AL
Sbjct: 1   DKFSKNDAIIAPSILSADFANLAEEAKRVLDAGADWLHVDVMDGHFVPNLTIGPPVVKAL 60

Query: 111 RPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGV 170
           R  TD PLD HLM+  PE  VPDF KAGA I + H EQ+STIHLHR + QIK  G KAGV
Sbjct: 61  RKHTDAPLDCHLMVTNPEDYVPDFAKAGASIFTFHIEQASTIHLHRLIQQIKSAGMKAGV 120

Query: 171 VLNPATSLSAIECVLDV--VDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPW 228
           VLNP T + A+E V++   VD+VL+MSV PGFGGQSFI S + K+  LR+   E      
Sbjct: 121 VLNPGTPVEAVEPVVEKGLVDMVLVMSVEPGFGGQSFIPSMMDKVRALRKKYPEL----D 176

Query: 229 IEVDGGVGPKNAYKV 243
           IEVDGGVGP    K 
Sbjct: 177 IEVDGGVGPSTIDKA 191

Length = 229
>gnl|CDD|235515 PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>gnl|CDD|238244 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>gnl|CDD|216142 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 epimerase family Back     alignment and domain information
>gnl|CDD|223114 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130231 TIGR01163, rpe, ribulose-phosphate 3-epimerase Back     alignment and domain information
>gnl|CDD|136958 PRK08745, PRK08745, ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|240303 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|236616 PRK09722, PRK09722, allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|181575 PRK08883, PRK08883, ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|169179 PRK08005, PRK08005, epimerase; Validated Back     alignment and domain information
>gnl|CDD|169215 PRK08091, PRK08091, ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>gnl|CDD|172549 PRK14057, PRK14057, epimerase; Provisional Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 246
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 100.0
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 100.0
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 100.0
PRK08091228 ribulose-phosphate 3-epimerase; Validated 100.0
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 100.0
PRK08005210 epimerase; Validated 100.0
PRK14057254 epimerase; Provisional 100.0
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 100.0
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 100.0
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 100.0
PLN02334229 ribulose-phosphate 3-epimerase 100.0
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 100.0
PRK05581220 ribulose-phosphate 3-epimerase; Validated 100.0
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 100.0
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 99.97
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 99.92
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 99.91
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 99.89
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 99.89
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 99.87
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 99.85
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 99.84
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 99.78
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 99.73
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 99.68
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 99.55
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 99.52
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.36
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 98.68
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 98.31
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 98.09
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 97.91
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 97.9
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.9
PLN02591250 tryptophan synthase 97.88
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.84
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.82
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 97.78
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 97.67
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 97.47
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 97.4
PF00697197 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isome 97.34
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.26
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.18
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 97.17
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 97.16
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.16
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 97.11
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 96.98
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.96
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 96.88
TIGR03151 307 enACPred_II putative enoyl-(acyl-carrier-protein) 96.85
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 96.82
PRK07094323 biotin synthase; Provisional 96.76
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 96.75
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 96.58
PRK06256336 biotin synthase; Validated 96.56
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 96.39
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 96.3
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 96.3
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 96.28
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.26
PRK11572248 copper homeostasis protein CutC; Provisional 96.25
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 96.25
PRK07695201 transcriptional regulator TenI; Provisional 96.22
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 96.22
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 96.21
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 96.21
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 96.04
PRK14024241 phosphoribosyl isomerase A; Provisional 95.96
TIGR02026497 BchE magnesium-protoporphyrin IX monomethyl ester 95.92
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM 95.88
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.88
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 95.82
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 95.75
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 95.65
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 95.59
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 95.57
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 95.51
PLN02363256 phosphoribosylanthranilate isomerase 95.5
PLN02389379 biotin synthase 95.48
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 95.43
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 95.38
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 95.36
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 95.24
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 95.15
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 95.1
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 95.05
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 95.02
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 94.91
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 94.88
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 94.84
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 94.84
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 94.82
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 94.77
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.71
PRK08508279 biotin synthase; Provisional 94.62
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 94.61
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 94.58
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 94.56
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 94.5
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 94.46
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 94.36
TIGR01579414 MiaB-like-C MiaB-like tRNA modifying enzyme. This 94.35
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 94.31
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 94.3
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 94.22
PLN02428349 lipoic acid synthase 94.21
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 94.06
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 93.92
PF04055166 Radical_SAM: Radical SAM superfamily; InterPro: IP 93.9
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 93.87
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 93.82
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.78
cd00019279 AP2Ec AP endonuclease family 2; These endonuclease 93.69
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.58
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 93.56
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 93.46
PRK12928290 lipoyl synthase; Provisional 93.41
PF03740239 PdxJ: Pyridoxal phosphate biosynthesis protein Pdx 93.23
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 93.21
PRK08446 350 coproporphyrinogen III oxidase; Provisional 92.99
PRK05628 375 coproporphyrinogen III oxidase; Validated 92.94
PRK09121339 5-methyltetrahydropteroyltriglutamate--homocystein 92.93
PRK05904 353 coproporphyrinogen III oxidase; Provisional 92.78
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 92.76
COG2108 353 Uncharacterized conserved protein related to pyruv 92.6
PRK14331437 (dimethylallyl)adenosine tRNA methylthiotransferas 92.6
PRK06096284 molybdenum transport protein ModD; Provisional 92.52
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 92.51
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 92.48
PRK08208 430 coproporphyrinogen III oxidase; Validated 92.36
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 92.33
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 92.31
PRK15108345 biotin synthase; Provisional 92.28
COG3142241 CutC Uncharacterized protein involved in copper re 92.27
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 92.18
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 92.16
PRK08195 337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 92.15
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM 92.02
smart00518273 AP2Ec AP endonuclease family 2. These endonuclease 92.02
PRK14340445 (dimethylallyl)adenosine tRNA methylthiotransferas 91.97
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 91.94
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 91.85
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 91.73
PRK07379 400 coproporphyrinogen III oxidase; Provisional 91.65
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 91.63
PRK04302223 triosephosphate isomerase; Provisional 91.48
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 91.36
smart00812 384 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro 91.27
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 91.13
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 91.12
TIGR00089429 RNA modification enzyme, MiaB family. This subfami 91.1
PF01136233 Peptidase_U32: Peptidase family U32 This is family 90.97
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 90.94
TIGR00510302 lipA lipoate synthase. The family shows strong seq 90.89
TIGR01334277 modD putative molybdenum utilization protein ModD. 90.74
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 90.7
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 90.67
TIGR02668302 moaA_archaeal probable molybdenum cofactor biosynt 90.67
PRK08599 377 coproporphyrinogen III oxidase; Provisional 90.66
PLN02617538 imidazole glycerol phosphate synthase hisHF 90.66
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 90.64
TIGR03217 333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 90.61
TIGR00538 455 hemN oxygen-independent coproporphyrinogen III oxi 90.52
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 90.49
PRK13347 453 coproporphyrinogen III oxidase; Provisional 90.36
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 90.27
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 90.22
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 90.11
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 90.01
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 89.76
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 89.63
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 89.52
cd03310321 CIMS_like CIMS - Cobalamine-independent methonine 89.29
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 89.27
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 89.26
TIGR00284 499 dihydropteroate synthase-related protein. This pro 89.2
PRK14336418 (dimethylallyl)adenosine tRNA methylthiotransferas 89.14
PRK06267350 hypothetical protein; Provisional 89.06
PRK14325444 (dimethylallyl)adenosine tRNA methylthiotransferas 89.0
cd00465306 URO-D_CIMS_like The URO-D_CIMS_like protein superf 88.92
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 88.85
PRK14333448 (dimethylallyl)adenosine tRNA methylthiotransferas 88.84
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 88.8
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 88.79
TIGR00539 360 hemN_rel putative oxygen-independent coproporphyri 88.75
PF03328221 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family 88.67
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 88.61
PRK04326330 methionine synthase; Provisional 88.6
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 88.57
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 88.55
PRK09249 453 coproporphyrinogen III oxidase; Provisional 88.53
PRK14335455 (dimethylallyl)adenosine tRNA methylthiotransferas 88.49
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 88.48
PRK06052344 5-methyltetrahydropteroyltriglutamate--homocystein 88.18
cd03311332 CIMS_C_terminal_like CIMS - Cobalamine-independent 88.14
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 88.14
TIGR02666334 moaA molybdenum cofactor biosynthesis protein A, b 88.08
PRK00366 360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 88.07
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 87.99
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.95
PRK08999312 hypothetical protein; Provisional 87.95
PRK06233372 hypothetical protein; Provisional 87.79
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 87.79
PRK06520368 5-methyltetrahydropteroyltriglutamate--homocystein 87.71
PTZ00413398 lipoate synthase; Provisional 87.7
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 87.64
PRK05660 378 HemN family oxidoreductase; Provisional 87.52
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 87.5
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 87.41
TIGR02351366 thiH thiazole biosynthesis protein ThiH. Members t 87.36
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 87.36
TIGR01574438 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3 87.35
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 87.24
PRK14327509 (dimethylallyl)adenosine tRNA methylthiotransferas 87.17
PF03060 330 NMO: Nitronate monooxygenase; InterPro: IPR004136 87.12
PLN02460338 indole-3-glycerol-phosphate synthase 87.05
TIGR00612 346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 86.96
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 86.9
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of th 86.87
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 86.83
PLN02475766 5-methyltetrahydropteroyltriglutamate--homocystein 86.78
TIGR01211 522 ELP3 histone acetyltransferase, ELP3 family. The S 86.73
PLN02334229 ribulose-phosphate 3-epimerase 86.68
PRK14337446 (dimethylallyl)adenosine tRNA methylthiotransferas 86.65
PRK08207488 coproporphyrinogen III oxidase; Provisional 86.57
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 86.52
PRK12677 384 xylose isomerase; Provisional 86.52
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 86.5
cd08562229 GDPD_EcUgpQ_like Glycerophosphodiester phosphodies 86.29
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 86.25
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 86.25
TIGR01125430 MiaB-like tRNA modifying enzyme YliG, TIGR01125. T 86.25
cd04743 320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 86.17
COG0620330 MetE Methionine synthase II (cobalamin-independent 86.17
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 86.13
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 85.98
TIGR03700351 mena_SCO4494 putative menaquinone biosynthesis pro 85.75
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 85.55
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 85.48
COG1856275 Uncharacterized homolog of biotin synthetase [Func 85.2
PRK09057 380 coproporphyrinogen III oxidase; Provisional 84.96
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 84.95
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 84.94
PRK01207343 methionine synthase; Provisional 84.93
PRK14328439 (dimethylallyl)adenosine tRNA methylthiotransferas 84.76
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 84.72
PRK05799 374 coproporphyrinogen III oxidase; Provisional 84.72
cd07944 266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 84.69
PRK00957305 methionine synthase; Provisional 84.6
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 84.41
TIGR01305 343 GMP_reduct_1 guanosine monophosphate reductase, eu 84.37
PRK06806281 fructose-bisphosphate aldolase; Provisional 84.35
cd07948 262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 84.2
PRK09016296 quinolinate phosphoribosyltransferase; Validated 84.03
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 83.89
PLN02274 505 inosine-5'-monophosphate dehydrogenase 83.87
PRK14040 593 oxaloacetate decarboxylase; Provisional 83.76
PRK05222758 5-methyltetrahydropteroyltriglutamate--homocystein 83.75
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 83.7
TIGR01210313 conserved hypothetical protein TIGR01210. This fam 83.66
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 83.6
PRK05458 326 guanosine 5'-monophosphate oxidoreductase; Provisi 83.51
PRK14041 467 oxaloacetate decarboxylase; Provisional 83.46
TIGR01093228 aroD 3-dehydroquinate dehydratase, type I. Type II 83.45
TIGR02109 358 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. 83.44
TIGR00676272 fadh2 5,10-methylenetetrahydrofolate reductase, pr 83.4
PF01645368 Glu_synthase: Conserved region in glutamate syntha 83.39
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 83.32
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 83.02
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 82.8
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 82.74
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 82.56
TIGR01496257 DHPS dihydropteroate synthase. This model represen 82.46
cd08207406 RLP_NonPhot Ribulose bisphosphate carboxylase like 82.39
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 82.15
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 82.13
PRK13305218 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; 81.9
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 81.9
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 81.8
PRK14332449 (dimethylallyl)adenosine tRNA methylthiotransferas 81.71
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 81.69
PRK14330434 (dimethylallyl)adenosine tRNA methylthiotransferas 81.47
cd08208424 RLP_Photo Ribulose bisphosphate carboxylase like p 81.46
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 81.38
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 81.36
PRK06294 370 coproporphyrinogen III oxidase; Provisional 81.3
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 81.26
PRK01060281 endonuclease IV; Provisional 81.06
PF05853272 DUF849: Prokaryotic protein of unknown function (D 80.6
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 80.55
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 80.54
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 80.53
PRK14334440 (dimethylallyl)adenosine tRNA methylthiotransferas 80.26
PRK05481289 lipoyl synthase; Provisional 80.22
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 80.18
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 80.13
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3e-74  Score=506.15  Aligned_cols=187  Identities=59%  Similarity=0.925  Sum_probs=182.4

Q ss_pred             CCcEEeeeecccChhhHHHHHHHHHHcCCCEEEeeeccCcccCCCCCCHHHHhhcccCCCCCeeEEEeccCcccchHHHH
Q 025927           56 SDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFI  135 (246)
Q Consensus        56 ~~~~IsPSIl~aD~~~l~~~i~~l~~~g~d~lHiDIMDG~FVpN~tfgp~~I~~ir~~t~~plDvHLMV~~P~~~i~~~~  135 (246)
                      .+.+|+||||++|+++|++|+++++++|+||+|+||||||||||+||||+++++||+.|++|+||||||++|++|++.|+
T Consensus         2 ~~~~iapSILsaD~~~l~~el~~~~~agad~iH~DVMDghFVPNiTfGp~~v~~l~~~t~~p~DvHLMV~~p~~~i~~fa   81 (220)
T COG0036           2 KMMKIAPSILSADFARLGEELKALEAAGADLIHIDVMDGHFVPNITFGPPVVKALRKITDLPLDVHLMVENPDRYIEAFA   81 (220)
T ss_pred             CCceeeeehhhCCHhHHHHHHHHHHHcCCCEEEEeccCCCcCCCcccCHHHHHHHhhcCCCceEEEEecCCHHHHHHHHH
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCEEEEccCCcccccHHHHHHHHHHcCCcEEEEEcCCCChHHHHHhhhhcceEEEEeecCCCCCCcccHHHHHHHHH
Q 025927          136 KAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISD  215 (246)
Q Consensus       136 ~agad~It~H~E~~~~~~~~~~i~~Ik~~G~k~GlAlnP~Tpve~l~~~l~~vD~VLvMsV~PGfgGQ~F~~~~l~KI~~  215 (246)
                      ++|||+||||+|+  +.++.|+|++||+.|+|+||+|||+||++.+++||+++|+||+|||+||||||+|+|++++||++
T Consensus        82 ~agad~It~H~E~--~~~~~r~i~~Ik~~G~kaGv~lnP~Tp~~~i~~~l~~vD~VllMsVnPGfgGQ~Fi~~~l~Ki~~  159 (220)
T COG0036          82 KAGADIITFHAEA--TEHIHRTIQLIKELGVKAGLVLNPATPLEALEPVLDDVDLVLLMSVNPGFGGQKFIPEVLEKIRE  159 (220)
T ss_pred             HhCCCEEEEEecc--CcCHHHHHHHHHHcCCeEEEEECCCCCHHHHHHHHhhCCEEEEEeECCCCcccccCHHHHHHHHH
Confidence            9999999999995  68999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCeEEEeCCCChhhhhhccc
Q 025927          216 LRRMCLEKGVNPWIEVDGGVGPKNAYKVPN  245 (246)
Q Consensus       216 lr~l~~~~~~~~~I~VDGGI~~e~i~~l~~  245 (246)
                      +|+++++++ ++.||||||||.+|++++.+
T Consensus       160 lr~~~~~~~-~~~IeVDGGI~~~t~~~~~~  188 (220)
T COG0036         160 LRAMIDERL-DILIEVDGGINLETIKQLAA  188 (220)
T ss_pred             HHHHhcccC-CeEEEEeCCcCHHHHHHHHH
Confidence            999999877 89999999999999999864

>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00697 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isomerase; InterPro: IPR001240 Indole-3-glycerol phosphate synthase (IGPS) (see IPR001468 from INTERPRO) catalyzes the fourth step in the biosynthesis of tryptophan, the ring closure of 1-(2-carboxy-phenylamino)-1-deoxyribulose into indol-3-glycerol-phosphate Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PLN02363 phosphoribosylanthranilate isomerase Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK09121 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Provisional Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>smart00518 AP2Ec AP endonuclease family 2 Back     alignment and domain information
>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>smart00812 Alpha_L_fucos Alpha-L-fucosidase Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00089 RNA modification enzyme, MiaB family Back     alignment and domain information
>PF01136 Peptidase_U32: Peptidase family U32 This is family U32 in the peptidase classification Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>TIGR00510 lipA lipoate synthase Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd03310 CIMS_like CIMS - Cobalamine-independent methonine synthase, or MetE Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd00465 URO-D_CIMS_like The URO-D_CIMS_like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases, as well as cobalamine (B12) independent methionine synthases Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PF03328 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family; InterPro: IPR005000 This family includes 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (4 Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK04326 methionine synthase; Provisional Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK06052 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Provisional Back     alignment and domain information
>cd03311 CIMS_C_terminal_like CIMS - Cobalamine-independent methonine synthase, or MetE, C-terminal domain_like Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK06233 hypothetical protein; Provisional Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK06520 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Provisional Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PLN02475 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK12677 xylose isomerase; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd08562 GDPD_EcUgpQ_like Glycerophosphodiester phosphodiesterase domain in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase UgpQ and similar proteins Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125 Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>COG0620 MetE Methionine synthase II (cobalamin-independent) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01207 methionine synthase; Provisional Back     alignment and domain information
>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK00957 methionine synthase; Provisional Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK05222 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>TIGR01210 conserved hypothetical protein TIGR01210 Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01093 aroD 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E Back     alignment and domain information
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd08208 RLP_Photo Ribulose bisphosphate carboxylase like proteins from phototrophic bacteria Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>PF05853 DUF849: Prokaryotic protein of unknown function (DUF849); InterPro: IPR008567 This family consists of several hypothetical prokaryotic proteins with no known function Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
1rpx_A230 D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tub 1e-103
1tqj_A230 Crystal Structure Of D-Ribulose 5-Phosphate 3-Epime 5e-73
2fli_A220 The Crystal Structure Of D-Ribulose 5-Phosphate 3-E 3e-45
3inp_A246 2.05 Angstrom Resolution Crystal Structure Of D-Rib 9e-39
1h1y_A228 The Structure Of The Cytosolic D-Ribulose-5-Phospha 1e-31
3ct7_A231 Crystal Structure Of D-Allulose 6-Phosphate 3-Epime 6e-31
3ovp_A228 Crystal Structure Of Hrpe Length = 228 6e-30
1tqx_A227 Crystal Structure Of Pfal009167 A Putative D-Ribulo 1e-28
3qc3_A225 Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epi 8e-26
3cu2_A237 Crystal Structure Of Ribulose-5-phosphate 3-epimera 3e-08
>pdb|1RPX|A Chain A, D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tuberosum Chloroplasts Length = 230 Back     alignment and structure 
Iteration: 1

 Score =  371 bits (952), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 189/196 (96%)
Query: 48  ARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVV 107
           +RVDKFSKSDIIVSPSILSANF+KLGEQVKA+E AGCDWIHVDVMDGRFVPNITIGPLVV
Sbjct: 1   SRVDKFSKSDIIVSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVV 60
Query: 108 DALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAK 167
           D+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSSTIHLHRT+NQIK LGAK
Sbjct: 61  DSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIKSLGAK 120
Query: 168 AGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNP 227
           AGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVKKISDLR++C E+G+NP
Sbjct: 121 AGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVKKISDLRKICAERGLNP 180
Query: 228 WIEVDGGVGPKNAYKV 243
           WIEVDGGVGPKNAYKV
Sbjct: 181 WIEVDGGVGPKNAYKV 196
>pdb|1TQJ|A Chain A, Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Synechocystis To 1.6 Angstrom Resolution Length = 230 Back     alignment and structure
>pdb|2FLI|A Chain A, The Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Streptococus Pyogenes Complexed With D-Xylitol 5- Phosphate Length = 220 Back     alignment and structure
>pdb|3INP|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of D-Ribulose-Phosphate 3- Epimerase From Francisella Tularensis Length = 246 Back     alignment and structure
>pdb|1H1Y|A Chain A, The Structure Of The Cytosolic D-Ribulose-5-Phosphate 3- Epimerase From Rice Complexed With Sulfate Length = 228 Back     alignment and structure
>pdb|3CT7|A Chain A, Crystal Structure Of D-Allulose 6-Phosphate 3-Epimerase From Escherichia Coli K-12 Length = 231 Back     alignment and structure
>pdb|3OVP|A Chain A, Crystal Structure Of Hrpe Length = 228 Back     alignment and structure
>pdb|1TQX|A Chain A, Crystal Structure Of Pfal009167 A Putative D-Ribulose 5-Phosphate 3- Epimerase From P.Falciparum Length = 227 Back     alignment and structure
>pdb|3QC3|A Chain A, Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epimerase (Np_954699) From Homo Sapiens At 2.20 A Resolution Length = 225 Back     alignment and structure
>pdb|3CU2|A Chain A, Crystal Structure Of Ribulose-5-phosphate 3-epimerase (yp_718263.1) From Haemophilus Somnus 129pt At 1.91 A Resolution Length = 237 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 1e-133
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 1e-129
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 1e-121
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 1e-120
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 1e-117
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 1e-111
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 1e-110
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 1e-109
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 1e-102
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 3e-22
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 2e-21
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 4e-21
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 2e-20
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 2e-15
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Length = 230 Back     alignment and structure
 Score =  372 bits (958), Expect = e-133
 Identities = 177/196 (90%), Positives = 189/196 (96%)

Query: 48  ARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVV 107
           +RVDKFSKSDIIVSPSILSANF+KLGEQVKA+E AGCDWIHVDVMDGRFVPNITIGPLVV
Sbjct: 1   SRVDKFSKSDIIVSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVV 60

Query: 108 DALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAK 167
           D+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSSTIHLHRT+NQIK LGAK
Sbjct: 61  DSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIKSLGAK 120

Query: 168 AGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNP 227
           AGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVKKISDLR++C E+G+NP
Sbjct: 121 AGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVKKISDLRKICAERGLNP 180

Query: 228 WIEVDGGVGPKNAYKV 243
           WIEVDGGVGPKNAYKV
Sbjct: 181 WIEVDGGVGPKNAYKV 196
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Length = 230 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Length = 220 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Length = 246 Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Length = 231 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Length = 228 Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Length = 237 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} PDB: 3ovq_A* 3ovr_A* 3qc3_A Length = 228 Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Length = 227 Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} PDB: 3exs_A* 3ext_A Length = 221 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Length = 207 Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Length = 216 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} PDB: 3ieb_A* Length = 218 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} Length = 211 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 100.0
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 100.0
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 100.0
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 100.0
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 100.0
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 100.0
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 100.0
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 100.0
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 100.0
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 100.0
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 99.96
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 99.96
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 99.95
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 99.95
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 99.95
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 99.93
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 99.93
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 99.93
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 99.92
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 99.9
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 99.89
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 99.86
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 99.85
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 99.83
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 99.68
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.66
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 99.66
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.63
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 99.59
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 99.58
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.57
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 99.54
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 99.48
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 99.46
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 99.02
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 98.98
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.98
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.87
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 98.74
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 98.68
3bo9_A 326 Putative nitroalkan dioxygenase; TM0800, structura 98.62
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 98.42
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 98.3
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 98.22
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 98.13
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 98.1
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 97.99
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.98
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 97.98
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.76
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 97.67
3tha_A252 Tryptophan synthase alpha chain; structural genomi 97.64
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.63
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.63
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 97.59
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.59
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.51
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 97.45
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 97.39
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 97.36
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 97.36
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 97.2
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.86
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 96.78
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.72
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 96.69
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 96.68
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 96.58
2nv1_A 305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 96.53
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 96.42
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 96.33
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 96.18
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 96.12
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 96.09
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 95.97
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 95.91
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 95.9
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 95.83
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 95.81
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 95.68
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 95.57
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 95.55
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 95.47
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 95.1
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 94.89
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 94.79
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 94.76
3lmz_A257 Putative sugar isomerase; structural genomics, joi 94.55
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 94.4
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 94.38
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 94.33
2qgq_A304 Protein TM_1862; alpha-beta protein, structural ge 94.14
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 94.1
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 93.95
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 93.88
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 93.81
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 93.8
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 93.76
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 93.7
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 93.59
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 93.56
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 93.55
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 93.4
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 93.39
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 93.37
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 93.27
1viz_A240 PCRB protein homolog; structural genomics, unknown 93.26
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 93.22
2q02_A272 Putative cytoplasmic protein; structural genomics, 93.18
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 93.01
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II a 92.95
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 92.67
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 92.43
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 92.27
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 92.22
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; de 92.13
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 92.01
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l 91.8
2vws_A267 YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escher 91.47
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 91.34
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 91.12
3eyp_A 469 Putative alpha-L-fucosidase; structural genomics, 91.04
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet 90.89
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 90.78
3ues_A 478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 90.54
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 90.31
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 90.25
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 90.06
1yx1_A264 Hypothetical protein PA2260; structural genomics, 89.99
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 89.92
2wvv_A 450 Alpha-L-fucosidase; alpha-L-fucose, hydrolase, gly 89.76
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 89.64
1olt_A 457 Oxygen-independent coproporphyrinogen III oxidase; 89.61
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 89.56
3kws_A287 Putative sugar isomerase; structural genomics, joi 89.32
3cny_A301 Inositol catabolism protein IOLE; xylose isomerase 89.22
3ppg_A789 5-methyltetrahydropteroyltriglutamate--homocystei 89.14
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 89.07
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 89.06
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 88.91
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 88.84
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 88.68
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 88.26
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 88.24
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 88.14
3aam_A270 Endonuclease IV, endoiv; DNA repair, base excision 88.07
1uas_A 362 Alpha-galactosidase; TIM-barrel, beta-alpha-barrel 87.98
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 87.95
2zxd_A 455 Alpha-L-fucosidase, putative; TIM barrel, hydrolas 87.87
3rpd_A357 Methionine synthase (B12-independent); structural 87.68
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 87.48
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 87.29
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 87.28
2q02_A 272 Putative cytoplasmic protein; structural genomics, 87.23
3ayv_A254 Putative uncharacterized protein TTHB071; structur 87.2
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 86.97
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 86.94
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 86.58
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 86.33
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 86.29
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 86.16
3o6c_A260 PNP synthase, pyridoxine 5'-phosphate synthase; st 86.12
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 86.07
3aal_A303 Probable endonuclease 4; endoiv, DNA repair, base 86.02
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 85.82
2xn2_A 732 Alpha-galactosidase; hydrolase, glycosidase; HET: 85.5
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 85.48
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 85.32
1qtw_A285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 85.3
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 85.25
1i60_A 278 IOLI protein; beta barrel, structural genomics, PS 85.05
1i60_A278 IOLI protein; beta barrel, structural genomics, PS 84.95
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 84.92
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 84.45
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 84.3
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 84.28
3qc0_A275 Sugar isomerase; TIM barrel, structural genomics, 84.15
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 84.14
4fnq_A 729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 84.08
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 83.84
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 83.81
3qvq_A252 Phosphodiesterase OLEI02445; structural genomics, 83.46
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 83.38
2c6q_A 351 GMP reductase 2; TIM barrel, metal-binding, NADP, 83.36
3dxi_A 320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 83.21
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 83.2
3lot_A314 Uncharacterized protein; protein of unknown functi 83.19
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 83.14
3apt_A310 Methylenetetrahydrofolate reductase; TIM barrel, o 83.13
3ble_A337 Citramalate synthase from leptospira interrogans; 82.93
3no5_A275 Uncharacterized protein; PFAM DUF849 domain contai 82.74
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 82.52
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 82.48
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 82.44
3chv_A284 Prokaryotic domain of unknown function (DUF849) W 82.2
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 82.11
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 81.77
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 81.65
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 81.53
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 81.51
3e49_A311 Uncharacterized protein DUF849 with A TIM barrel; 81.49
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 81.36
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 80.42
3lot_A 314 Uncharacterized protein; protein of unknown functi 80.3
2otd_A247 Glycerophosphodiester phosphodiesterase; structura 80.3
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
Probab=100.00  E-value=7.3e-64  Score=447.24  Aligned_cols=188  Identities=44%  Similarity=0.719  Sum_probs=180.5

Q ss_pred             CCcEEeeeecccChhhHHHHHHHHHHcCCCEEEeeeccCcccCCCCCCHHHHhhcccCC-CCCeeEEEeccCcccchHHH
Q 025927           56 SDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVT-DLPLDVHLMIVEPEQRVPDF  134 (246)
Q Consensus        56 ~~~~IsPSIl~aD~~~l~~~i~~l~~~g~d~lHiDIMDG~FVpN~tfgp~~I~~ir~~t-~~plDvHLMV~~P~~~i~~~  134 (246)
                      ++++|+|||||+|+.+|++++++++++|+||+|+|||||+||||++|||+++++||+.| ++|+|+|||+.||++|++.|
T Consensus        26 ~~~~i~pSilsaD~~~L~~~i~~l~~~G~d~lHvDVmDg~FVpnit~G~~~v~~lr~~~p~~~ldvHLmv~~p~~~i~~~  105 (246)
T 3inp_A           26 KHIQINPSILSADLARLGDDVKAVLAAGADNIHFDVMDNHYVPNLTFGPMVLKALRDYGITAGMDVHLMVKPVDALIESF  105 (246)
T ss_dssp             -CCEEEEBGGGSCGGGHHHHHHHHHHTTCCCEEEEEEBSSSSSCBCCCHHHHHHHHHHTCCSCEEEEEECSSCHHHHHHH
T ss_pred             cCCeeehhhhcCChhhHHHHHHHHHHcCCCEEEEEecCCCcCcchhcCHHHHHHHHHhCCCCeEEEEEeeCCHHHHHHHH
Confidence            35899999999999999999999999999999999999999999999999999999998 99999999999999999999


Q ss_pred             HhcCCCEEEEccCCcccccHHHHHHHHHHcCCcEEEEEcCCCChHHHHHhhhhcceEEEEeecCCCCCCcccHHHHHHHH
Q 025927          135 IKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKIS  214 (246)
Q Consensus       135 ~~agad~It~H~E~~~~~~~~~~i~~Ik~~G~k~GlAlnP~Tpve~l~~~l~~vD~VLvMsV~PGfgGQ~F~~~~l~KI~  214 (246)
                      +++|||+||||.|+  ..++.++++.||++|+|+|++|||+||++.++++++.+|+|++|||+||||||+|+|++++||+
T Consensus       106 ~~aGAd~itvH~Ea--~~~~~~~i~~ir~~G~k~Gvalnp~Tp~e~l~~~l~~vD~VlvMsV~PGfgGQ~fi~~~l~KI~  183 (246)
T 3inp_A          106 AKAGATSIVFHPEA--SEHIDRSLQLIKSFGIQAGLALNPATGIDCLKYVESNIDRVLIMSVNPGFGGQKFIPAMLDKAK  183 (246)
T ss_dssp             HHHTCSEEEECGGG--CSCHHHHHHHHHTTTSEEEEEECTTCCSGGGTTTGGGCSEEEEECSCTTC--CCCCTTHHHHHH
T ss_pred             HHcCCCEEEEcccc--chhHHHHHHHHHHcCCeEEEEecCCCCHHHHHHHHhcCCEEEEeeecCCCCCcccchHHHHHHH
Confidence            99999999999996  5789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCeEEEeCCCChhhhhhccc
Q 025927          215 DLRRMCLEKGVNPWIEVDGGVGPKNAYKVPN  245 (246)
Q Consensus       215 ~lr~l~~~~~~~~~I~VDGGI~~e~i~~l~~  245 (246)
                      ++|++++++|+++.|+||||||.+|++++++
T Consensus       184 ~lr~~~~~~~~~~~I~VDGGI~~~ti~~~~~  214 (246)
T 3inp_A          184 EISKWISSTDRDILLEIDGGVNPYNIAEIAV  214 (246)
T ss_dssp             HHHHHHHHHTSCCEEEEESSCCTTTHHHHHT
T ss_pred             HHHHHHHhcCCCeeEEEECCcCHHHHHHHHH
Confidence            9999999999999999999999999999875
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A Back     alignment and structure
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} PDB: 2vwt_A Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} SCOP: c.1.15.7 Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2wvv_A Alpha-L-fucosidase; alpha-L-fucose, hydrolase, glycoside hydrolase family 29; 1.73A {Bacteroides thetaiotaomicron} PDB: 2xii_A* 2xib_A* 2wvv_B 2wvt_A* 2wvu_A* 2wvs_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3cny_A Inositol catabolism protein IOLE; xylose isomerase-like TIM barrel, structural genomics, joint for structural genomics, JCSG; 1.85A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ppg_A 5-methyltetrahydropteroyltriglutamate--homocystei methyltransferase; cobalamin-independent, surface entropy reduction; 1.98A {Candida albicans} PDB: 3ppf_A 3pph_A 3ppc_A Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} Back     alignment and structure
>1uas_A Alpha-galactosidase; TIM-barrel, beta-alpha-barrel, greek KEY motif, hydrolase; HET: GLA; 1.50A {Oryza sativa} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>2zxd_A Alpha-L-fucosidase, putative; TIM barrel, hydrolase; HET: ZXD; 2.15A {Thermotoga maritima} PDB: 2zwy_A* 2zx5_A* 2zx6_A* 2zx7_A* 2zwz_A* 2zx9_A* 2zxa_A* 2zxb_A* 2zx8_A* 1hl9_A* 1hl8_A* 1odu_A* 2wsp_A* Back     alignment and structure
>3rpd_A Methionine synthase (B12-independent); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, rossmann fold, Zn, TRA; HET: MSE; 1.50A {Shewanella SP} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3ayv_A Putative uncharacterized protein TTHB071; structural genomics, riken structural genomics/proteomics in RSGI, TIM barrel, unknown function; 1.85A {Thermus thermophilus} PDB: 3ayt_A Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>3o6c_A PNP synthase, pyridoxine 5'-phosphate synthase; structural genomics, IDP90671, center for structural genomic infectious diseases; HET: MSE; 1.87A {Campylobacter jejuni subsp} SCOP: c.1.24.0 PDB: 3o6d_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3aal_A Probable endonuclease 4; endoiv, DNA repair, base excision repair, TIM barrel, DNA DA endonuclease, hydrolase, metal-binding; 1.60A {Geobacillus kaustophilus} PDB: 1xp3_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3qvq_A Phosphodiesterase OLEI02445; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase, hydrolase; HET: MSE G3P; 1.60A {Oleispira antarctica} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3lot_A Uncharacterized protein; protein of unknown function, structural genomics, joint CENT structural genomics, JCSG; HET: MSE; 1.89A {Archaeoglobus fulgidus} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3apt_A Methylenetetrahydrofolate reductase; TIM barrel, oxidoreductase, flavin; HET: FAD; 1.85A {Thermus thermophilus} PDB: 3apy_A* 1v93_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3no5_A Uncharacterized protein; PFAM DUF849 domain containing protein, structural genomics, center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>3chv_A Prokaryotic domain of unknown function (DUF849) W barrel fold; TIM barrel fold, structural genomics, joint center for struc genomics; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>3e49_A Uncharacterized protein DUF849 with A TIM barrel; structural genomics, joint center for structural genomics; HET: MSE; 1.75A {Burkholderia xenovorans LB400} Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3lot_A Uncharacterized protein; protein of unknown function, structural genomics, joint CENT structural genomics, JCSG; HET: MSE; 1.89A {Archaeoglobus fulgidus} Back     alignment and structure
>2otd_A Glycerophosphodiester phosphodiesterase; structural genomics PSI-2, protein structure initiative, midwest center for STR genomics, hydrolase; 2.60A {Shigella flexneri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 246
d1rpxa_230 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P 1e-73
d1tqja_221 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {S 1e-61
d2flia1217 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimera 1e-58
d1h1ya_220 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {R 2e-43
d1tqxa_221 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P 6e-42
d1q6oa_213 c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarbo 1e-28
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 4e-04
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: D-ribulose-5-phosphate 3-epimerase
domain: D-ribulose-5-phosphate 3-epimerase
species: Potato (Solanum tuberosum) [TaxId: 4113]

 Score =  221 bits (565), Expect = 1e-73
 Identities = 177/196 (90%), Positives = 189/196 (96%)

Query: 48  ARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVV 107
           +RVDKFSKSDIIVSPSILSANF+KLGEQVKA+E AGCDWIHVDVMDGRFVPNITIGPLVV
Sbjct: 1   SRVDKFSKSDIIVSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVV 60

Query: 108 DALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAK 167
           D+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSSTIHLHRT+NQIK LGAK
Sbjct: 61  DSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIKSLGAK 120

Query: 168 AGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNP 227
           AGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVKKISDLR++C E+G+NP
Sbjct: 121 AGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVKKISDLRKICAERGLNP 180

Query: 228 WIEVDGGVGPKNAYKV 243
           WIEVDGGVGPKNAYKV
Sbjct: 181 WIEVDGGVGPKNAYKV 196
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 221 Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Length = 217 Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Length = 220 Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Length = 221 Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 100.0
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 100.0
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 100.0
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 100.0
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 100.0
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 99.87
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 98.42
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 98.25
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 97.8
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 97.68
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 97.54
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 97.51
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 96.77
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 96.66
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 96.55
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 96.48
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 96.25
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 96.24
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 96.23
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 95.95
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 95.89
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 95.89
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 95.85
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 95.45
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 95.43
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 95.32
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 94.94
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 93.81
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 93.59
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 93.52
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 93.48
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 92.9
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 92.68
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 92.14
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 91.38
d1zy9a2 348 Alpha-galactosidase GalA catalytic domain {Thermot 90.68
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 90.32
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 90.24
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 89.79
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 89.7
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 88.84
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 88.58
d1olta_ 441 Oxygen-independent coproporphyrinogen III oxidase 88.38
d1eepa_ 388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 87.36
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 86.44
d1hl9a2 350 Putative alpha-L-fucosidase, catalytic domain {The 86.3
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 85.19
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 83.93
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 82.52
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 81.72
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 81.61
d3bofa1260 Cobalamin-dependent methionine synthase MetH, C-te 81.4
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 81.32
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: D-ribulose-5-phosphate 3-epimerase
domain: D-ribulose-5-phosphate 3-epimerase
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=2.9e-68  Score=469.34  Aligned_cols=198  Identities=89%  Similarity=1.375  Sum_probs=192.8

Q ss_pred             cccccCCCCCcEEeeeecccChhhHHHHHHHHHHcCCCEEEeeeccCcccCCCCCCHHHHhhcccCCCCCeeEEEeccCc
Q 025927           48 ARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEP  127 (246)
Q Consensus        48 ~~~~~~~~~~~~IsPSIl~aD~~~l~~~i~~l~~~g~d~lHiDIMDG~FVpN~tfgp~~I~~ir~~t~~plDvHLMV~~P  127 (246)
                      +|++++++++++|||||||+|+.+|++++++++++|+||+|+|||||+||||++|||++++++|++|++|+|+||||.+|
T Consensus         1 ~~~~~~~~~~~~IspSIl~~d~~~l~~~i~~l~~~g~d~iHiDImDG~Fvpn~t~~~~~v~~i~~~t~~~~dvHLMv~~P   80 (230)
T d1rpxa_           1 SRVDKFSKSDIIVSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEP   80 (230)
T ss_dssp             CGGGGSCTTSCEEEEBGGGSCGGGHHHHHHHHHHTTCCCEEEEEEBSSSSSCBCCCHHHHHHHGGGCCSCEEEEEESSSH
T ss_pred             CCccccccCCeEEEcchhhcCHHHHHHHHHHHHHcCCCEEEEeCccCCcCCccccChHHHhhhhhccCceeeeeeeecch
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchHHHHhcCCCEEEEccCCcccccHHHHHHHHHHcCCcEEEEEcCCCChHHHHHhhhhcceEEEEeecCCCCCCcccH
Q 025927          128 EQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIE  207 (246)
Q Consensus       128 ~~~i~~~~~agad~It~H~E~~~~~~~~~~i~~Ik~~G~k~GlAlnP~Tpve~l~~~l~~vD~VLvMsV~PGfgGQ~F~~  207 (246)
                      .+|++.|+++|+++|+||+|+....++.+++++||++|+++||||||+||++.+++||+++|+||+|||+|||+||+|+|
T Consensus        81 ~~~i~~~~~~g~~~i~~H~E~~~~~~~~~~i~~ik~~g~k~Gialnp~T~~~~l~~~l~~vD~VllM~V~PGf~GQ~f~~  160 (230)
T d1rpxa_          81 DQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIE  160 (230)
T ss_dssp             HHHHHHHHHTTCSEEEEECSTTTCSCHHHHHHHHHHTTSEEEEEECTTCCGGGGTTTTTTCSEEEEESSCTTCSSCCCCT
T ss_pred             hhhHHHHhhcccceeEEeccccccccHHHHHHHHHHcCCeEEEEeCCCCCHHHHHHHHhhCCEEEEEEecCCcccchhhh
Confidence            99999999999999999999754567999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhcCCCCeEEEeCCCChhhhhhccc
Q 025927          208 SQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVPN  245 (246)
Q Consensus       208 ~~l~KI~~lr~l~~~~~~~~~I~VDGGI~~e~i~~l~~  245 (246)
                      .+++||+++|++++++++++.|+||||||.+|++++++
T Consensus       161 ~~~~kI~~~~~~~~~~~~~~~I~vDGGIn~~~i~~l~~  198 (230)
T d1rpxa_         161 SQVKKISDLRKICAERGLNPWIEVDGGVGPKNAYKVIE  198 (230)
T ss_dssp             THHHHHHHHHHHHHHHTCCCEEEEESSCCTTTHHHHHH
T ss_pred             hhHHHHHHHHHHHHhcCCceEEEEECCcCHHHHHHHHH
Confidence            99999999999999999999999999999999998864
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hl9a2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure