Citrus Sinensis ID: 026051

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVSFVRK
ccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHcccccccEEEcHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccccccHHHHHHHHcccccccHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccEEEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHccccccccEEEccHHHHHHHHHHHHHHccccHHHcEccEEEcccHHHEEEcHHHcEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccEEEEEEEEEccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
mdiviipagvprkpgmtrddlfnINAGIVKTLCEGIAKCCPKAIVNlisnpvnstvPIAAEVFkkvgtydpkrllGVTMLDVVRANTFVAEVlgldprevdvpvvgghagvTILPllsqvkpscsltpteiDYLTDriqnggtevveaktgagsaTLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGieeiyslgplneyeRAGLEKAKKELAGSIQKGVSFVRK
mdiviipagvprkpgmtrdDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAevlgldprevdVPVVGGHAGVTilpllsqvkpsCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEiyslgplnEYERAGLEKAKKElagsiqkgvsfvrk
MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVSFVRK
***VIIPAGVP***GMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYE************************
MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVSFVR*
MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVSFVRK
MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVSFVRK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVSFVRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query244 2.2.26 [Sep-21-2011]
P19446356 Malate dehydrogenase, gly N/A no 0.995 0.682 0.905 1e-127
P46488356 Malate dehydrogenase, gly N/A no 0.995 0.682 0.893 1e-125
Q42972356 Malate dehydrogenase, gly yes no 1.0 0.685 0.877 1e-123
P37228353 Malate dehydrogenase, gly yes no 1.0 0.691 0.868 1e-122
O82399354 Probable malate dehydroge yes no 1.0 0.689 0.856 1e-121
Q9ZP05354 Malate dehydrogenase, gly no no 1.0 0.689 0.872 1e-116
Q9XFW3358 Malate dehydrogenase 2, g N/A no 1.0 0.681 0.872 1e-116
Q43743358 Malate dehydrogenase 1, g N/A no 1.0 0.681 0.868 1e-115
Q9ZP06341 Malate dehydrogenase 1, m no no 0.995 0.712 0.683 1e-92
P17783347 Malate dehydrogenase, mit N/A no 0.983 0.691 0.687 2e-92
>sp|P19446|MDHG_CITLA Malate dehydrogenase, glyoxysomal OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function desciption
 Score =  452 bits (1163), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 220/243 (90%), Positives = 230/243 (94%)

Query: 1   MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAA 60
           MD++I+PAGVPRKPGMTRDDLF INAGIVKTLCEGIAKCCP+AIVNLISNPVNSTVPIAA
Sbjct: 113 MDLIIVPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPRAIVNLISNPVNSTVPIAA 172

Query: 61  EVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQV 120
           EVFKK GTYDPKRLLGVTMLDVVRANTFVAEVLGLDPR+VDVPVVGGHAGVTILPLLSQV
Sbjct: 173 EVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTILPLLSQV 232

Query: 121 KPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGV 180
           KP  S T  EI YLTDRIQNGGTEVVEAK GAGSATLSMAYAA KFADACLRGLRGDAGV
Sbjct: 233 KPPSSFTQEEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVKFADACLRGLRGDAGV 292

Query: 181 IECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVS 240
           IECA+V+S VTELPFFASKVRLGR GIEE+YSLGPLNEYER GLEKAKKELAGSI+KGVS
Sbjct: 293 IECAFVSSQVTELPFFASKVRLGRNGIEEVYSLGPLNEYERIGLEKAKKELAGSIEKGVS 352

Query: 241 FVR 243
           F+R
Sbjct: 353 FIR 355

Citrullus lanatus (taxid: 3654)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 7
>sp|P46488|MDHG_CUCSA Malate dehydrogenase, glyoxysomal OS=Cucumis sativus GN=MDHG PE=2 SV=1 Back     alignment and function description
>sp|Q42972|MDHG_ORYSJ Malate dehydrogenase, glyoxysomal OS=Oryza sativa subsp. japonica GN=Os12g0632700 PE=1 SV=3 Back     alignment and function description
>sp|P37228|MDHG_SOYBN Malate dehydrogenase, glyoxysomal OS=Glycine max PE=2 SV=2 Back     alignment and function description
>sp|O82399|MDHG2_ARATH Probable malate dehydrogenase, glyoxysomal OS=Arabidopsis thaliana GN=At2g22780 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZP05|MDHG1_ARATH Malate dehydrogenase, glyoxysomal OS=Arabidopsis thaliana GN=At5g09660 PE=1 SV=1 Back     alignment and function description
>sp|Q9XFW3|MDHG2_BRANA Malate dehydrogenase 2, glyoxysomal OS=Brassica napus GN=MDH2 PE=3 SV=1 Back     alignment and function description
>sp|Q43743|MDHG1_BRANA Malate dehydrogenase 1, glyoxysomal OS=Brassica napus GN=MDH1 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZP06|MDHM1_ARATH Malate dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=At1g53240 PE=1 SV=1 Back     alignment and function description
>sp|P17783|MDHM_CITLA Malate dehydrogenase, mitochondrial OS=Citrullus lanatus GN=MMDH PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
359496625 356 PREDICTED: malate dehydrogenase, glyoxys 1.0 0.685 0.918 1e-126
359475502 356 PREDICTED: malate dehydrogenase, glyoxys 1.0 0.685 0.897 1e-125
60593475 362 Chain A, Mature And Translocatable Forms 0.995 0.671 0.905 1e-125
126894 356 RecName: Full=Malate dehydrogenase, glyo 0.995 0.682 0.905 1e-125
224097202 354 predicted protein [Populus trichocarpa] 1.0 0.689 0.897 1e-125
60593487326 Chain A, Mature And Translocatable Forms 0.995 0.745 0.905 1e-125
255582419332 malate dehydrogenase, putative [Ricinus 1.0 0.734 0.893 1e-123
449451347 356 PREDICTED: malate dehydrogenase, glyoxys 0.995 0.682 0.893 1e-123
1170897 356 RecName: Full=Malate dehydrogenase, glyo 0.995 0.682 0.893 1e-123
255562058 356 malate dehydrogenase, putative [Ricinus 1.0 0.685 0.868 1e-122
>gi|359496625|ref|XP_002263670.2| PREDICTED: malate dehydrogenase, glyoxysomal [Vitis vinifera] gi|297739396|emb|CBI29427.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 224/244 (91%), Positives = 229/244 (93%)

Query: 1   MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAA 60
           MD+VIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCP AIVNLISNPVNSTVPIAA
Sbjct: 113 MDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPNAIVNLISNPVNSTVPIAA 172

Query: 61  EVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQV 120
           EVFKK GT+DPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQV
Sbjct: 173 EVFKKAGTFDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQV 232

Query: 121 KPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGV 180
           KP CS TP EIDYLT RIQNGGTEVVEAK GAGSATLSMAYAA KFAD CLRGLRGDAGV
Sbjct: 233 KPPCSFTPEEIDYLTARIQNGGTEVVEAKAGAGSATLSMAYAAVKFADTCLRGLRGDAGV 292

Query: 181 IECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVS 240
           I+CAYV S VTELPFFASKVRLGR G EEIY LGPLNEYERAGLEKAKKELA SIQKG+S
Sbjct: 293 IQCAYVFSQVTELPFFASKVRLGRTGAEEIYPLGPLNEYERAGLEKAKKELASSIQKGIS 352

Query: 241 FVRK 244
           F+RK
Sbjct: 353 FIRK 356

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359475502|ref|XP_003631692.1| PREDICTED: malate dehydrogenase, glyoxysomal [Vitis vinifera] gi|147774268|emb|CAN65552.1| hypothetical protein VITISV_033330 [Vitis vinifera] gi|297736349|emb|CBI25072.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|60593475|pdb|1SEV|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures gi|60593476|pdb|1SEV|B Chain B, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Back     alignment and taxonomy information
>gi|126894|sp|P19446.1|MDHG_CITLA RecName: Full=Malate dehydrogenase, glyoxysomal; Flags: Precursor gi|167284|gb|AAA33041.1| glyoxysomal malate dehydrogenase precursor (EC 1.1.1.37) [Citrullus lanatus subsp. vulgaris] Back     alignment and taxonomy information
>gi|224097202|ref|XP_002310874.1| predicted protein [Populus trichocarpa] gi|222853777|gb|EEE91324.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|60593487|pdb|1SMK|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures gi|60593488|pdb|1SMK|B Chain B, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures gi|60593489|pdb|1SMK|C Chain C, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures gi|60593490|pdb|1SMK|D Chain D, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures gi|60593491|pdb|1SMK|E Chain E, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures gi|60593492|pdb|1SMK|F Chain F, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures gi|60593493|pdb|1SMK|G Chain G, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures gi|60593494|pdb|1SMK|H Chain H, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Back     alignment and taxonomy information
>gi|255582419|ref|XP_002531998.1| malate dehydrogenase, putative [Ricinus communis] gi|223528357|gb|EEF30397.1| malate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449451347|ref|XP_004143423.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Cucumis sativus] gi|449499834|ref|XP_004160930.1| PREDICTED: malate dehydrogenase, glyoxysomal-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|1170897|sp|P46488.1|MDHG_CUCSA RecName: Full=Malate dehydrogenase, glyoxysomal; Flags: Precursor gi|695311|gb|AAC41647.1| glyoxysomal malate dehydrogenase [Cucumis sativus] Back     alignment and taxonomy information
>gi|255562058|ref|XP_002522037.1| malate dehydrogenase, putative [Ricinus communis] gi|223538636|gb|EEF40237.1| malate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
TAIR|locus:2062240354 PMDH1 "peroxisomal NAD-malate 1.0 0.689 0.856 6.1e-110
TAIR|locus:2144781363 PMDH2 "peroxisomal NAD-malate 0.778 0.523 0.889 1.4e-87
TAIR|locus:2009605341 mMDH1 "mitochondrial malate de 0.995 0.712 0.683 1e-84
TAIR|locus:2086340341 mMDH2 "mitochondrial malate de 0.995 0.712 0.679 4.4e-84
TAIR|locus:2079177403 MDH "malate dehydrogenase" [Ar 1.0 0.605 0.646 9.7e-80
FB|FBgn0262559336 Mdh2 "Malate dehydrogenase 2" 0.983 0.714 0.608 1.5e-74
WB|WBGene00003162341 mdh-2 [Caenorhabditis elegans 0.987 0.706 0.588 2.1e-70
ZFIN|ZDB-GENE-040426-2143337 mdh2 "malate dehydrogenase 2, 0.987 0.715 0.572 5.5e-70
UNIPROTKB|E1BVT3337 MDH2 "Malate dehydrogenase" [G 0.991 0.718 0.566 7e-70
UNIPROTKB|F1PYG8338 MDH2 "Malate dehydrogenase" [C 0.991 0.715 0.549 1.7e-68
TAIR|locus:2062240 PMDH1 "peroxisomal NAD-malate dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1086 (387.4 bits), Expect = 6.1e-110, P = 6.1e-110
 Identities = 209/244 (85%), Positives = 226/244 (92%)

Query:     1 MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAA 60
             MD+VIIPAGVPRKPGMTRDDLFNINAGIV+TL E IAKCCPKAIVN+ISNPVNSTVPIAA
Sbjct:   111 MDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAIVNIISNPVNSTVPIAA 170

Query:    61 EVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQV 120
             EVFKK GT+DPK+L+GVTMLDVVRANTFVAEV+ LDPREV+VPVVGGHAGVTILPLLSQV
Sbjct:   171 EVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVEVPVVGGHAGVTILPLLSQV 230

Query:   121 KPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGV 180
             KP CS T  EI+YLTDRIQNGGTEVVEAK GAGSATLSMAYAA +FADACLRGLRGDA +
Sbjct:   231 KPPCSFTQKEIEYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVEFADACLRGLRGDANI 290

Query:   181 IECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVS 240
             +ECAYVAS VTELPFFASKVRLGR GI+E+Y LGPLNEYER GLEKAKKEL+ SI KGV+
Sbjct:   291 VECAYVASHVTELPFFASKVRLGRCGIDEVYGLGPLNEYERMGLEKAKKELSVSIHKGVT 350

Query:   241 FVRK 244
             F +K
Sbjct:   351 FAKK 354
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006108 "malate metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016615 "malate dehydrogenase activity" evidence=IEA;ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0030060 "L-malate dehydrogenase activity" evidence=IEA
GO:0044262 "cellular carbohydrate metabolic process" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005777 "peroxisome" evidence=IDA
GO:0031998 "regulation of fatty acid beta-oxidation" evidence=IGI;IMP
GO:0009507 "chloroplast" evidence=IDA
GO:0080093 "regulation of photorespiration" evidence=IMP
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0007031 "peroxisome organization" evidence=RCA
GO:0009062 "fatty acid catabolic process" evidence=RCA
TAIR|locus:2144781 PMDH2 "peroxisomal NAD-malate dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009605 mMDH1 "mitochondrial malate dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086340 mMDH2 "mitochondrial malate dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079177 MDH "malate dehydrogenase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0262559 Mdh2 "Malate dehydrogenase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00003162 mdh-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2143 mdh2 "malate dehydrogenase 2, NAD (mitochondrial)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVT3 MDH2 "Malate dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYG8 MDH2 "Malate dehydrogenase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q43743MDHG1_BRANA1, ., 1, ., 1, ., 3, 70.86881.00.6815N/Ano
Q5NVR2MDHM_PONAB1, ., 1, ., 1, ., 3, 70.55370.99180.7159yesno
B1LGK2MDH_ECOSM1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
C4ZSX4MDH_ECOBW1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
Q42972MDHG_ORYSJ1, ., 1, ., 1, ., 3, 70.87701.00.6853yesno
P08249MDHM_MOUSE1, ., 1, ., 1, ., 3, 70.55370.99180.7159yesno
B7LRL0MDH_ESCF31, ., 1, ., 1, ., 3, 70.56790.99180.7756yesno
Q0TCN0MDH_ECOL51, ., 1, ., 1, ., 3, 70.57610.99180.7756yesno
A8A545MDH_ECOHS1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
B7UJW8MDH_ECO271, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
Q1R6A3MDH_ECOUT1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
P46488MDHG_CUCSA1, ., 1, ., 1, ., 3, 70.89300.99590.6825N/Ano
A7MWD3MDH_VIBHB1, ., 1, ., 1, ., 3, 70.57430.98770.7749yesno
Q32LG3MDHM_BOVIN1, ., 1, ., 1, ., 3, 70.54950.99180.7159yesno
A1AGC9MDH_ECOK11, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
Q9XFW3MDHG2_BRANA1, ., 1, ., 1, ., 3, 70.87291.00.6815N/Ano
B7N0M1MDH_ECO811, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
Q31WA4MDH_SHIBS1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
P37228MDHG_SOYBN1, ., 1, ., 1, ., 3, 70.86881.00.6912yesno
B7MBZ7MDH_ECO451, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
O02640MDHM_CAEEL1, ., 1, ., 1, ., 3, 70.58840.98770.7067yesno
B7LHU4MDH_ECO551, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
P40926MDHM_HUMAN1, ., 1, ., 1, ., 3, 70.55370.99180.7159yesno
B4T769MDH_SALNS1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
B1IQP3MDH_ECOLC1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
P04636MDHM_RAT1, ., 1, ., 1, ., 3, 70.55550.99590.7189yesno
B1XHK9MDH_ECODH1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
P19446MDHG_CITLA1, ., 1, ., 1, ., 3, 70.90530.99590.6825N/Ano
Q5R030MDH_IDILO1, ., 1, ., 1, ., 3, 70.58750.97540.7677yesno
P00346MDHM_PIG1, ., 1, ., 1, ., 3, 70.55370.99180.7159yesno
Q3YX11MDH_SHISS1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
O82399MDHG2_ARATH1, ., 1, ., 1, ., 3, 70.85651.00.6892yesno
P61890MDH_ECOL61, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
Q7MYW9MDH_PHOLL1, ., 1, ., 1, ., 3, 70.55960.99180.7756yesno
B2U1U9MDH_SHIB31, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
Q87SU7MDH_VIBPA1, ., 1, ., 1, ., 3, 70.58260.98770.7749yesno
B5YSW2MDH_ECO5E1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
B7NKU9MDH_ECO7I1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno
B7M0U8MDH_ECO8A1, ., 1, ., 1, ., 3, 70.57200.99180.7756yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.976
3rd Layer1.1.1.370.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00010647001
RecName- Full=Malate dehydrogenase; EC=1.1.1.37; (356 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00003727001
RecName- Full=Citrate synthase; (472 aa)
   •••• 0.956
GSVIVG00017898001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (565 aa)
     •• 0.941
GSVIVG00028048001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (470 aa)
     •• 0.929
VVME2
RecName- Full=Malic enzyme; (591 aa)
     •• 0.905
NADP-ME
RecName- Full=Malic enzyme; (496 aa)
     •• 0.905
GSVIVG00016723001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (411 aa)
     •• 0.903
GSVIVG00032723001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (410 aa)
     •• 0.903
GSVIVG00032463001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (450 aa)
     •• 0.902
GSVIVG00026767001
RecName- Full=Malic enzyme; (605 aa)
     •• 0.902
GSVIVG00018984001
RecName- Full=Malic enzyme; (625 aa)
     •• 0.902

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
PLN00106323 PLN00106, PLN00106, malate dehydrogenase 1e-178
cd01337310 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma 1e-159
PRK05086312 PRK05086, PRK05086, malate dehydrogenase; Provisio 1e-120
TIGR01772312 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, 1e-117
PTZ00325321 PTZ00325, PTZ00325, malate dehydrogenase; Provisio 1e-110
COG0039313 COG0039, Mdh, Malate/lactate dehydrogenases [Energ 3e-65
pfam02866173 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, 5e-59
cd01339300 cd01339, LDH-like_MDH, L-lactate dehydrogenase-lik 5e-42
PRK06223307 PRK06223, PRK06223, malate dehydrogenase; Reviewed 5e-40
cd00650263 cd00650, LDH_MDH_like, NAD-dependent, lactate dehy 9e-31
pfam00056142 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, 1e-30
TIGR01763305 TIGR01763, MalateDH_bact, malate dehydrogenase, NA 6e-30
cd00300300 cd00300, LDH_like, L-lactate dehydrogenase-like en 7e-30
PTZ00117319 PTZ00117, PTZ00117, malate dehydrogenase; Provisio 3e-27
PTZ00082321 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provi 8e-26
TIGR01771299 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase 6e-24
cd05291306 cd05291, HicDH_like, L-2-hydroxyisocapronate dehyd 1e-23
cd05294309 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenas 3e-22
cd05292308 cd05292, LDH_2, A subgroup of L-lactate dehydrogen 5e-17
PRK00066315 PRK00066, ldh, L-lactate dehydrogenase; Reviewed 7e-15
cd05290307 cd05290, LDH_3, A subgroup of L-lactate dehydrogen 8e-15
cd05293312 cd05293, LDH_1, A subgroup of L-lactate dehydrogen 1e-14
PLN02602350 PLN02602, PLN02602, lactate dehydrogenase 2e-13
cd00704323 cd00704, MDH, Malate dehydrogenase 2e-12
TIGR01759323 TIGR01759, MalateDH-SF1, malate dehydrogenase 9e-12
TIGR01756313 TIGR01756, LDH_protist, lactate dehydrogenase 2e-08
cd01336325 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic an 9e-08
TIGR01758324 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD- 1e-07
cd01338322 cd01338, MDH_choloroplast_like, Chloroplast-like m 2e-06
PRK05442326 PRK05442, PRK05442, malate dehydrogenase; Provisio 8e-06
PLN00135309 PLN00135, PLN00135, malate dehydrogenase 3e-05
>gnl|CDD|215058 PLN00106, PLN00106, malate dehydrogenase Back     alignment and domain information 
 Score =  492 bits (1269), Expect = e-178
 Identities = 185/237 (78%), Positives = 202/237 (85%)

Query: 1   MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAA 60
            D+VIIPAGVPRKPGMTRDDLFNINAGIVKTLCE +AK CP A+VN+ISNPVNSTVPIAA
Sbjct: 87  ADLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAVAKHCPNALVNIISNPVNSTVPIAA 146

Query: 61  EVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQV 120
           EV KK G YDPK+L GVT LDVVRANTFVAE  GLDP +VDVPVVGGHAG+TILPLLSQ 
Sbjct: 147 EVLKKAGVYDPKKLFGVTTLDVVRANTFVAEKKGLDPADVDVPVVGGHAGITILPLLSQA 206

Query: 121 KPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGV 180
            P  S T  EI+ LT RIQNGGTEVVEAK GAGSATLSMAYAAA+FADACLRGL G+A V
Sbjct: 207 TPKVSFTDEEIEALTKRIQNGGTEVVEAKAGAGSATLSMAYAAARFADACLRGLNGEADV 266

Query: 181 IECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQK 237
           +EC+YV S VTELPFFASKVRLGR G+EE+  LGPL+EYE+ GLE  K EL  SI+K
Sbjct: 267 VECSYVQSEVTELPFFASKVRLGRNGVEEVLGLGPLSEYEQKGLEALKPELKASIEK 323

Length = 323
>gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>gnl|CDD|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|202437 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain Back     alignment and domain information
>gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>gnl|CDD|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>gnl|CDD|200963 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|233562 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>gnl|CDD|173409 PTZ00117, PTZ00117, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173376 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|133430 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>gnl|CDD|133428 cd05292, LDH_2, A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|178836 PRK00066, ldh, L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|133426 cd05290, LDH_3, A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|133429 cd05293, LDH_1, A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|178212 PLN02602, PLN02602, lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|133420 cd00704, MDH, Malate dehydrogenase Back     alignment and domain information
>gnl|CDD|130820 TIGR01759, MalateDH-SF1, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|130817 TIGR01756, LDH_protist, lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|133421 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>gnl|CDD|130819 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|133423 cd01338, MDH_choloroplast_like, Chloroplast-like malate dehydrogenases Back     alignment and domain information
>gnl|CDD|235468 PRK05442, PRK05442, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177744 PLN00135, PLN00135, malate dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 244
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 100.0
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 100.0
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 100.0
PRK05086312 malate dehydrogenase; Provisional 100.0
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 100.0
PLN00106323 malate dehydrogenase 100.0
PLN00135309 malate dehydrogenase 100.0
PTZ00325321 malate dehydrogenase; Provisional 100.0
KOG1495332 consensus Lactate dehydrogenase [Energy production 100.0
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 100.0
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 100.0
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 100.0
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 100.0
PLN02602350 lactate dehydrogenase 100.0
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 100.0
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 100.0
PRK05442326 malate dehydrogenase; Provisional 100.0
TIGR01756313 LDH_protist lactate dehydrogenase. This model repr 100.0
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 100.0
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 100.0
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 100.0
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 100.0
PLN00112444 malate dehydrogenase (NADP); Provisional 100.0
PTZ00117319 malate dehydrogenase; Provisional 100.0
PTZ00082321 L-lactate dehydrogenase; Provisional 100.0
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 100.0
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 100.0
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 100.0
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 100.0
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 100.0
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 100.0
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 100.0
PRK06223307 malate dehydrogenase; Reviewed 100.0
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 100.0
KOG1496332 consensus Malate dehydrogenase [Energy production 100.0
PF02866174 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta 100.0
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 99.91
PRK15076431 alpha-galactosidase; Provisional 99.89
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 99.89
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 99.86
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 99.83
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 99.81
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 99.67
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 98.79
PF11975232 Glyco_hydro_4C: Family 4 glycosyl hydrolase C-term 97.03
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information 
Probab=100.00  E-value=1.3e-65  Score=452.89  Aligned_cols=243  Identities=59%  Similarity=0.947  Sum_probs=228.4

Q ss_pred             CcEEEEcCCCCCCCCCCHHHHHHHhHHHHHHHHHHHHhhCCCcEEEEecCCCCCcHHHHHHHHHHhCCCCCCCeEEechh
Q 026051            1 MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTYDPKRLLGVTML   80 (244)
Q Consensus         1 aDiviitag~~~~~g~~r~~l~~~N~~i~~~i~~~i~~~~p~~~iiv~tNPvd~~~~ilt~~~~~~~~~~~~~viG~t~l   80 (244)
                      ||+||+|||.|++|||+|+|++..|++|++++++.|++++|++++|++|||+|.||++||+++++.+|||++||||+|.|
T Consensus        68 aDivvitaG~~~~~g~~R~dll~~N~~I~~~i~~~i~~~~p~~iiivvsNPvDv~~~i~t~~~~~~sg~p~~rViG~g~L  147 (312)
T TIGR01772        68 ADVVVIPAGVPRKPGMTRDDLFNVNAGIVKDLVAAVAESCPKAMILVITNPVNSTVPIAAEVLKKKGVYDPNKLFGVTTL  147 (312)
T ss_pred             CCEEEEeCCCCCCCCccHHHHHHHhHHHHHHHHHHHHHhCCCeEEEEecCchhhHHHHHHHHHHHhcCCChHHEEeeecc
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999779


Q ss_pred             hHHHHHHHHHHHhCCCCCcceeeEeccCCCceeeeccccCCCCCCCChhHHHHHHHHHhcCcceeeeccCCCCchhHHHH
Q 026051           81 DVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMA  160 (244)
Q Consensus        81 d~~R~~~~la~~l~v~~~~v~~~viG~h~g~~~vp~~s~~~~~~~~~~~~~~~l~~~v~~~~~~ii~~k~~~g~~~~s~a  160 (244)
                      ||+||+++||++++++|++|+++||||||+++++|+||++++...++++++++|.++++++|++|+++|.|||+|+||+|
T Consensus       148 DsaR~r~~la~~l~v~~~~v~~~ViGeHg~~s~vp~~S~~~~~~~~~~~~~~~i~~~v~~~g~~Ii~~k~gkg~t~~~ia  227 (312)
T TIGR01772       148 DIVRANTFVAELKGKDPMEVNVPVIGGHSGETIIPLISQCPGKVLFTEDQLEALIHRIQNAGTEVVKAKAGAGSATLSMA  227 (312)
T ss_pred             hHHHHHHHHHHHhCCCHHHeEEEEEEecCCCccccccccccccCCCCHHHHHHHHHHHHHHHHHHHhCccCCCChhHHHH
Confidence            99999999999999999999999999997569999999998654466666899999999999999998667899999999


Q ss_pred             HHHHHHHHHHHhccCCCCCeeeeeEecCCCC-CccEEEEeEEEcCCceEEEccCCCCCHHHHHHHHHHHHHHHHHHHHhh
Q 026051          161 YAAAKFADACLRGLRGDAGVIECAYVASTVT-ELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGV  239 (244)
Q Consensus       161 ~a~~~~i~ai~~~~~~~~~~~~~~~~~~~~~-~~~~~s~Pv~ig~~Gv~~i~~~~~L~~~E~~~l~~s~~~l~~~~~~~~  239 (244)
                      +++++++++|++++.|++.++|+++++++|+ +++|||+||+||++|+++++++++|+++|+++|++|++.|++.+++|+
T Consensus       228 ~a~~~iv~ail~~~~d~~~v~~~s~~~g~yg~~~v~~s~P~~ig~~Gv~~i~~~~~L~~~E~~~l~~S~~~i~~~~~~g~  307 (312)
T TIGR01772       228 FAGARFVLSLVRGLKGEEGVVECAYVESDGVTEATFFATPLLLGKNGVEKRLGIGKLSSFEEKMLNGALPELKKNIKKGE  307 (312)
T ss_pred             HHHHHHHHHHHHhhCCCccEEEEEEEccCCCcCceEEEEEEEEcCCeeEEEEccCCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999987767889999888888884 789999999999999999998856999999999999999999999999


Q ss_pred             hhhh
Q 026051          240 SFVR  243 (244)
Q Consensus       240 ~~~~  243 (244)
                      +|+.
T Consensus       308 ~~~~  311 (312)
T TIGR01772       308 EFVA  311 (312)
T ss_pred             HHhc
Confidence            9975

Although malate dehydrogenases have in some cases been mistaken for lactate dehydrogenases due to the similarity of these two substrates and the apparent ease with which evolution can toggle these activities, critical residues have been identified which can discriminate between the two activities. At the time of the creation of this model no hits above the trusted cutoff contained critical residues typical of lactate dehydrogenases.
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PLN00135 malate dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01756 LDH_protist lactate dehydrogenase Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>KOG1496 consensus Malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF02866 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF11975 Glyco_hydro_4C: Family 4 glycosyl hydrolase C-terminal domain; InterPro: IPR022616 This domain is found primarily in bacterial family 4 glycosyl hydrolases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
1sev_A362 Mature And Translocatable Forms Of Glyoxysomal Mala 1e-128
1smk_A326 Mature And Translocatable Forms Of Glyoxysomal Mala 1e-127
1mld_A314 Refined Structure Of Mitochondrial Malate Dehydroge 1e-74
2dfd_A342 Crystal Structure Of Human Malate Dehydrogenase Typ 1e-74
2pwz_A312 Crystal Structure Of The Apo Form Of E.Coli Malate 7e-74
1emd_A312 Crystal Structure Of A Ternary Complex Of Escherich 9e-74
1ib6_A312 Crystal Structure Of R153c E. Coli Malate Dehydroge 1e-72
4e0b_A313 2.17 Angstrom Resolution Crystal Structure Of Malat 2e-70
1guz_A310 Structural Basis For Thermophilic Protein Stability 1e-24
1gv1_A310 Structural Basis For Thermophilic Protein Stability 1e-24
3tl2_A315 Crystal Structure Of Bacillus Anthracis Str. Ames M 2e-21
3p7m_A321 Structure Of Putative Lactate Dehydrogenase From Fr 4e-20
1uxi_A309 Large Improvement In The Thermal Stability Of A Tet 6e-20
1gv0_A310 Structural Basis For Thermophilic Protein Stability 6e-20
1uxh_A309 Large Improvement In The Thermal Stability Of A Tet 8e-20
1guy_A309 Structural Basis For Thermophilic Protein Stability 1e-19
1ur5_A309 Stabilization Of A Tetrameric Malate Dehydrogenase 1e-19
2hjr_A328 Crystal Structure Of Cryptosporidium Parvum Malate 8e-19
3gvh_A324 Crystal Structure Of LactateMALATE DEHYDROGENASE FR 5e-18
1a5z_A319 Lactate Dehydrogenase From Thermotoga Maritima (tml 4e-16
1sov_A328 Toxoplasma Gondii Bradyzoite-specific Ldh (ldh2) Ap 6e-15
3czm_A326 T. Gondii Bradyzoite-Specific Ldh (Ldh2) In Complex 7e-15
3nep_X314 1.55a Resolution Structure Of Malate Dehydrogenase 3e-14
2d4a_A308 Structure Of The Malate Dehydrogenase From Aeropyru 2e-13
1ceq_A316 Chloroquine Binds In The Cofactor Binding Site Of P 3e-13
1xiv_A323 Plasmodium Falciparum Lactate Dehydrogenase Complex 3e-13
1t24_A322 Plasmodium Falciparum Lactate Dehydrogenase Complex 3e-13
1u4o_A321 Plasmodium Falciparum Lactate Dehydrogenase Complex 4e-13
2fm3_A321 Crystal Structure Of The Lactate Dehydrogenase From 3e-12
2ewd_A317 Crystal Structure Of The Lactate Dehydrogenase From 3e-12
2zqy_A326 T-State Structure Of Allosteric L-Lactate Dehydroge 3e-12
1oc4_A322 Lactate Dehydrogenase From Plasmodium Berghei Lengt 4e-12
3vku_A326 Penta Mutant Of Lactobacillus Casei Lactate Dehydro 5e-12
1cet_A316 Chloroquine Binds In The Cofactor Binding Site Of P 5e-12
1llc_A325 Structure Determination Of The Allosteric L-Lactate 6e-12
2a92_A321 Crystal Structure Of Lactate Dehydrogenase From Pla 7e-12
1t2e_A322 Plasmodium Falciparum Lactate Dehydrogenase S245a, 7e-12
1hyg_A313 Crystal Structure Of Mj0490 Gene Product, The Famil 1e-11
1y6j_A318 L-Lactate Dehydrogenase From Clostridium Thermocell 8e-11
2j5k_A304 2.0 A Resolution Structure Of The Wild Type Malate 1e-10
1hlp_A303 Structural Features Stabilizing Halophilic Malate D 1e-10
2hlp_A303 Crystal Structure Of The E267r Mutant Of A Halophil 1e-10
3om9_A329 T. Gondii Bradyzoite-Specific Ldh (Ldh1) In Complex 3e-10
1pze_A331 T.gondii Ldh1 Apo Form Length = 331 3e-10
3d0o_A317 Crystal Structure Of Lactate Dehydrogenase From Sta 3e-10
1pzg_A331 T.Gondii Ldh1 Complexed With Apad And Sulfate At 1. 3e-10
3h3j_A317 Crystal Structure Of Lactate Dehydrogenase Mutant ( 4e-10
2x0r_A304 R207s,R292s Mutant Of Malate Dehydrogenase From The 2e-09
1o6z_A303 1.95 A Resolution Structure Of (r207s,r292s) Mutant 2e-09
4a73_A310 Single Point Mutant Of Thermus Thermophilus Lactate 2e-09
2e37_A310 Structure Of Tt0471 Protein From Thermus Thermophil 3e-09
3pqd_A326 Crystal Structure Of L-Lactate Dehydrogenase From B 3e-09
2ldx_A331 Characterization Of The Antigenic Sites On The Refi 3e-09
2v6m_A310 Crystal Structure Of Lactate Dehydrogenase From The 5e-09
2v65_A331 Apo Ldh From The Psychrophile C. Gunnari Length = 3 5e-09
1v6a_A332 Crystal Structure Of L-Lactate Dehydrogenase From C 6e-09
1i10_A331 Human Muscle L-Lactate Dehydrogenase M Chain, Terna 7e-09
4ajp_A337 Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl- 7e-09
4aj4_A332 Rat Ldha In Complex With 4-((2-Allylsulfanyl-1,3-Be 9e-09
4aj1_A331 Rat Ldha In Complex With N-(2-(Methylamino)-1,3- Be 9e-09
3pqe_A326 Crystal Structure Of L-Lactate Dehydrogenase From B 1e-08
2xxb_A310 Penta-Mutant Of Thermus Thermophilus Lactate Dehydr 1e-08
1lld_A319 Molecular Basis Of Allosteric Activation Of Bacteri 2e-08
1ez4_A318 Crystal Structure Of Non-Allosteric L-Lactate Dehyd 2e-08
9ldt_A332 Design And Synthesis Of New Enzymes Based On The La 3e-08
1ldb_A317 Structure Determination And Refinement Of Bacillus 3e-08
1ldn_A316 Structure Of A Ternary Complex Of An Allosteric Lac 4e-08
2x0i_A294 2.9 A Resolution Structure Of Malate Dehydrogenase 8e-08
3h3f_A331 Rabbit Muscle L-Lactate Dehydrogenase In Complex Wi 9e-08
3fi9_A343 Crystal Structure Of Malate Dehydrogenase From Porp 2e-07
2v6b_A304 Crystal Structure Of Lactate Dehydrogenase From Dei 4e-07
4h7p_A345 Crystal Structure Of A Putative Cytosolic Malate De 4e-06
1t2f_A333 Human B Lactate Dehydrogenase Complexed With Nad+ A 8e-06
1i0z_A333 Human Heart L-Lactate Dehydrogenase H Chain, Ternar 9e-06
4mdh_A334 Refined Crystal Structure Of Cytoplasmic Malate Deh 3e-05
5mdh_A333 Crystal Structure Of Ternary Complex Of Porcine Cyt 3e-05
5ldh_A334 Structure Of The Active Ternary Complex Of Pig Hear 4e-05
6ldh_A330 Refined Crystal Structure Of Dogfish M4 Apo-Lactate 3e-04
1ldm_A329 Refined Crystal Structure Of Dogfish M4 Apo-Lactate 3e-04
1civ_A385 Chloroplast Nadp-Dependent Malate Dehydrogenase Fro 7e-04
>pdb|1SEV|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Length = 362 Back     alignment and structure 
Iteration: 1

 Score =  452 bits (1163), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/243 (90%), Positives = 230/243 (94%)
Query: 1   MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAA 60
           MD++I+PAGVPRKPGMTRDDLF INAGIVKTLCEGIAKCCP+AIVNLISNPVNSTVPIAA
Sbjct: 113 MDLIIVPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPRAIVNLISNPVNSTVPIAA 172
Query: 61  EVFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQV 120
           EVFKK GTYDPKRLLGVTMLDVVRANTFVAEVLGLDPR+VDVPVVGGHAGVTILPLLSQV
Sbjct: 173 EVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTILPLLSQV 232
Query: 121 KPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGV 180
           KP  S T  EI YLTDRIQNGGTEVVEAK GAGSATLSMAYAA KFADACLRGLRGDAGV
Sbjct: 233 KPPSSFTQEEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVKFADACLRGLRGDAGV 292
Query: 181 IECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVS 240
           IECA+V+S VTELPFFASKVRLGR GIEE+YSLGPLNEYER GLEKAKKELAGSI+KGVS
Sbjct: 293 IECAFVSSQVTELPFFASKVRLGRNGIEEVYSLGPLNEYERIGLEKAKKELAGSIEKGVS 352
Query: 241 FVR 243
           F+R
Sbjct: 353 FIR 355
>pdb|1SMK|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Length = 326 Back     alignment and structure
>pdb|1MLD|A Chain A, Refined Structure Of Mitochondrial Malate Dehydrogenase From Porcine Heart And The Consensus Structure For Dicarboxylic Acid Oxidoreductases Length = 314 Back     alignment and structure
>pdb|2DFD|A Chain A, Crystal Structure Of Human Malate Dehydrogenase Type 2 Length = 342 Back     alignment and structure
>pdb|2PWZ|A Chain A, Crystal Structure Of The Apo Form Of E.Coli Malate Dehydrogenase Length = 312 Back     alignment and structure
>pdb|1EMD|A Chain A, Crystal Structure Of A Ternary Complex Of Escherichia Coli Malate Dehydrogenase, Citrate And Nad At 1.9 Angstroms Resolution Length = 312 Back     alignment and structure
>pdb|1IB6|A Chain A, Crystal Structure Of R153c E. Coli Malate Dehydrogenase Length = 312 Back     alignment and structure
>pdb|4E0B|A Chain A, 2.17 Angstrom Resolution Crystal Structure Of Malate Dehydrogenase From Vibrio Vulnificus Cmcp6 Length = 313 Back     alignment and structure
>pdb|1GUZ|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|1GV1|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|3TL2|A Chain A, Crystal Structure Of Bacillus Anthracis Str. Ames Malate Dehydrogenase In Closed Conformation Length = 315 Back     alignment and structure
>pdb|3P7M|A Chain A, Structure Of Putative Lactate Dehydrogenase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 321 Back     alignment and structure
>pdb|1UXI|A Chain A, Large Improvement In The Thermal Stability Of A Tetrameric Malate Dehydrogenase By Single Point Mutations At The Dimer-Dimer Interface Length = 309 Back     alignment and structure
>pdb|1GV0|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|1UXH|A Chain A, Large Improvement In The Thermal Stability Of A Tetrameric Malate Dehydrogenase By Single Point Mutations At The Dimer-Dimer Interface Length = 309 Back     alignment and structure
>pdb|1GUY|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 309 Back     alignment and structure
>pdb|1UR5|A Chain A, Stabilization Of A Tetrameric Malate Dehydrogenase By Introduction Of A Disulfide Bridge At The DimerDIMER Interface Length = 309 Back     alignment and structure
>pdb|2HJR|A Chain A, Crystal Structure Of Cryptosporidium Parvum Malate Dehydrogenase Length = 328 Back     alignment and structure
>pdb|3GVH|A Chain A, Crystal Structure Of LactateMALATE DEHYDROGENASE FROM Brucella Melitensis Length = 324 Back     alignment and structure
>pdb|1A5Z|A Chain A, Lactate Dehydrogenase From Thermotoga Maritima (tmldh) Length = 319 Back     alignment and structure
>pdb|1SOV|A Chain A, Toxoplasma Gondii Bradyzoite-specific Ldh (ldh2) Apo Form Length = 328 Back     alignment and structure
>pdb|3CZM|A Chain A, T. Gondii Bradyzoite-Specific Ldh (Ldh2) In Complex With Nad And Oxq Length = 326 Back     alignment and structure
>pdb|3NEP|X Chain X, 1.55a Resolution Structure Of Malate Dehydrogenase From Salinibacter Ruber Length = 314 Back     alignment and structure
>pdb|2D4A|A Chain A, Structure Of The Malate Dehydrogenase From Aeropyrum Pernix Length = 308 Back     alignment and structure
>pdb|1CEQ|A Chain A, Chloroquine Binds In The Cofactor Binding Site Of Plasmodium Falciparum Lactate Dehydrogenase Length = 316 Back     alignment and structure
>pdb|1XIV|A Chain A, Plasmodium Falciparum Lactate Dehydrogenase Complexed With 2-({4- Chloro-[hydroxy(Methoxy)methyl]cyclohexyl}amino)ethane- 1,1,2-Triol Length = 323 Back     alignment and structure
>pdb|1T24|A Chain A, Plasmodium Falciparum Lactate Dehydrogenase Complexed With Nad+ And 4- Hydroxy-1,2,5-Oxadiazole-3-Carboxylic Acid Length = 322 Back     alignment and structure
>pdb|1U4O|A Chain A, Plasmodium Falciparum Lactate Dehydrogenase Complexed With 2,6- Naphthalenedicarboxylic Acid Length = 321 Back     alignment and structure
>pdb|2FM3|A Chain A, Crystal Structure Of The Lactate Dehydrogenase From Cryptosporidium Parvum Complexed With Substrate (Pyruvic Acid) And Cofactor (B- Nicotinamide Adenine Dinucleotide) Length = 321 Back     alignment and structure
>pdb|2EWD|A Chain A, Crystal Structure Of The Lactate Dehydrogenase From Cryptosporidium Parvum Complexed With Substrate (Pyruvic Acid) And Cofactor Analog (3-Acetylpyridine Adenine Dinucleotide). Length = 317 Back     alignment and structure
>pdb|2ZQY|A Chain A, T-State Structure Of Allosteric L-Lactate Dehydrogenase From Lactobacillus Casei Length = 326 Back     alignment and structure
>pdb|1OC4|A Chain A, Lactate Dehydrogenase From Plasmodium Berghei Length = 322 Back     alignment and structure
>pdb|3VKU|A Chain A, Penta Mutant Of Lactobacillus Casei Lactate Dehydrogenase Length = 326 Back     alignment and structure
>pdb|1CET|A Chain A, Chloroquine Binds In The Cofactor Binding Site Of Plasmodium Falciparum Lactate Dehydrogenase. Length = 316 Back     alignment and structure
>pdb|1LLC|A Chain A, Structure Determination Of The Allosteric L-Lactate Dehydrogenase From Lactobacillus Casei At 3.0 Angstroms Resolution Length = 325 Back     alignment and structure
>pdb|2A92|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Plasmodium Vivax: Complex With Nadh Length = 321 Back     alignment and structure
>pdb|1T2E|A Chain A, Plasmodium Falciparum Lactate Dehydrogenase S245a, A327p Mutant Complexed With Nadh And Oxamate Length = 322 Back     alignment and structure
>pdb|1HYG|A Chain A, Crystal Structure Of Mj0490 Gene Product, The Family Of LactateMALATE DEHYDROGENASE Length = 313 Back     alignment and structure
>pdb|1Y6J|A Chain A, L-Lactate Dehydrogenase From Clostridium Thermocellum Cth-1135 Length = 318 Back     alignment and structure
>pdb|2J5K|A Chain A, 2.0 A Resolution Structure Of The Wild Type Malate Dehydrogenase From Haloarcula Marismortui (radiation Damage Series) Length = 304 Back     alignment and structure
>pdb|1HLP|A Chain A, Structural Features Stabilizing Halophilic Malate Dehydrogenase From An Archaebacterium Length = 303 Back     alignment and structure
>pdb|2HLP|A Chain A, Crystal Structure Of The E267r Mutant Of A Halophilic Malate Dehydrogenase In The Apo Form Length = 303 Back     alignment and structure
>pdb|3OM9|A Chain A, T. Gondii Bradyzoite-Specific Ldh (Ldh1) In Complex With Nad And Oxq Length = 329 Back     alignment and structure
>pdb|1PZE|A Chain A, T.gondii Ldh1 Apo Form Length = 331 Back     alignment and structure
>pdb|3D0O|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Staphylococcus Aureus Length = 317 Back     alignment and structure
>pdb|1PZG|A Chain A, T.Gondii Ldh1 Complexed With Apad And Sulfate At 1.6 Angstroms Length = 331 Back     alignment and structure
>pdb|3H3J|A Chain A, Crystal Structure Of Lactate Dehydrogenase Mutant (A85r) Fro Staphylococcus Aureus Complexed With Nad And Pyruvate Length = 317 Back     alignment and structure
>pdb|2X0R|A Chain A, R207s,R292s Mutant Of Malate Dehydrogenase From The Halophilic Archaeon Haloarcula Marismortui (Holo Form) Length = 304 Back     alignment and structure
>pdb|1O6Z|A Chain A, 1.95 A Resolution Structure Of (r207s,r292s) Mutant Of Malate Dehydrogenase From The Halophilic Archaeon Haloarcula Marismortui (holo Form) Length = 303 Back     alignment and structure
>pdb|4A73|A Chain A, Single Point Mutant Of Thermus Thermophilus Lactate Dehydrogenase Length = 310 Back     alignment and structure
>pdb|2E37|A Chain A, Structure Of Tt0471 Protein From Thermus Thermophilus Length = 310 Back     alignment and structure
>pdb|3PQD|A Chain A, Crystal Structure Of L-Lactate Dehydrogenase From Bacillus Subtilis Complexed With Fbp And Nad+ Length = 326 Back     alignment and structure
>pdb|2LDX|A Chain A, Characterization Of The Antigenic Sites On The Refined 3- Angstroms Resolution Structure Of Mouse Testicular Lactate Dehydrogenase C4 Length = 331 Back     alignment and structure
>pdb|2V6M|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Thermus Thermophilus Hb8 (Apo Form) Length = 310 Back     alignment and structure
>pdb|2V65|A Chain A, Apo Ldh From The Psychrophile C. Gunnari Length = 331 Back     alignment and structure
>pdb|1V6A|A Chain A, Crystal Structure Of L-Lactate Dehydrogenase From Cyprinus Carpio Length = 332 Back     alignment and structure
>pdb|1I10|A Chain A, Human Muscle L-Lactate Dehydrogenase M Chain, Ternary Complex With Nadh And Oxamate Length = 331 Back     alignment and structure
>pdb|4AJP|A Chain A, Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl-1,3- Benzothiazol-6yl)amino)-3-Oxo-Propyl)amino)-4-Oxo-Butyl) Phenyl)methyl)propanedioic Acid Length = 337 Back     alignment and structure
>pdb|4AJ4|A Chain A, Rat Ldha In Complex With 4-((2-Allylsulfanyl-1,3-Benzothizol-6-Yl) Amino)-4-Oxo-Butanoic Acid Length = 332 Back     alignment and structure
>pdb|4AJ1|A Chain A, Rat Ldha In Complex With N-(2-(Methylamino)-1,3- Benzothiazol-6-Yl)acetamide Length = 331 Back     alignment and structure
>pdb|3PQE|A Chain A, Crystal Structure Of L-Lactate Dehydrogenase From Bacillus Subtilis With H171c Mutation Length = 326 Back     alignment and structure
>pdb|2XXB|A Chain A, Penta-Mutant Of Thermus Thermophilus Lactate Dehydrogenase, Complex With Amp Length = 310 Back     alignment and structure
>pdb|1LLD|A Chain A, Molecular Basis Of Allosteric Activation Of Bacterial L-Lactate Dehydrogenase Length = 319 Back     alignment and structure
>pdb|1EZ4|A Chain A, Crystal Structure Of Non-Allosteric L-Lactate Dehydrogenase From Lactobacillus Pentosus At 2.3 Angstrom Resolution Length = 318 Back     alignment and structure
>pdb|9LDT|A Chain A, Design And Synthesis Of New Enzymes Based On The Lactate Dehydrogenase Framework Length = 332 Back     alignment and structure
>pdb|1LDB|A Chain A, Structure Determination And Refinement Of Bacillus Stearothermophilus Lactate Dehydrogenase Length = 317 Back     alignment and structure
>pdb|1LDN|A Chain A, Structure Of A Ternary Complex Of An Allosteric Lactate Dehydrogenase From Bacillus Stearothermophilus At 2.5 Angstroms Resolution Length = 316 Back     alignment and structure
>pdb|2X0I|A Chain A, 2.9 A Resolution Structure Of Malate Dehydrogenase From Archaeoglobus Fulgidus In Complex With Nadh Length = 294 Back     alignment and structure
>pdb|3H3F|A Chain A, Rabbit Muscle L-Lactate Dehydrogenase In Complex With Nadh And Oxamate Length = 331 Back     alignment and structure
>pdb|3FI9|A Chain A, Crystal Structure Of Malate Dehydrogenase From Porphyromonas Gingivalis Length = 343 Back     alignment and structure
>pdb|2V6B|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Deinococcus Radiodurans (Apo Form) Length = 304 Back     alignment and structure
>pdb|4H7P|A Chain A, Crystal Structure Of A Putative Cytosolic Malate Dehydrogenase From Leishmania Major Friedlin Length = 345 Back     alignment and structure
>pdb|1T2F|A Chain A, Human B Lactate Dehydrogenase Complexed With Nad+ And 4- Hydroxy-1,2,5-Oxadiazole-3-Carboxylic Acid Length = 333 Back     alignment and structure
>pdb|1I0Z|A Chain A, Human Heart L-Lactate Dehydrogenase H Chain, Ternary Complex With Nadh And Oxamate Length = 333 Back     alignment and structure
>pdb|4MDH|A Chain A, Refined Crystal Structure Of Cytoplasmic Malate Dehydrogenase At 2.5-Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|5MDH|A Chain A, Crystal Structure Of Ternary Complex Of Porcine Cytoplasmic Malate Dehydrogenase Alpha-Ketomalonate And Tnad At 2.4 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|5LDH|A Chain A, Structure Of The Active Ternary Complex Of Pig Heart Lactate Dehydrogenase With S-Lac-Nad At 2.7 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|6LDH|A Chain A, Refined Crystal Structure Of Dogfish M4 Apo-Lactate Dehydrogenase Length = 330 Back     alignment and structure
>pdb|1LDM|A Chain A, Refined Crystal Structure Of Dogfish M4 Apo-Lactate Dehydrogenase Length = 329 Back     alignment and structure
>pdb|1CIV|A Chain A, Chloroplast Nadp-Dependent Malate Dehydrogenase From Flaveria Bidentis Length = 385 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 1e-140
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 1e-137
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 1e-137
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 3e-44
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 7e-40
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 1e-38
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 1e-38
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 2e-38
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 2e-38
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 3e-38
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 3e-38
3tl2_A315 Malate dehydrogenase; center for structural genomi 3e-38
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 3e-38
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 2e-37
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 4e-37
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 3e-36
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 4e-36
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 8e-36
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 9e-36
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 1e-35
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 1e-35
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 2e-35
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 4e-35
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 6e-35
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 1e-34
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 2e-34
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 3e-34
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 2e-32
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 3e-32
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 1e-31
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 3e-31
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 7e-31
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 2e-30
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 2e-30
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 3e-30
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 1e-29
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Length = 326 Back     alignment and structure
 Score =  395 bits (1016), Expect = e-140
 Identities = 219/243 (90%), Positives = 229/243 (94%)

Query: 2   DIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAE 61
           D++I+PAGVPRKPGMTRDDLF INAGIVKTLCEGIAKCCP+AIVNLISNPVNSTVPIAAE
Sbjct: 78  DLIIVPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPRAIVNLISNPVNSTVPIAAE 137

Query: 62  VFKKVGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVK 121
           VFKK GTYDPKRLLGVTMLDVVRANTFVAEVLGLDPR+VDVPVVGGHAGVTILPLLSQVK
Sbjct: 138 VFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTILPLLSQVK 197

Query: 122 PSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVI 181
           P  S T  EI YLTDRIQNGGTEVVEAK GAGSATLSMAYAA KFADACLRGLRGDAGVI
Sbjct: 198 PPSSFTQEEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVKFADACLRGLRGDAGVI 257

Query: 182 ECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVSF 241
           ECA+V+S VTELPFFASKVRLGR GIEE+YSLGPLNEYER GLEKAKKELAGSI+KGVSF
Sbjct: 258 ECAFVSSQVTELPFFASKVRLGRNGIEEVYSLGPLNEYERIGLEKAKKELAGSIEKGVSF 317

Query: 242 VRK 244
           +R 
Sbjct: 318 IRS 320
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Length = 312 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Length = 314 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Length = 343 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Length = 308 Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Length = 314 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Length = 310 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Length = 309 Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Length = 313 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Length = 317 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Length = 303 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Length = 315 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Length = 328 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Length = 324 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Length = 321 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Length = 322 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Length = 316 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Length = 326 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Length = 318 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Length = 326 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Length = 319 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Length = 331 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Length = 317 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Length = 331 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Length = 310 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Length = 319 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Length = 318 Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Length = 333 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Length = 304 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ojs_A* 2x0i_A* 2x0j_A* Length = 294 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Length = 327 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Length = 303 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Length = 309 Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Length = 375 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Length = 329 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Length = 330 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 100.0
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 100.0
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 100.0
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 100.0
3tl2_A315 Malate dehydrogenase; center for structural genomi 100.0
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 100.0
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 100.0
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 100.0
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 100.0
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 100.0
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 100.0
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 100.0
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 100.0
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 100.0
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 100.0
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 100.0
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 100.0
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 100.0
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 100.0
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 100.0
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 100.0
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 100.0
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 100.0
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 100.0
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 100.0
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 100.0
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 100.0
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 100.0
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 100.0
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 100.0
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 100.0
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 100.0
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 100.0
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 100.0
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 100.0
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 100.0
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 100.0
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 100.0
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 100.0
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 100.0
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 100.0
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 100.0
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 99.93
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 99.91
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 99.86
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
Probab=100.00  E-value=9.1e-63  Score=434.88  Aligned_cols=242  Identities=56%  Similarity=0.866  Sum_probs=221.6

Q ss_pred             CcEEEEcCCCCCCCCCCHHHHHHHhHHHHHHHHHHHHhhCCCcEEEEecCCCCCcHHHHHHHHHHhCCC-CCCCeEEech
Q 026051            1 MDIVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEGIAKCCPKAIVNLISNPVNSTVPIAAEVFKKVGTY-DPKRLLGVTM   79 (244)
Q Consensus         1 aDiviitag~~~~~g~~r~~l~~~N~~i~~~i~~~i~~~~p~~~iiv~tNPvd~~~~ilt~~~~~~~~~-~~~~viG~t~   79 (244)
                      |||||||||.||+|||+|+||++.|++|++++++.+.++||+++++++|||+|.+|+++++ ++|.+|+ |++||+|+|.
T Consensus        70 aDivii~ag~~rkpG~~R~dll~~N~~I~~~i~~~i~~~~p~a~vlvvtNPvd~~t~~a~~-~~k~sg~~p~~rv~G~~~  148 (312)
T 3hhp_A           70 ADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE-VLKKAGVYDKNKLFGVTT  148 (312)
T ss_dssp             CSEEEECCSCSCCTTCCHHHHHHHHHHHHHHHHHHHHHHCTTSEEEECSSCHHHHHHHHHH-HHHHTTCCCTTSEEECCH
T ss_pred             CCEEEEeCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCcEEEEecCcchhHHHHHHH-HHHHcCCCCcceEEEEec
Confidence            7999999999999999999999999999999999999999999999999999944433332 6778887 9999999999


Q ss_pred             hhHHHHHHHHHHHhCCCCCcceeeEeccCCCceeeeccccCCCCCCCChhHHHHHHHHHhcCcceeeeccCCCCchhHHH
Q 026051           80 LDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATLSM  159 (244)
Q Consensus        80 ld~~R~~~~la~~l~v~~~~v~~~viG~h~g~~~vp~~s~~~~~~~~~~~~~~~l~~~v~~~~~~ii~~k~~~g~~~~s~  159 (244)
                      ||++|++++||+++|++|++|+++|||||+|+|++|+||++ ....+++++|+++.++++++|++|++.|.|+|+++||+
T Consensus       149 LD~~R~~~~la~~lgv~~~~v~~~V~G~Hsg~t~vp~~S~~-~g~~~~~~~~~~i~~~v~~~g~eIi~~k~g~gst~~s~  227 (312)
T 3hhp_A          149 LDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQV-PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSM  227 (312)
T ss_dssp             HHHHHHHHHHHHHHTCCGGGCCCCEEECSSGGGEEECGGGC-TTCCCCHHHHHHHHHHHHTHHHHHHHHTTTSCCCCHHH
T ss_pred             hhHHHHHHHHHHHhCcChhHcceeEEeccCCCceeeecccC-CCCCCCHHHHHHHHHHHHhhhHHHHhhccCCCCchhHH
Confidence            99999999999999999999999999999779999999998 33357788899999999999999999876779999999


Q ss_pred             HHHHHHHHHHHHhccCCCCCeeeeeEecCCCCCccEEEEeEEEcCCceEEEccCCCCCHHHHHHHHHHHHHHHHHHHHhh
Q 026051          160 AYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGV  239 (244)
Q Consensus       160 a~a~~~~i~ai~~~~~~~~~~~~~~~~~~~~~~~~~~s~Pv~ig~~Gv~~i~~~~~L~~~E~~~l~~s~~~l~~~~~~~~  239 (244)
                      |+|+++++++|+.+++|++.++||++++++..+++|||+||++|++|+++++++++|+++|+++|++|++.|++++++++
T Consensus       228 a~a~~~~~~ai~~~l~~~~~v~~~s~~~g~g~~~v~~s~P~~~g~~Gv~~v~~~~~L~~~E~~~l~~s~~~l~~~i~~g~  307 (312)
T 3hhp_A          228 GQAAARFGLSLVRALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIALGE  307 (312)
T ss_dssp             HHHHHHHHHHHHHHHTTCSSCEEEEEEECCCSSCSEEEEEEEEETTEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHcCCCCceEEEEEecCCCCcceEEEeEEEEeCCEEEEEcCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999877777889999998876544578999999999999999999878999999999999999999999999


Q ss_pred             hhhhC
Q 026051          240 SFVRK  244 (244)
Q Consensus       240 ~~~~~  244 (244)
                      +|+++
T Consensus       308 ~~~~~  312 (312)
T 3hhp_A          308 EFVNK  312 (312)
T ss_dssp             HHHTC
T ss_pred             HHhhC
Confidence            99864
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 244
d1mlda2169 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (S 3e-50
d2cmda2167 d.162.1.1 (A:146-312) Malate dehydrogenase {Escher 1e-49
d1guza2163 d.162.1.1 (A:143-305) Malate dehydrogenase {Chloro 2e-31
d1uxja2164 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloro 4e-30
d1ldma2169 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfi 3e-26
d5mdha2179 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (S 4e-26
d1llda2170 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifid 8e-25
d1ez4a2171 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lacto 2e-24
d1a5za2172 d.162.1.1 (A:164-333) Lactate dehydrogenase {Therm 5e-24
d1llca2172 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lacto 9e-24
d2ldxa2172 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse 9e-24
d1hyea2168 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehyd 2e-23
d1ldna2168 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacil 3e-23
d1hyha2163 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehy 3e-23
d1o6za2161 d.162.1.1 (A:163-330) Malate dehydrogenase {Archae 3e-23
d1i0za2172 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human 9e-23
d1y6ja2169 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clost 2e-22
d1t2da2165 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malar 3e-21
d1pzga2174 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxop 4e-21
d1mlda1144 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus s 6e-21
d2cmda1145 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichi 2e-20
d1y7ta2173 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermu 1e-19
d1b8pa2171 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquasp 1e-19
d7mdha2188 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghu 3e-19
d1guza1142 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium 1e-17
d1y7ta1154 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus th 1e-17
d1llda1143 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobac 2e-17
d1ojua1142 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon 2e-17
d1a5za1140 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto 4e-15
d1uxja1142 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflex 9e-15
d7mdha1175 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( 2e-14
d1ez4a1146 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobac 2e-14
d5mdha1154 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s 2e-14
d1o6za1142 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon 3e-14
d2ldxa1159 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mu 3e-14
d1y6ja1142 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi 6e-14
d1pzga1154 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplas 7e-14
d1t2da1150 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria p 1e-13
d1ldna1148 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus 2e-13
d1ojua2152 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archa 4e-13
d1i0za1160 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Ho 4e-13
d1hyha1146 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydro 1e-12
d1up7a1162 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Ther 2e-11
d1hyea1145 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydroge 2e-11
d1s6ya1169 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Baci 8e-11
d1u8xx1167 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase 1e-09
d1obba1171 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermoto 9e-09
>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 169 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: LDH C-terminal domain-like
superfamily: LDH C-terminal domain-like
family: Lactate & malate dehydrogenases, C-terminal domain
domain: Malate dehydrogenase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  159 bits (404), Expect = 3e-50
 Identities = 84/167 (50%), Positives = 114/167 (68%)

Query: 77  VTMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTD 136
           VT LD+VRAN FVAE+ GLDP  V VPV+GGHAG TI+PL+SQ  P       ++  LT 
Sbjct: 1   VTTLDIVRANAFVAELKGLDPARVSVPVIGGHAGKTIIPLISQCTPKVDFPQDQLSTLTG 60

Query: 137 RIQNGGTEVVEAKTGAGSATLSMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFF 196
           RIQ  GTEVV+AK GAGSATLSMAYA A+F  + +  + G  GV+EC++V S  T+ P+F
Sbjct: 61  RIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETDCPYF 120

Query: 197 ASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQKGVSFVR 243
           ++ + LG+ GIE+   +G ++ +E   + +A  EL  SI+KG  FV+
Sbjct: 121 STPLLLGKKGIEKNLGIGKISPFEEKMIAEAIPELKASIKKGEEFVK 167
>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 167 Back     information, alignment and structure
>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 163 Back     information, alignment and structure
>d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 164 Back     information, alignment and structure
>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Length = 169 Back     information, alignment and structure
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 179 Back     information, alignment and structure
>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 170 Back     information, alignment and structure
>d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 171 Back     information, alignment and structure
>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 172 Back     information, alignment and structure
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 172 Back     information, alignment and structure
>d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 168 Back     information, alignment and structure
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 163 Back     information, alignment and structure
>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 161 Back     information, alignment and structure
>d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 169 Back     information, alignment and structure
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 Back     information, alignment and structure
>d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 174 Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 145 Back     information, alignment and structure
>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 173 Back     information, alignment and structure
>d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Length = 171 Back     information, alignment and structure
>d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 188 Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 154 Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 143 Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 142 Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 154 Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 150 Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 Back     information, alignment and structure
>d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 152 Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 146 Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Length = 162 Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 145 Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Length = 169 Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Length = 167 Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
d1mlda2169 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 100.0
d2cmda2167 Malate dehydrogenase {Escherichia coli [TaxId: 562 100.0
d1ojua2152 Lactate dehydrogenase {Archaeon Archaeoglobus fulg 100.0
d1guza2163 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 100.0
d1uxja2164 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 100.0
d1ez4a2171 Lactate dehydrogenase {Lactobacillus pentosus [Tax 100.0
d1llda2170 Lactate dehydrogenase {Bifidobacterium longum, str 100.0
d5mdha2179 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 100.0
d1y6ja2169 Lactate dehydrogenase {Clostridium thermocellum [T 100.0
d1pzga2174 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 100.0
d1a5za2172 Lactate dehydrogenase {Thermotoga maritima [TaxId: 100.0
d7mdha2188 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 100.0
d1hyea2168 MJ0490, lactate/malate dehydrogenase {Archaeon Met 100.0
d1hyha2163 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 100.0
d1t2da2165 Lactate dehydrogenase {Malaria parasite (Plasmodiu 100.0
d1ldna2168 Lactate dehydrogenase {Bacillus stearothermophilus 100.0
d1o6za2161 Malate dehydrogenase {Archaeon Haloarcula marismor 100.0
d1i0za2172 Lactate dehydrogenase {Human (Homo sapiens), heart 100.0
d1llca2172 Lactate dehydrogenase {Lactobacillus casei [TaxId: 100.0
d1ldma2169 Lactate dehydrogenase {Dogfish (Squalus acanthias) 100.0
d2ldxa2172 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 99.97
d1y7ta2173 Malate dehydrogenase {Thermus thermophilus [TaxId: 99.97
d1b8pa2171 Malate dehydrogenase {Aquaspirillum arcticum [TaxI 99.97
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 99.9
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 99.89
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.89
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 99.88
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 99.88
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 99.88
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 99.87
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 99.87
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 99.86
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 99.86
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 99.86
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 99.86
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 99.85
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 99.84
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 99.84
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 99.84
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 99.83
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 99.82
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 99.82
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.81
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 99.72
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 99.65
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 99.6
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 99.44
d1up7a2253 6-phospho-beta-glucosidase {Thermotoga maritima [T 98.38
d1s6ya2270 6-phospho-beta-glucosidase {Bacillus stearothermop 98.33
d1u8xx2276 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 97.46
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 97.29
d1obba2308 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 97.09
d1vjta2278 Putative alpha-glucosidase TM0752 {Thermotoga mari 96.99
>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: LDH C-terminal domain-like
superfamily: LDH C-terminal domain-like
family: Lactate & malate dehydrogenases, C-terminal domain
domain: Malate dehydrogenase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=3.8e-37  Score=247.16  Aligned_cols=166  Identities=50%  Similarity=0.834  Sum_probs=148.5

Q ss_pred             chhhHHHHHHHHHHHhCCCCCcceeeEeccCCCceeeeccccCCCCCCCChhHHHHHHHHHhcCcceeeeccCCCCchhH
Q 026051           78 TMLDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPSCSLTPTEIDYLTDRIQNGGTEVVEAKTGAGSATL  157 (244)
Q Consensus        78 t~ld~~R~~~~la~~l~v~~~~v~~~viG~h~g~~~vp~~s~~~~~~~~~~~~~~~l~~~v~~~~~~ii~~k~~~g~~~~  157 (244)
                      |.|||+||+++||++|+++|++|+++|+|||||++++|+||++.+.+.++.++++++.+++++++++|++.|++.+++.+
T Consensus         2 T~LDs~R~~~~la~~l~v~~~~V~~~ViGeHg~~t~vp~~s~~~~~~~~~~~~~~~l~~~v~~~~~eii~~k~~~~~~~~   81 (169)
T d1mlda2           2 TTLDIVRANAFVAELKGLDPARVSVPVIGGHAGKTIIPLISQCTPKVDFPQDQLSTLTGRIQEAGTEVVKAKAGAGSATL   81 (169)
T ss_dssp             CHHHHHHHHHHHHHHTTCCGGGCBCCEEECSSGGGEEECGGGCBSCCCCCHHHHHHHHHHHHHHHHHHHHHHTTSCSCCH
T ss_pred             cccHHHHHHHHHHHHHCcCHHHeeEEEEEcCCCcceeehhhhhccCCCCcHHHHHHHHHHHHHhHHHHHHhhcCcChHhH
Confidence            78999999999999999999999999999998899999999998877788889999999999999999999877788888


Q ss_pred             HHHHHHHHHHHHHHhccCCCCCeeeeeEecCCCCCccEEEEeEEEcCCceEEEccCCCCCHHHHHHHHHHHHHHHHHHHH
Q 026051          158 SMAYAAAKFADACLRGLRGDAGVIECAYVASTVTELPFFASKVRLGRAGIEEIYSLGPLNEYERAGLEKAKKELAGSIQK  237 (244)
Q Consensus       158 s~a~a~~~~i~ai~~~~~~~~~~~~~~~~~~~~~~~~~~s~Pv~ig~~Gv~~i~~~~~L~~~E~~~l~~s~~~l~~~~~~  237 (244)
                      +.++++++++.+++.+..+...+.++++...+..+++|||+||+||++|+++++++++|+++|+++|++|++.||+.|++
T Consensus        82 ~~~~a~~~~~~~i~~~~~~~~~v~~~~~~~~~~~~~v~~s~P~~ig~~Gi~~v~~l~~L~~~E~~~l~~s~~~lk~~I~~  161 (169)
T d1mlda2          82 SMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETDCPYFSTPLLLGKKGIEKNLGIGKISPFEEKMIAEAIPELKASIKK  161 (169)
T ss_dssp             HHHHHHHHHHHHHHHHHHTCTTCEEEEEEECCSSSSSEEEEEEEEETTEEEEECCCCSCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhccccCCceEEEEEeeccccccCCEeEeeeEEEcCCccEEEecCCCCCHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999998876555566665544333346789999999999999999998679999999999999999999999


Q ss_pred             hhhhhh
Q 026051          238 GVSFVR  243 (244)
Q Consensus       238 ~~~~~~  243 (244)
                      +++|+.
T Consensus       162 g~~fi~  167 (169)
T d1mlda2         162 GEEFVK  167 (169)
T ss_dssp             HHHHHT
T ss_pred             HHHHHh
Confidence            999985
>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Back     information, alignment and structure
>d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1up7a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya2 d.162.1.2 (A:173-445) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vjta2 d.162.1.2 (A:192-469) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure