Citrus Sinensis ID: 026436

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MTSSPAPTVAGSSFHGNINSSSSLISQGSYLDQFCSKKKVQEPRRVSSVIRDPSHAQDHVIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLKQLQERVKALEEQTSKKTVESMIIVKKSQMIYTDDETSPTDINFDAQSNQYLPEIEVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESDVTVKDLVKNLQPALRKFM
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccEEEEEEccEEEEEEEccccccccHHHHHHHHHHccccEEEEEEEEEEEcccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHcccEEEEccEccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHc
mtsspaptvagssfhgninsssslisqgsyldqfcskkkvqeprrvssvirdpshaqdHVIAERKRREKLNQRFIALSAlvpglkktdkasiLGDSIKYLKQLQERVKALEEQTSKKTVESMIIVKKSqmiytddetsptdinfdaqsnqylpeievrvsdrDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLscnvlpfgnstVDITVVAQMDVESDVTVKDLVKNLQPALRKFM
mtsspaptvagssfhgniNSSSSLISQGSYLDQFCSKKKvqeprrvssvirdpshaqdhviAERKRREKLNQRFIAlsalvpglkktdkaSILGDSIKYLKQLQERVKAleeqtskktvesmiivkksqmiytdDETSPTDINFDAQSNQYLPEIEVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMdvesdvtvkDLVKNLQPALRKFM
MTSSPAPTVAgssfhgninsssslisqgsYLDQFCSKKKVQEPRRVSSVIRDPSHAQDHVIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLKQLQERVKALEEQTSKKTVESMIIVKKSQMIYTDDETSPTDINFDAQSNQYLPEIEVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESDVTVKDLVKNLQPALRKFM
**********************************************************************NQRFIALSALVPGLKKTDKASILGDSIKYLKQLQ****************SMIIVKKSQMIYT********INFDAQSNQYLPEIEVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESDVTVKDLVK**********
*****************************************************************RREKLNQRFIALSALVPGLKKTDKASILGDSIKYLKQLQ***************************************************EVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDV**DVTVKDLVKNLQPALRKFM
**********GSSFHGNINSSSSLISQGSYLDQFCS***********************VIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLKQLQERVKALEEQTSKKTVESMIIVKKSQMIYTDDETSPTDINFDAQSNQYLPEIEVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESDVTVKDLVKNLQPALRKFM
*******************************************************AQDHVIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLKQLQERVKALEEQTSKKTVESMIIVKKS*********************QYLPEIEVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESDVTVKDLVKNLQPALRKFM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSSPAPTVAGSSFHGNINSSSSLISQGSYLDQFCSKKKVQEPRRVSSVIRDPSHAQDHVIAERKRREKLNQRFIALSALVPGLKKTDKASIxxxxxxxxxxxxxxxxxxxxxxxxxxxxSMIIVKKSQMIYTDDETSPTDINFDAQSNQYLPEIEVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESDVTVKDLVKNLQPALRKFM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query238 2.2.26 [Sep-21-2011]
Q9T072328 Transcription factor bHLH yes no 0.802 0.582 0.548 2e-50
Q1PF16295 Transcription factor bHLH no no 0.743 0.6 0.521 7e-43
Q1PF17305 Transcription factor bHLH no no 0.810 0.632 0.509 2e-42
Q8S3F1320 Transcription factor NAI1 no no 0.760 0.565 0.507 7e-41
Q9FIP9592 Transcription factor ATR2 no no 0.697 0.280 0.322 2e-15
O49687589 Transcription factor MYC4 no no 0.680 0.275 0.344 2e-15
Q39204623 Transcription factor MYC2 no no 0.714 0.272 0.335 3e-15
P13027612 Anthocyanin regulatory R- N/A no 0.571 0.222 0.331 4e-15
Q9ZPY8566 Transcription factor ABA- no no 0.394 0.166 0.380 4e-15
P13526610 Anthocyanin regulatory Lc N/A no 0.558 0.218 0.325 1e-14
>sp|Q9T072|BH025_ARATH Transcription factor bHLH25 OS=Arabidopsis thaliana GN=BHLH25 PE=2 SV=2 Back     alignment and function desciption
 Score =  199 bits (505), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 107/195 (54%), Positives = 146/195 (74%), Gaps = 4/195 (2%)

Query: 44  RRVSSVIRDPSHAQDHVIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLKQL 103
           +R     R+ S+AQDH+IAERKRREKL QRF+ALSALVPGLKK DKAS+LGD++K++K L
Sbjct: 138 KRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMDKASVLGDALKHIKYL 197

Query: 104 QERVKALEEQTSKKTVESMIIVKKSQMIYTDDETSPTDINFDAQSNQYLPEIEVRVSDRD 163
           QERV  LEEQ  ++ +ESM++VKKS++I  D+  S +    D  S+  LPEIEVR SD D
Sbjct: 198 QERVGELEEQKKERRLESMVLVKKSKLILDDNNQSFSSSCEDGFSDLDLPEIEVRFSDED 257

Query: 164 VLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESDVTV 223
           VLI+I CEK   KGHLA I++EIE +H L + + +VL FG  T+DIT++A+ + + D+T+
Sbjct: 258 VLIKILCEK--QKGHLAKIMAEIEKLHIL-ITNSSVLNFG-PTLDITIIAKKESDFDMTL 313

Query: 224 KDLVKNLQPALRKFM 238
            D+VK+L+ AL  F+
Sbjct: 314 MDVVKSLRSALSNFI 328

Arabidopsis thaliana (taxid: 3702)
>sp|Q1PF16|BH019_ARATH Transcription factor bHLH19 OS=Arabidopsis thaliana GN=BHLH19 PE=2 SV=1 Back     alignment and function description
>sp|Q1PF17|BH018_ARATH Transcription factor bHLH18 OS=Arabidopsis thaliana GN=BHLH18 PE=2 SV=1 Back     alignment and function description
>sp|Q8S3F1|BH020_ARATH Transcription factor NAI1 OS=Arabidopsis thaliana GN=NAI1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIP9|ATR2_ARATH Transcription factor ATR2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 Back     alignment and function description
>sp|O49687|BH004_ARATH Transcription factor MYC4 OS=Arabidopsis thaliana GN=BHLH4 PE=2 SV=1 Back     alignment and function description
>sp|Q39204|RAP1_ARATH Transcription factor MYC2 OS=Arabidopsis thaliana GN=RAP1 PE=1 SV=2 Back     alignment and function description
>sp|P13027|ARRS_MAIZE Anthocyanin regulatory R-S protein OS=Zea mays GN=R-S PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPY8|AIB_ARATH Transcription factor ABA-INDUCIBLE bHLH-TYPE OS=Arabidopsis thaliana GN=AIB PE=2 SV=2 Back     alignment and function description
>sp|P13526|ARLC_MAIZE Anthocyanin regulatory Lc protein OS=Zea mays GN=LC PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
147818973 365 hypothetical protein VITISV_026466 [Viti 0.920 0.6 0.620 6e-66
359480528 365 PREDICTED: transcription factor bHLH25-l 0.920 0.6 0.620 2e-65
255576031331 DNA binding protein, putative [Ricinus c 0.802 0.577 0.646 1e-62
297735856186 unnamed protein product [Vitis vinifera] 0.773 0.989 0.659 1e-60
297736346 344 unnamed protein product [Vitis vinifera] 0.886 0.613 0.555 3e-58
359475553331 PREDICTED: transcription factor bHLH25-l 0.886 0.637 0.555 4e-58
225438169 358 PREDICTED: transcription factor bHLH25-l 0.873 0.581 0.591 8e-58
296088946334 unnamed protein product [Vitis vinifera] 0.873 0.622 0.591 8e-58
297735854 350 unnamed protein product [Vitis vinifera] 0.865 0.588 0.600 1e-57
359480524 351 PREDICTED: transcription factor bHLH25-l 0.865 0.586 0.600 1e-57
>gi|147818973|emb|CAN67117.1| hypothetical protein VITISV_026466 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  256 bits (654), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 168/224 (75%), Gaps = 5/224 (2%)

Query: 15  HGNINSSSSLISQGSYLDQFCSKKKVQEPRRVSSVIRDPSHAQDHVIAERKRREKLNQRF 74
           HGN+N  S  IS+GSY +Q    K  Q  +RV+ + R  SHAQDH++AERKRREKL+QRF
Sbjct: 147 HGNVNFPSQ-ISKGSYENQNYVPKANQGTKRVTPMRRTSSHAQDHIMAERKRREKLSQRF 205

Query: 75  IALSALVPGLKKTDKASILGDSIKYLKQLQERVKALEEQTSKKTVESMIIVKKSQMIYTD 134
           IALSALVPGLKK DKAS+LGD+IKYLKQLQERVK+LEEQ  + TVES++ +KKSQ+   D
Sbjct: 206 IALSALVPGLKKMDKASVLGDAIKYLKQLQERVKSLEEQMKETTVESVVFIKKSQL-SAD 264

Query: 135 DETSPTDINFDAQSNQYLPEIEVRVSDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSV 194
           DETS  D NFD      + +IE RVSD++VLIRIHC+K   KG +A +L EIE  HHLSV
Sbjct: 265 DETSSCDENFDGCREDAVRDIEARVSDKNVLIRIHCKK--QKGFVAKVLGEIEE-HHLSV 321

Query: 195 LSCNVLPFGNSTVDITVVAQMDVESDVTVKDLVKNLQPALRKFM 238
           ++ +VLPFG   +DITVVAQM  E  VTVKDLV NL+ A  KFM
Sbjct: 322 VNSSVLPFGKHAMDITVVAQMGDEXQVTVKDLVNNLRLAFLKFM 365

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359480528|ref|XP_002270448.2| PREDICTED: transcription factor bHLH25-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255576031|ref|XP_002528911.1| DNA binding protein, putative [Ricinus communis] gi|223531665|gb|EEF33491.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297735856|emb|CBI18610.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736346|emb|CBI25069.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475553|ref|XP_002268443.2| PREDICTED: transcription factor bHLH25-like [Vitis vinifera] gi|147839680|emb|CAN75020.1| hypothetical protein VITISV_039940 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225438169|ref|XP_002262764.1| PREDICTED: transcription factor bHLH25-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088946|emb|CBI38512.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735854|emb|CBI18608.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480524|ref|XP_002262843.2| PREDICTED: transcription factor bHLH25-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
TAIR|locus:2137574328 AT4G37850 "AT4G37850" [Arabido 0.802 0.582 0.548 2.9e-48
UNIPROTKB|Q75GI1359 OSJNBa0013A09.16 "Putative tra 0.764 0.506 0.537 4.2e-47
TAIR|locus:2062225305 AT2G22750 "AT2G22750" [Arabido 0.806 0.629 0.517 2.3e-46
TAIR|locus:2062235320 NAI1 "AT2G22770" [Arabidopsis 0.756 0.562 0.520 1.9e-42
TAIR|locus:2062230295 AT2G22760 "AT2G22760" [Arabido 0.760 0.613 0.505 1.7e-41
UNIPROTKB|Q2QLR0338 LOC_Os12g43620 "Helix-loop-hel 0.663 0.467 0.464 1.8e-32
UNIPROTKB|Q8LSP3451 OJ1203D03.3 "Helix-loop-helix 0.701 0.370 0.448 3.3e-31
UNIPROTKB|Q84R60353 OSJNBb0113I20.8 "Putative ammo 0.659 0.444 0.449 3e-30
UNIPROTKB|Q84R79301 OSJNBb0113I20.1 "Putative ammo 0.651 0.514 0.427 5e-28
UNIPROTKB|Q336P5699 Os10g0575000 "Os10g0575000 pro 0.554 0.188 0.407 1.3e-18
TAIR|locus:2137574 AT4G37850 "AT4G37850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 504 (182.5 bits), Expect = 2.9e-48, P = 2.9e-48
 Identities = 107/195 (54%), Positives = 146/195 (74%)

Query:    44 RRVSSVIRDPSHAQDHVIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLKQL 103
             +R     R+ S+AQDH+IAERKRREKL QRF+ALSALVPGLKK DKAS+LGD++K++K L
Sbjct:   138 KRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMDKASVLGDALKHIKYL 197

Query:   104 QERVKALEEQTSKKTVESMIIVKKSQMIYTDDETSPTDINFDAQSNQYLPEIEVRVSDRD 163
             QERV  LEEQ  ++ +ESM++VKKS++I  D+  S +    D  S+  LPEIEVR SD D
Sbjct:   198 QERVGELEEQKKERRLESMVLVKKSKLILDDNNQSFSSSCEDGFSDLDLPEIEVRFSDED 257

Query:   164 VLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESDVTV 223
             VLI+I CEK   KGHLA I++EIE +H L + + +VL FG  T+DIT++A+ + + D+T+
Sbjct:   258 VLIKILCEKQ--KGHLAKIMAEIEKLHIL-ITNSSVLNFG-PTLDITIIAKKESDFDMTL 313

Query:   224 KDLVKNLQPALRKFM 238
              D+VK+L+ AL  F+
Sbjct:   314 MDVVKSLRSALSNFI 328
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
UNIPROTKB|Q75GI1 OSJNBa0013A09.16 "Putative transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2062225 AT2G22750 "AT2G22750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062235 NAI1 "AT2G22770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062230 AT2G22760 "AT2G22760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QLR0 LOC_Os12g43620 "Helix-loop-helix DNA-binding domain containing protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8LSP3 OJ1203D03.3 "Helix-loop-helix DNA-binding domain containing protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84R60 OSJNBb0113I20.8 "Putative ammonium transporter" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84R79 OSJNBb0113I20.1 "Putative ammonium transporter" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q336P5 Os10g0575000 "Os10g0575000 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
smart0035353 smart00353, HLH, helix loop helix domain 3e-12
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 6e-12
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 1e-10
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information 
 Score = 59.2 bits (144), Expect = 3e-12
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 3/51 (5%)

Query: 61  IAERKRREKLNQRFIALSALVPGL---KKTDKASILGDSIKYLKQLQERVK 108
             ER+RR K+N+ F  L +L+P L   KK  KA IL  +I+Y+K LQE ++
Sbjct: 2   ARERRRRRKINEAFDELRSLLPTLPKNKKLSKAEILRLAIEYIKSLQEELQ 52

Length = 53
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 238
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.48
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.47
smart0035353 HLH helix loop helix domain. 99.41
KOG1318411 consensus Helix loop helix transcription factor EB 99.26
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 99.06
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.64
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.6
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 98.51
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.45
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 98.44
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.43
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.42
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.38
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.36
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.25
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.97
KOG0561 373 consensus bHLH transcription factor [Transcription 97.96
PLN0321793 transcription factor ATBS1; Provisional 97.93
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.92
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.71
PRK05007884 PII uridylyl-transferase; Provisional 97.68
KOG4029228 consensus Transcription factor HAND2/Transcription 97.67
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.49
PRK01759854 glnD PII uridylyl-transferase; Provisional 97.4
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 97.37
PRK00275895 glnD PII uridylyl-transferase; Provisional 97.37
PRK04374869 PII uridylyl-transferase; Provisional 97.35
PRK05092931 PII uridylyl-transferase; Provisional 97.24
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.08
PRK03381774 PII uridylyl-transferase; Provisional 97.0
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.91
TIGR01693 850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.91
PRK03059856 PII uridylyl-transferase; Provisional 96.82
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 96.8
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 96.74
PRK05007 884 PII uridylyl-transferase; Provisional 96.7
PRK01759 854 glnD PII uridylyl-transferase; Provisional 96.68
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 96.65
PRK03381 774 PII uridylyl-transferase; Provisional 96.64
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.59
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.44
PRK05092 931 PII uridylyl-transferase; Provisional 96.32
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.28
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.25
PRK03059 856 PII uridylyl-transferase; Provisional 96.13
PRK0019490 hypothetical protein; Validated 96.12
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.08
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 96.06
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 96.03
PRK04435147 hypothetical protein; Provisional 95.78
PRK00275 895 glnD PII uridylyl-transferase; Provisional 95.78
KOG4447173 consensus Transcription factor TWIST [Transcriptio 95.78
KOG3910632 consensus Helix loop helix transcription factor [T 95.66
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 95.59
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 95.56
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 95.54
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 95.33
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 95.2
PRK04374 869 PII uridylyl-transferase; Provisional 94.93
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 94.75
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 94.67
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 94.56
PRK08577136 hypothetical protein; Provisional 94.32
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 94.04
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 94.03
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 93.82
cd0211660 ACT ACT domains are commonly involved in specifica 93.58
KOG3898254 consensus Transcription factor NeuroD and related 93.57
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 93.48
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 93.41
PRK07334403 threonine dehydratase; Provisional 92.42
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 92.17
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 92.15
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 91.63
COG4492150 PheB ACT domain-containing protein [General functi 91.38
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 91.04
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 91.0
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 90.8
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 90.67
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 90.55
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 90.35
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 90.31
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 90.3
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 90.22
KOG4395285 consensus Transcription factor Atonal, contains HT 89.82
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 88.78
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 87.99
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 86.87
PRK11589190 gcvR glycine cleavage system transcriptional repre 86.27
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 86.16
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 85.77
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 85.73
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 85.56
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 84.84
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 83.96
PRK11589 190 gcvR glycine cleavage system transcriptional repre 82.59
PRK08198404 threonine dehydratase; Provisional 82.35
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 82.33
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 81.6
PRK11899279 prephenate dehydratase; Provisional 81.05
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 80.46
KOG3582856 consensus Mlx interactors and related transcriptio 80.12
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information 
Probab=99.48  E-value=7.4e-14  Score=93.85  Aligned_cols=49  Identities=47%  Similarity=0.699  Sum_probs=46.3

Q ss_pred             cchhhHHHHHHHHHHHHHHHHHhhcCCCC-----CCCChhhHHHHHHHHHHHHH
Q 026436           56 AQDHVIAERKRREKLNQRFIALSALVPGL-----KKTDKASILGDSIKYLKQLQ  104 (238)
Q Consensus        56 ~~~h~~~Er~RR~~i~~~~~~L~~lvP~~-----~k~~k~~il~~ai~yi~~L~  104 (238)
                      +..|+..||+||++||+.|..|+.+||..     .+.+|++||..||+||++||
T Consensus         2 R~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq   55 (55)
T PF00010_consen    2 RQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ   55 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence            56899999999999999999999999976     67999999999999999997

; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>KOG3582 consensus Mlx interactors and related transcription factors [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 4e-16
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 3e-14
1hlo_A80 Protein (transcription factor MAX); transcriptiona 3e-13
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 8e-13
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 4e-10
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
4f3l_A 361 Mclock, circadian locomoter output cycles protein 2e-05
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 3e-05
1a0a_A63 BHLH, protein (phosphate system positive regulator 5e-05
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
 Score = 70.1 bits (172), Expect = 4e-16
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 51  RDPSHAQDHVIAERKRREKLNQRFIALSALVPGLK-KTDKASILGDSIKYLKQLQERVKA 109
                   H   E++ R  +N + I L  LV G + K +K+++L  +I Y++ LQ   + 
Sbjct: 2   SRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQK 61

Query: 110 LEEQ 113
           L+++
Sbjct: 62  LKQE 65
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.7
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.62
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.61
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.61
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.61
4ati_A118 MITF, microphthalmia-associated transcription fact 99.6
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.59
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.59
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.56
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.52
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.5
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.31
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.31
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.0
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.88
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.82
4ath_A83 MITF, microphthalmia-associated transcription fact 98.79
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.32
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.12
1u8s_A 192 Glycine cleavage system transcriptional repressor, 96.4
2nyi_A 195 Unknown protein; protein structure initiative, PSI 96.14
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 95.92
2nyi_A195 Unknown protein; protein structure initiative, PSI 95.62
1u8s_A192 Glycine cleavage system transcriptional repressor, 95.13
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 91.33
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 90.93
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 90.73
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 90.64
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 90.21
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 90.02
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 89.34
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 88.79
2pc6_A165 Probable acetolactate synthase isozyme III (small; 88.42
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 87.25
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 80.95
3luy_A329 Probable chorismate mutase; structural genomics, A 80.74
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.70  E-value=2.5e-17  Score=118.81  Aligned_cols=64  Identities=27%  Similarity=0.454  Sum_probs=59.4

Q ss_pred             CccchhhHHHHHHHHHHHHHHHHHhhcCCCC-CCCChhhHHHHHHHHHHHHHHHHHHHHHHhhhc
Q 026436           54 SHAQDHVIAERKRREKLNQRFIALSALVPGL-KKTDKASILGDSIKYLKQLQERVKALEEQTSKK  117 (238)
Q Consensus        54 ~~~~~h~~~Er~RR~~i~~~~~~L~~lvP~~-~k~~k~~il~~ai~yi~~L~~~~~~l~~~~~~~  117 (238)
                      .++..|+.+||+||++||+.|..|+++||++ .|+||++||.+||+||++|+.+++.|++++...
T Consensus         5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L   69 (82)
T 1am9_A            5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSL   69 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3577899999999999999999999999997 899999999999999999999999999977643
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 238
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 2e-13
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 4e-13
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 2e-12
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 4e-12
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 5e-12
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 2e-11
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 2e-11
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 3e-11
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.9 bits (148), Expect = 2e-13
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 67  REKLNQRFIALSALVPGL-KKTDKASILGDSIKYLKQLQERVKALEEQ 113
           R  +N + I L  LV G   K  K+ +L  +I Y+K LQ+    L ++
Sbjct: 1   RSSINDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQE 48
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.59
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.57
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.57
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.51
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.07
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 96.86
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 96.4
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 95.71
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 94.31
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 93.46
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 89.07
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 88.5
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 88.49
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.63  E-value=2.3e-16  Score=111.53  Aligned_cols=62  Identities=27%  Similarity=0.479  Sum_probs=57.7

Q ss_pred             ccchhhHHHHHHHHHHHHHHHHHhhcCCCC-CCCChhhHHHHHHHHHHHHHHHHHHHHHHhhh
Q 026436           55 HAQDHVIAERKRREKLNQRFIALSALVPGL-KKTDKASILGDSIKYLKQLQERVKALEEQTSK  116 (238)
Q Consensus        55 ~~~~h~~~Er~RR~~i~~~~~~L~~lvP~~-~k~~k~~il~~ai~yi~~L~~~~~~l~~~~~~  116 (238)
                      ++..|+.+||+||++||+.|..|++|||+. .|++|++||..||+||++|+.+++.|..+...
T Consensus         6 kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~   68 (80)
T d1am9a_           6 KRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLS   68 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            467899999999999999999999999986 68999999999999999999999999987654
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure