Citrus Sinensis ID: 026551

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MYMCGAYAVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
cccccccEEEEcccccEEEEEEccccccEEEEEEEEcccccccccccEEEEccccccccccccccEEEEEEEccccEEEEEEcccccccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccEEEEcccccEEEEEEcccccccEEEEEEEccccccccccccHEEcHHHccccccccccEEEEEEcccccEEEEEccccccccccccEEEEEcccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mymcgayavkigrpgyrvtkqfdpetkqRSLLFQieypeiedlskprhrfmsSFEQRVQPFDKRYQYLMFAAEPYEiiafkvpsteidkstpkffshwdpdskmfTLQLYfkskpvegnkpqaapaangavapppppppqgpppgvsagnaprappppmtgtlppppppmangprpmppggappapppppggsgtmanftpgtqvgrpptmpppppqgyggqqmpirppppppnmgq
MYMCGAYavkigrpgyrvtKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKStpkffshwdpdSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
MYMCGAYAVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKpqaapaangavapppppppqgpppgvsagnaprappppmtgtlppppppmangprpmppggappapppppggSGTMANFTPGTQVGRpptmpppppqgyggqqmpIRppppppNMGQ
**MCGAYAVKIGRPGYRVTKQFD****QRSLLFQIEYPEIED*******FM*SFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYF******************************************************************************************************************************
****GAYAVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKS****************************************************************************************************************************
MYMCGAYAVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
*YMCGAYAVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPV**************VAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPP*GSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPP*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYMCGAYAVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query237 2.2.26 [Sep-21-2011]
Q15428 464 Splicing factor 3A subuni yes no 0.430 0.219 0.647 3e-36
Q6AXT8 471 Splicing factor 3A subuni yes no 0.430 0.216 0.647 4e-36
A5PJN8 477 Splicing factor 3A subuni yes no 0.430 0.213 0.647 6e-36
Q54B65215 Splicing factor 3A subuni yes no 0.438 0.483 0.648 6e-35
Q62203 475 Splicing factor 3A subuni yes no 0.388 0.193 0.617 5e-30
Q9P7L8217 Pre-mRNA-splicing factor yes no 0.409 0.447 0.5 2e-21
>sp|Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 OS=Homo sapiens GN=SF3A2 PE=1 SV=2 Back     alignment and function desciption
 Score =  151 bits (382), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 84/102 (82%)

Query: 11  IGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMF 70
           IGRPGY+VTKQ D E  Q+SLLFQI+YPEI +   PRHRFMS++EQR++P D+R+QYL+ 
Sbjct: 112 IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLM 171

Query: 71  AAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFK 112
           AAEPYE IAFKVPS EIDK+  KF++HW+ ++K F LQ +FK
Sbjct: 172 AAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFK 213
Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.
Homo sapiens (taxid: 9606)
>sp|Q6AXT8|SF3A2_RAT Splicing factor 3A subunit 2 OS=Rattus norvegicus GN=Sf3a2 PE=2 SV=1 Back     alignment and function description
>sp|A5PJN8|SF3A2_BOVIN Splicing factor 3A subunit 2 OS=Bos taurus GN=SF3A2 PE=2 SV=1 Back     alignment and function description
>sp|Q54B65|SF3A2_DICDI Splicing factor 3A subunit 2 OS=Dictyostelium discoideum GN=sf3a2 PE=3 SV=1 Back     alignment and function description
>sp|Q62203|SF3A2_MOUSE Splicing factor 3A subunit 2 OS=Mus musculus GN=Sf3a2 PE=2 SV=2 Back     alignment and function description
>sp|Q9P7L8|SAP62_SCHPO Pre-mRNA-splicing factor sap62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap62 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
224140247334 predicted protein [Populus trichocarpa] 0.949 0.673 0.755 2e-65
255556836327 Splicing factor 3A subunit, putative [Ri 0.894 0.648 0.772 5e-64
297739988241 unnamed protein product [Vitis vinifera] 0.540 0.531 0.906 6e-63
225441145 357 PREDICTED: splicing factor 3A subunit 2 0.523 0.347 0.919 1e-61
449440151 341 PREDICTED: splicing factor 3A subunit 2- 0.518 0.360 0.918 2e-61
449501030 341 PREDICTED: splicing factor 3A subunit 2- 0.518 0.360 0.918 2e-61
356554761 349 PREDICTED: splicing factor 3A subunit 2- 0.949 0.644 0.633 4e-61
356550634 350 PREDICTED: splicing factor 3A subunit 2- 0.523 0.354 0.887 2e-59
262192723253 hypothetical protein [Nicotiana tabacum] 0.502 0.470 0.857 9e-57
116787560308 unknown [Picea sitchensis] 0.527 0.405 0.832 1e-55
>gi|224140247|ref|XP_002323495.1| predicted protein [Populus trichocarpa] gi|222868125|gb|EEF05256.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 176/233 (75%), Positives = 188/233 (80%), Gaps = 8/233 (3%)

Query: 8   AVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQY 67
            VKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIED +KPRHRFMSS+EQR++  DKR+QY
Sbjct: 107 TVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDNTKPRHRFMSSYEQRIEANDKRFQY 166

Query: 68  LMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAA 127
           L+F+AEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFK KP E NKPQ+  AA
Sbjct: 167 LLFSAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKLKPPEANKPQSVAAA 226

Query: 128 NGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPP 187
           N  V   PPPP   PP G+ AG +   PPP      PPPPP MANGPRPMPPGGAPPAPP
Sbjct: 227 NSTVPSQPPPPL--PPQGLPAG-SRPPPPPMPASLPPPPPPAMANGPRPMPPGGAPPAPP 283

Query: 188 PPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQM---PIRPPPPPPNMGQ 237
           PPPGGSG M NFTPGTQ GRP +M   PP G+ GQQM    IRPP  PPNMGQ
Sbjct: 284 PPPGGSGAMVNFTPGTQAGRPSSM--LPPHGFLGQQMQGQTIRPPLLPPNMGQ 334

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255556836|ref|XP_002519451.1| Splicing factor 3A subunit, putative [Ricinus communis] gi|223541314|gb|EEF42865.1| Splicing factor 3A subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297739988|emb|CBI30170.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225441145|ref|XP_002266748.1| PREDICTED: splicing factor 3A subunit 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449440151|ref|XP_004137848.1| PREDICTED: splicing factor 3A subunit 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449501030|ref|XP_004161259.1| PREDICTED: splicing factor 3A subunit 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356554761|ref|XP_003545711.1| PREDICTED: splicing factor 3A subunit 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356550634|ref|XP_003543690.1| PREDICTED: splicing factor 3A subunit 2-like [Glycine max] Back     alignment and taxonomy information
>gi|262192723|gb|ACY30431.1| hypothetical protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|116787560|gb|ABK24557.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
TAIR|locus:2060279277 AT2G32600 [Arabidopsis thalian 0.472 0.404 0.848 2e-49
ZFIN|ZDB-GENE-040426-897278 sf3a2 "splicing factor 3a, sub 0.438 0.374 0.663 5.1e-35
UNIPROTKB|A5PJN8 477 SF3A2 "Splicing factor 3A subu 0.451 0.224 0.648 3.6e-34
UNIPROTKB|G3MW14411 SF3A2 "Splicing factor 3A subu 0.451 0.260 0.648 3.6e-34
UNIPROTKB|J9P6E2 478 SF3A2 "Uncharacterized protein 0.451 0.223 0.648 3.6e-34
UNIPROTKB|Q15428 464 SF3A2 "Splicing factor 3A subu 0.451 0.230 0.648 3.6e-34
RGD|1308627 471 Sf3a2 "splicing factor 3a, sub 0.451 0.227 0.648 3.6e-34
FB|FBgn0036314264 CG10754 [Drosophila melanogast 0.451 0.405 0.607 4.1e-33
DICTYBASE|DDB_G0293876215 sf3a2 "splicing factor 3A subu 0.434 0.479 0.663 6.7e-33
WB|WBGene00008683222 repo-1 [Caenorhabditis elegans 0.434 0.463 0.644 6.7e-33
TAIR|locus:2060279 AT2G32600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 515 (186.3 bits), Expect = 2.0e-49, P = 2.0e-49
 Identities = 95/112 (84%), Positives = 103/112 (91%)

Query:     9 VKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYL 68
             VKIGRPGYRVTKQ+DPE +QRSLLFQIEYPEIED  KPRHRFMSS+EQ+VQP+DK YQYL
Sbjct:   108 VKIGRPGYRVTKQYDPELQQRSLLFQIEYPEIEDNIKPRHRFMSSYEQKVQPYDKSYQYL 167

Query:    69 MFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNK 120
             +FAAEPYEIIAFKVPSTE+DKSTPKFFSHWDPDSKMFTLQ+YFK    E NK
Sbjct:   168 LFAAEPYEIIAFKVPSTEVDKSTPKFFSHWDPDSKMFTLQVYFKPTKPEPNK 219
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0051604 "protein maturation" evidence=RCA
ZFIN|ZDB-GENE-040426-897 sf3a2 "splicing factor 3a, subunit 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJN8 SF3A2 "Splicing factor 3A subunit 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MW14 SF3A2 "Splicing factor 3A subunit 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6E2 SF3A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15428 SF3A2 "Splicing factor 3A subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308627 Sf3a2 "splicing factor 3a, subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0036314 CG10754 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293876 sf3a2 "splicing factor 3A subunit 2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00008683 repo-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0025001901
hypothetical protein (334 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_XIII3357
hypothetical protein (820 aa)
    ••• 0.636
eugene3.00170116
hypothetical protein (1268 aa)
    ••• 0.613
eugene3.00440042
hypothetical protein (2357 aa)
    ••• 0.572
eugene3.00120183
hypothetical protein (509 aa)
    ••• 0.471
gw1.XV.452.1
hypothetical protein (495 aa)
    ••• 0.470
fgenesh4_pm.C_LG_V000144
hypothetical protein (776 aa)
    ••• 0.450
eugene3.00070768
hypothetical protein (795 aa)
    ••• 0.428
gw1.XI.1022.1
SubName- Full=Putative uncharacterized protein; (240 aa)
    ••  0.401

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
COG5246222 COG5246, PRP11, Splicing factor 3a, subunit 2 [RNA 2e-29
smart01050129 smart01050, CactinC_cactus, Cactus-binding C-termi 6e-18
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-09
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-09
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 6e-09
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-08
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-08
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 7e-08
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-07
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-07
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-07
pfam04652315 pfam04652, DUF605, Vta1 like 2e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-06
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-06
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 5e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 7e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 8e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-06
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-05
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-05
pfam04652315 pfam04652, DUF605, Vta1 like 1e-05
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-05
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-05
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-05
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 2e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 4e-05
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 4e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-05
PRK14954 620 PRK14954, PRK14954, DNA polymerase III subunits ga 6e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 7e-05
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 7e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-04
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 1e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 2e-04
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 2e-04
PRK09111 598 PRK09111, PRK09111, DNA polymerase III subunits ga 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-04
PRK13729 475 PRK13729, PRK13729, conjugal transfer pilus assemb 3e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-04
TIGR02784 1135 TIGR02784, addA_alphas, double-strand break repair 4e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 5e-04
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 5e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 5e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-04
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 7e-04
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 7e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-04
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 8e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 8e-04
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 8e-04
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 9e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.001
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
PRK14965 576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.001
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.001
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.001
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 0.001
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 0.001
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 0.002
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.002
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.003
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 0.003
pfam07462 574 pfam07462, MSP1_C, Merozoite surface protein 1 (MS 0.003
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 0.003
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.004
PRK09111 598 PRK09111, PRK09111, DNA polymerase III subunits ga 0.004
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.004
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.004
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 0.004
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.004
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.004
>gnl|CDD|227571 COG5246, PRP11, Splicing factor 3a, subunit 2 [RNA processing and modification] Back     alignment and domain information 
 Score =  109 bits (273), Expect = 2e-29
 Identities = 38/104 (36%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 9   VKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYL 68
            + G P Y+V    +P+  +R L  Q+ Y +      P++R +SS EQ V+ +D+ ++YL
Sbjct: 116 KRSGIPSYKVRSLVEPKGGRRGLGIQVNYEDDLAEEMPQYRIVSSLEQNVEEYDESFRYL 175

Query: 69  MFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFK 112
           +FA EPYE IAFK  + EID  +      WD ++  +TLQ +F 
Sbjct: 176 VFACEPYENIAFKFENKEIDFLSIYED--WDAETGTYTLQFFFL 217

Length = 222
>gnl|CDD|214996 smart01050, CactinC_cactus, Cactus-binding C-terminus of cactin protein Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234012 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|219419 pfam07462, MSP1_C, Merozoite surface protein 1 (MSP1) C-terminus Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 237
KOG0227222 consensus Splicing factor 3a, subunit 2 [RNA proce 100.0
COG5246222 PRP11 Splicing factor 3a, subunit 2 [RNA processin 100.0
PF09732125 CactinC_cactus: Cactus-binding C-terminus of cacti 99.78
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.75
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.61
KOG2370623 consensus Cactin [Signal transduction mechanisms] 97.37
KOG3671 569 consensus Actin regulatory protein (Wiskott-Aldric 97.05
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 89.31
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 83.92
>KOG0227 consensus Splicing factor 3a, subunit 2 [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=8e-54  Score=372.89  Aligned_cols=115  Identities=63%  Similarity=1.028  Sum_probs=111.2

Q ss_pred             CcceeEeCCCCceEEEeeCCCCCceeeEEEEEcCCccCCCCcceeeecccccccCCCCCCccEEEEEecCCccceeeecC
Q 026551            5 GAYAVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPS   84 (237)
Q Consensus         5 ~kk~vKIGRPgYKVTK~rDpeT~q~gLlfqVdYPei~~g~~Pr~RfMSayEQkvE~pDk~~QYLv~AaEPYEtIaFKIPn   84 (237)
                      .|++||||||||||||+||+++||+||||||+|++|+++++|||||||+|||+||.+|++||||||||||||||||||||
T Consensus       106 vk~~vkigrpgykvtk~r~~~~gq~~L~fQv~Yp~i~~~~~Pr~rfmssyeq~ve~~dk~~qyLvfaaePyE~Iafk~p~  185 (222)
T KOG0227|consen  106 VKKFVKIGRPGYKVTKQRDPENGQQGLLFQVNYPEIEEGIMPRHRFMSSYEQKVEPPDKSWQYLVFAAEPYENIAFKVPS  185 (222)
T ss_pred             hhhhhhcCCCcceeeeeecCccCceeeEEEecchhhhhccCCcchhhhhhHhhcCCccccceEEEEEeccccceeeecCc
Confidence            46799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCCcceeeecCCCCEEEEEEeeccCCCCCC
Q 026551           85 TEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGN  119 (237)
Q Consensus        85 ~EIDk~~~k~wt~WD~dtK~F~LQf~Fk~e~~~~~  119 (237)
                      +|||+++||||||||.|||+|+|||+|+.++.+.+
T Consensus       186 ~Eid~se~Kf~t~wd~~tk~y~lqF~fk~~~~~~~  220 (222)
T KOG0227|consen  186 REIDKSEGKFWTHWDAETKQYTLQFFFKQAEPEQP  220 (222)
T ss_pred             hhhhhccCceeeeecCCCceEEEEEEecccCccCC
Confidence            99999999999999999999999999998876643

>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] Back     alignment and domain information
>PF09732 CactinC_cactus: Cactus-binding C-terminus of cactin protein; InterPro: IPR019134 This entry represents the C-terminal 200 residues of the cactin protein which is necessary for the association of cactin with IkappaB-cactus, as one of the intracellular members of the Rel complex Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2370 consensus Cactin [Signal transduction mechanisms] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
4dgw_C231 PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A 6e-50
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-13
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-12
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-11
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-11
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-04
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-09
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 6e-06
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 1e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 4e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-05
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 3e-05
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 8e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 7e-04
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 2e-04
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 2e-04
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-04
>4dgw_C PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A {Saccharomyces cerevisiae} Length = 231 Back     alignment and structure
 Score =  162 bits (410), Expect = 6e-50
 Identities = 29/120 (24%), Positives = 47/120 (39%), Gaps = 20/120 (16%)

Query: 12  GRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFA 71
           G  G  +   +  E K+ S+       + +    P  R +S  E       K  ++L+ A
Sbjct: 114 GSVGMAIQVNYSSEVKENSVD-----SDDKAKVPPLIRIVSGLELSDTK-QKGKKFLVIA 167

Query: 72  AEPYEIIAFKVPSTEIDKSTPKF--------------FSHWDPDSKMFTLQLYFKSKPVE 117
            EP+E IA ++P  EI  S                   + WD  SK++ +Q +FK    E
Sbjct: 168 YEPFENIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQAEQE 227
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
4dgw_C231 PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A 100.0
>4dgw_C PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.6e-52  Score=363.63  Aligned_cols=105  Identities=25%  Similarity=0.376  Sum_probs=96.7

Q ss_pred             eeEeCCCCceEEEeeCCCCCceeeEEEEEcCC-c---------cCCCCcceeeecccccccCCCCCCccEEEEEecCCcc
Q 026551            8 AVKIGRPGYRVTKQFDPETKQRSLLFQIEYPE-I---------EDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEI   77 (237)
Q Consensus         8 ~vKIGRPgYKVTK~rDpeT~q~gLlfqVdYPe-i---------~~g~~Pr~RfMSayEQkvE~pDk~~QYLv~AaEPYEt   77 (237)
                      ...|||||||||||||++|+|+||||||+|++ |         +++++|||||||+|||++|.+ ++|||||||||||||
T Consensus        95 ~~~IGRPGYKVTKVRDPETgQ~GLLFQVdYPEeIk~~~~~~~~~egi~PrhRIMSAyEQrVE~P-Kd~QYLVIAAEPYET  173 (231)
T 4dgw_C           95 XXXXXXXXXXXXXXXXXXXGSVGMAIQVNYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQ-KGKKFLVIAYEPFEN  173 (231)
T ss_dssp             SCCCCCCCCBCCCEECCBCCBCCEEEEEECCCSSSTTSCCSCSSTTCCCEEEEEETTCCSSCCC-CCCEEEEEECSSSCC
T ss_pred             ccccccccccccccccccCCCeeEEEEEECChhhhhcccccccCCCCCcCEEEECHHHhcccCC-CCCEEEEEEeCCCCC
Confidence            45899999999999999999999999999999 6         788999999999999999998 999999999999999


Q ss_pred             ceeeecCcccccCC--------------CcceeeecCCCCEEEEEEeecc
Q 026551           78 IAFKVPSTEIDKST--------------PKFFSHWDPDSKMFTLQLYFKS  113 (237)
Q Consensus        78 IaFKIPn~EIDk~~--------------~k~wt~WD~dtK~F~LQf~Fk~  113 (237)
                      |||||||+|||+.+              |+||||||+|+|+|+||||||.
T Consensus       174 IAFKIPNrEIDk~e~~~~~~~~~svDElgKfwTyWD~DsK~FyLQffFK~  223 (231)
T 4dgw_C          174 IAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQ  223 (231)
T ss_dssp             BCCEECSSCSSCCSCCSCCCCCCSSCHHHHHTEEEETTTTEEEEC-----
T ss_pred             ceeEcCChhhccccccccccccccccccCCEEEEecCCCCEEEEEEEEee
Confidence            99999999999988              8899999999999999999993

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00