Citrus Sinensis ID: 026689

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----

MKRYRNGEIWDFETAEESGGREVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMADALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGYMIYKLTNL

ccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccHHHHHHccccccccEEEEEEcccEEEEEEEccccEEEEccccHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHcccccc

cccccccEEEEEEccccccccEEEEEEEcccccEEEEEEEcccccccccccccEEEEEEccccccHcccHHHHHHHHHHHHHHHHHHccccHHHHHEEEEEccccccHHHHHHHHHHHHHHccccccEEEccHHHHHHHHccccccccEEEEEccccEEEEEcccccEEEEcccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHccccc

mkryrngeiwdfetaeesggrevilgldggttstvcicmpvismsdslpdplpVLARAAagcsnhnsvgedAARETIEKVMADALlksgsnrsAVRAVCLAvsgvnhptdQQRILNWLrdifpgnvrlYVHNDALAAlasgtmgklHGCVLIAGtgtiaygftedgrdaraagagpilgdwgsgyGIAAQALTAVIRAydgrgpdtmlTSNILstlelsspdeLIGYMIYKLTNL

mkryrngeiwdfetaeesggreVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMADAllksgsnrSAVRAVCLAVsgvnhptdQQRILNWLRDIFPGNVRLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNIlstlelsspdeligymiykltnl

MKRYRNGEIWDFETAEESGGREVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMADALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEdgrdaraagagPILGDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGYMIYKLTNL

********IWDFETAEESGGREVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAA********************MADALL*****RSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGYMIYKL***

******G***************VILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMADALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGYMIYKLTN*

**RYRNGEIWDFETAEESGGREVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMADALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGYMIYKLTNL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		235	2.2.26 [Sep-21-2011]
Q54PM7		319	N-acetyl-D-glucosamine ki	yes	no	0.842	0.620	0.355	1e-33
Q3SZM9		344	N-acetyl-D-glucosamine ki	yes	no	0.680	0.465	0.310	1e-08
Q9UJ70		344	N-acetyl-D-glucosamine ki	yes	no	0.617	0.421	0.322	2e-08
Q9QZ08		343	N-acetyl-D-glucosamine ki	yes	no	0.680	0.466	0.304	1e-07
P81799		343	N-acetyl-D-glucosamine ki	yes	no	0.680	0.466	0.298	1e-07

>sp\|Q54PM7\|NAGK_DICDI N-acetyl-D-glucosamine kinase OS=Dictyostelium discoideum GN=nagk PE=3 SV=2	Back alignment and function desciption

 Score =  143 bits (360), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 120/214 (56%), Gaps = 16/214 (7%)

Query: 21  REVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIE-- 78
           +E+ +G+DGG T T  + +               LAR  + CSN++SVGED A+  I   
Sbjct: 3   KEIFIGIDGGGTKTSTVAVDSNGQE---------LARHTSPCSNYHSVGEDLAKAAINEG 53

Query: 79  -----KVMADALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVHND 133
                + + + +    +    V ++CL +SGV+   D+  + +W+ ++   ++   +HND
Sbjct: 54  IKYVIRKVKETITDDDNKEVTVGSICLGMSGVDREKDKLLVKSWVTELLGESINYSIHND 113

Query: 134 ALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALT 193
           A+ AL+SGT GKL G V+I GTG I+ GF  +G   R+ G GP+LGD+GSGY I    L 
Sbjct: 114 AIVALSSGTQGKLFGVVIICGTGCISLGFNREGVSGRSGGWGPLLGDYGSGYQIGYDILR 173

Query: 194 AVIRAYDGRGPDTMLTSNILSTLELSSPDELIGY 227
            V++A D  GP T LT  +L  L+L+  ++LI +
Sbjct: 174 HVLKAKDQVGPKTSLTQVLLEKLQLTKEEDLISW 207

Converts N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, into GlcNAc 6-phosphate. Also has ManNAc kinase activity.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 5EC: 9

>sp\|Q3SZM9\|NAGK_BOVIN N-acetyl-D-glucosamine kinase OS=Bos taurus GN=NAGK PE=2 SV=1	Back alignment and function description

>sp\|Q9UJ70\|NAGK_HUMAN N-acetyl-D-glucosamine kinase OS=Homo sapiens GN=NAGK PE=1 SV=4	Back alignment and function description

>sp\|Q9QZ08\|NAGK_MOUSE N-acetyl-D-glucosamine kinase OS=Mus musculus GN=Nagk PE=2 SV=3	Back alignment and function description

>sp\|P81799\|NAGK_RAT N-acetyl-D-glucosamine kinase OS=Rattus norvegicus GN=Nagk PE=1 SV=4	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		235
255561146		328	N-acetylglucosamine kinase, putative [Ri	0.965	0.692	0.846	1e-107
224131396		354	predicted protein [Populus trichocarpa]	0.961	0.638	0.828	1e-106
359485331		350	PREDICTED: N-acetyl-D-glucosamine kinase	0.965	0.648	0.817	1e-103
356501411		370	PREDICTED: N-acetyl-D-glucosamine kinase	0.965	0.613	0.791	2e-99
255648369		370	unknown [Glycine max]	0.965	0.613	0.782	4e-98
357494031		367	N-acetyl-D-glucosamine kinase [Medicago	0.965	0.618	0.786	5e-98
357494027		355	N-acetyl-D-glucosamine kinase [Medicago	0.965	0.639	0.786	8e-98
356554098		369	PREDICTED: LOW QUALITY PROTEIN: N-acetyl	0.965	0.615	0.768	1e-94
449505827		231	PREDICTED: N-acetyl-D-glucosamine kinase	0.948	0.965	0.774	5e-94
449463605		350	PREDICTED: LOW QUALITY PROTEIN: N-acetyl	0.948	0.637	0.766	1e-92

>gi\|255561146\|ref\|XP_002521585.1\| N-acetylglucosamine kinase, putative [Ricinus communis] gi\|223539263\|gb\|EEF40856.1\| N-acetylglucosamine kinase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/228 (84%), Positives = 207/228 (90%), Gaps = 1/228 (0%)

Query: 1   MKRYRNGEIWDFE-TAEESGGREVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAA 59
           MKRYRNGEIWDFE     SG   VILGLDGGTTSTVCICMP++  S  LPDPLPVLARA 
Sbjct: 1   MKRYRNGEIWDFEHEIPVSGNNPVILGLDGGTTSTVCICMPILPFSTPLPDPLPVLARAV 60

Query: 60  AGCSNHNSVGEDAARETIEKVMADALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLR 119
           AGCSNHNSVGE AARET+E+VMADALLKSGSNRSAV+AVCLAVSGVNHP D QRILNWLR
Sbjct: 61  AGCSNHNSVGETAARETLEEVMADALLKSGSNRSAVQAVCLAVSGVNHPNDVQRILNWLR 120

Query: 120 DIFPGNVRLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILG 179
           DIFP +V+LYV NDA+AALASGTMGKLHGCVLIAGTGTIAYGFTEDG++ARAAGAGPILG
Sbjct: 121 DIFPNHVKLYVQNDAVAALASGTMGKLHGCVLIAGTGTIAYGFTEDGKEARAAGAGPILG 180

Query: 180 DWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGY 227
           DWGSGYGIAAQALTAV+RAYDGRGP T+LTS+IL TL LSSPDELIG+
Sbjct: 181 DWGSGYGIAAQALTAVVRAYDGRGPQTILTSSILQTLGLSSPDELIGW 228

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224131396\|ref\|XP_002321074.1\| predicted protein [Populus trichocarpa] gi\|222861847\|gb\|EEE99389.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359485331\|ref\|XP_002278295.2\| PREDICTED: N-acetyl-D-glucosamine kinase-like [Vitis vinifera] gi\|302143498\|emb\|CBI22059.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356501411\|ref\|XP_003519518.1\| PREDICTED: N-acetyl-D-glucosamine kinase-like [Glycine max]	Back alignment and taxonomy information

>gi\|255648369\|gb\|ACU24635.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|357494031\|ref\|XP_003617304.1\| N-acetyl-D-glucosamine kinase [Medicago truncatula] gi\|355518639\|gb\|AET00263.1\| N-acetyl-D-glucosamine kinase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357494027\|ref\|XP_003617302.1\| N-acetyl-D-glucosamine kinase [Medicago truncatula] gi\|355518637\|gb\|AET00261.1\| N-acetyl-D-glucosamine kinase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356554098\|ref\|XP_003545386.1\| PREDICTED: LOW QUALITY PROTEIN: N-acetyl-D-glucosamine kinase-like [Glycine max]	Back alignment and taxonomy information

>gi\|449505827\|ref\|XP_004162579.1\| PREDICTED: N-acetyl-D-glucosamine kinase-like, partial [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449463605\|ref\|XP_004149522.1\| PREDICTED: LOW QUALITY PROTEIN: N-acetyl-D-glucosamine kinase-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		235
TAIR\|locus:2028135		351	AT1G30540 [Arabidopsis thalian	0.914	0.612	0.671	3.1e-76
DICTYBASE\|DDB_G0284433		319	DDB_G0284433 "N-acetyl-D-gluco	0.842	0.620	0.355	1e-29
UNIPROTKB\|Q8EBK6		300	nagK "N-acetylglucosamine kina	0.782	0.613	0.287	2.7e-08
TIGR_CMR\|SO_3507		300	SO_3507 "conserved hypothetica	0.782	0.613	0.287	2.7e-08
UNIPROTKB\|F1SLE3		360	NAGK "Uncharacterized protein"	0.757	0.494	0.294	3.2e-06
UNIPROTKB\|Q3SZM9		344	NAGK "N-acetyl-D-glucosamine k	0.617	0.421	0.295	6.7e-06
UNIPROTKB\|Q9UJ70		344	NAGK "N-acetyl-D-glucosamine k	0.612	0.418	0.32	6.7e-06
MGI\|MGI:1860418		343	Nagk "N-acetylglucosamine kina	0.617	0.422	0.288	3.5e-05
ZFIN\|ZDB-GENE-070928-19		293	zgc:171682 "zgc:171682" [Danio	0.638	0.511	0.257	4.4e-05
RGD\|1305057		343	Nagk "N-acetylglucosamine kina	0.617	0.422	0.288	4.7e-05

TAIR\|locus:2028135 AT1G30540 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 768 (275.4 bits), Expect = 3.1e-76, P = 3.1e-76
 Identities = 145/216 (67%), Positives = 173/216 (80%)

Query:    13 ETAEESGG-REVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGED 71
             E  EE+G    VILGLDGG TSTVC+C+P  S  +  PDPLP+L RA AGC+N NSVGE 
Sbjct:    20 EATEENGFVNGVILGLDGGATSTVCVCVPFFSFGERFPDPLPILGRAVAGCTNRNSVGET 79

Query:    72 AARETIEKVMADALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVH 131
             AAR+++E+V+++AL++SG ++S VR VCL VSGVNHP+DQ++I NW+RD+FP +V++YV 
Sbjct:    80 AARDSLEQVISEALVQSGFDKSDVRGVCLGVSGVNHPSDQEKIENWIRDMFPSHVKVYVQ 139

Query:   132 NDALAALASGTMGKLHGCVLIAGTGTIAYGFTEXXXXXXXXXXXPILGDWGSGYGIAAQA 191
             NDA+ ALASGTMGKLHGCVLIAGTG IAYGF E           PILGDWGSGYGIAAQA
Sbjct:   140 NDAIVALASGTMGKLHGCVLIAGTGCIAYGFDEDGKEARASGGGPILGDWGSGYGIAAQA 199

Query:   192 LTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGY 227
             LTAVIRA+DGRGP TMLTS IL  L LSSPDELIG+
Sbjct:   200 LTAVIRAHDGRGPQTMLTSTILKALGLSSPDELIGW 235

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0016887 "ATPase activity" evidence=ISS

DICTYBASE\|DDB_G0284433 DDB_G0284433 "N-acetyl-D-glucosamine kinase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8EBK6 nagK "N-acetylglucosamine kinase NagK" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_3507 SO_3507 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SLE3 NAGK "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3SZM9 NAGK "N-acetyl-D-glucosamine kinase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UJ70 NAGK "N-acetyl-D-glucosamine kinase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1860418 Nagk "N-acetylglucosamine kinase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-070928-19 zgc:171682 "zgc:171682" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

RGD\|1305057 Nagk "N-acetylglucosamine kinase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.7.1.59	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.XIV.3021.1	hypothetical protein (319 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		235
pfam01869		257	pfam01869, BcrAD_BadFG, BadF/BadG/BcrA/BcrD ATPase	5e-34
COG2971		301	COG2971, COG2971, Predicted N-acetylglucosamine ki	2e-27
cd00012		185	cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-	5e-04

>gnl\|CDD\|216750 pfam01869, BcrAD_BadFG, BadF/BadG/BcrA/BcrD ATPase family	Back alignment and domain information

 Score =  122 bits (308), Expect = 5e-34
 Identities = 67/207 (32%), Positives = 94/207 (45%), Gaps = 20/207 (9%)

Query: 26  GLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMADAL 85
           G+DGG+T T  + M          D   VL RA +G +N  SVG +AA + I   + +AL
Sbjct: 1   GIDGGSTKTKAVLMDE--------DGE-VLGRAISGSANIESVGVEAAVKNIVDAINEAL 51

Query: 86  LKSGSNRSAVRAVCLAVSGVNHPTDQQRILNW-LRDIFPGNVRLYVHNDALAALASGTMG 144
            ++G +   +    L   G        +     +R+I      + VH D   ALA  T G
Sbjct: 52  EEAGLDPEDIEYRGLT--GYGLAGLDGKFAKDIVREIL---EEISVHTDGAVALAPATRG 106

Query: 145 KLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALTAVIRAYDGRGP 204
           +  G + I GTG+   G  +DG+  R  G G   GD GS   IAA+AL AV+R  DG   
Sbjct: 107 E-DGVIDIGGTGSKVIGL-DDGKVVRFGGNGFCAGDEGSFLWIAARALGAVLRELDGLAA 164

Query: 205 DTMLTSNILSTLELSSPDELIGYMIYK 231
            T L   ++  L     D+LI     K
Sbjct: 165 KTTLADVVMKALG---VDDLIAVAYRK 188

This family includes the BadF and BadG proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis. The family also includes an activase subunit from the enzyme 2-hydroxyglutaryl-CoA dehydratase. An uncharacterized protein from Aquifex aeolicus contains two copies of this region suggesting that the family may structurally dimerise. This family appears to be related to pfam00370. Length = 257

>gnl\|CDD\|225518 COG2971, COG2971, Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		235
COG2971		301	Predicted N-acetylglucosamine kinase [Carbohydrate	100.0
KOG1794		336	consensus N-Acetylglucosamine kinase [Carbohydrate	100.0
PF01869		271	BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In	99.97
COG1940		314	NagC Transcriptional regulator/sugar kinase [Trans	99.83
PRK09698		302	D-allose kinase; Provisional	99.81
TIGR00744		318	ROK_glcA_fam ROK family protein (putative glucokin	99.81
PRK13311		256	N-acetyl-D-glucosamine kinase; Provisional	99.8
PRK09557		301	fructokinase; Reviewed	99.8
PRK13310		303	N-acetyl-D-glucosamine kinase; Provisional	99.79
PF00480		179	ROK: ROK family; InterPro: IPR000600 A family of b	99.74
PRK12408		336	glucokinase; Provisional	99.74
PRK05082		291	N-acetylmannosamine kinase; Provisional	99.74
PRK00292		316	glk glucokinase; Provisional	99.72
PRK14101		638	bifunctional glucokinase/RpiR family transcription	99.59
TIGR00749		316	glk glucokinase, proteobacterial type. This model	99.57
smart00732		99	YqgFc Likely ribonuclease with RNase H fold. YqgF	99.22
PTZ00288		405	glucokinase 1; Provisional	99.03
PF02685		316	Glucokinase: Glucokinase; InterPro: IPR003836 Gluc	98.95
PRK00047		498	glpK glycerol kinase; Provisional	98.8
PF00370		245	FGGY_N: FGGY family of carbohydrate kinases, N-ter	98.79
PRK10939		520	autoinducer-2 (AI-2) kinase; Provisional	98.78
PRK04123		548	ribulokinase; Provisional	98.77
TIGR02707		351	butyr_kinase butyrate kinase. This model represent	98.74
COG1070		502	XylB Sugar (pentulose and hexulose) kinases [Carbo	98.72
COG0554		499	GlpK Glycerol kinase [Energy production and conver	98.69
PRK13318		258	pantothenate kinase; Reviewed	98.68
TIGR01234		536	L-ribulokinase L-ribulokinase. This enzyme catalyz	98.66
PTZ00294		504	glycerol kinase-like protein; Provisional	98.66
COG0837		320	Glk Glucokinase [Carbohydrate transport and metabo	98.62
TIGR01311		493	glycerol_kin glycerol kinase. This model describes	98.62
PLN02295		512	glycerol kinase	98.6
PLN02362		509	hexokinase	98.6
PLN02914		490	hexokinase	98.6
PLN02405		497	hexokinase	98.59
TIGR01312		481	XylB D-xylulose kinase. D-xylulose kinase (XylB) g	98.58
TIGR01315		541	5C_CHO_kinase FGGY-family pentulose kinase. This m	98.57
PTZ00107		464	hexokinase; Provisional	98.55
PRK13321		256	pantothenate kinase; Reviewed	98.52
PRK10331		470	L-fuculokinase; Provisional	98.51
COG1069		544	AraB Ribulose kinase [Energy production and conver	98.51
TIGR02628		465	fuculo_kin_coli L-fuculokinase. Members of this fa	98.47
PRK15027		484	xylulokinase; Provisional	98.44
TIGR01314		505	gntK_FGGY gluconate kinase, FGGY type. Gluconate i	98.43
PLN02669		556	xylulokinase	98.32
PLN02596		490	hexokinase-like	98.31
PRK03011		358	butyrate kinase; Provisional	98.23
COG5026		466	Hexokinase [Carbohydrate transport and metabolism]	98.06
KOG2517		516	consensus Ribulose kinase and related carbohydrate	97.93
PRK15080		267	ethanolamine utilization protein EutJ; Provisional	97.91
TIGR00241		248	CoA_E_activ CoA-substrate-specific enzyme activase	97.77
TIGR02529		239	EutJ ethanolamine utilization protein EutJ family	97.59
PF05378		176	Hydant_A_N: Hydantoinase/oxoprolinase N-terminal r	97.54
PF00349		206	Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo	97.46
KOG1369		474	consensus Hexokinase [Carbohydrate transport and m	97.45
TIGR02259		432	benz_CoA_red_A benzoyl-CoA reductase, bcr type, su	97.04
TIGR02627		454	rhamnulo_kin rhamnulokinase. This model describes	96.98
PRK13320		244	pantothenate kinase; Reviewed	96.96
PRK09472		420	ftsA cell division protein FtsA; Reviewed	96.82
PRK13324		258	pantothenate kinase; Reviewed	96.81
smart00842		187	FtsA Cell division protein FtsA. FtsA is essential	96.79
TIGR03192		293	benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s	96.78
PRK13317		277	pantothenate kinase; Provisional	96.7
TIGR02261		262	benz_CoA_red_D benzoyl-CoA reductase, bcr type, su	96.53
TIGR03286		404	methan_mark_15 putative methanogenesis marker prot	96.53
COG1924		396	Activator of 2-hydroxyglutaryl-CoA dehydratase (HS	96.29
PRK13326		262	pantothenate kinase; Reviewed	96.26
TIGR00671		243	baf pantothenate kinase, type III. This model desc	96.22
TIGR01174		371	ftsA cell division protein FtsA. This bacterial ce	96.2
TIGR00329		305	gcp_kae1 metallohydrolase, glycoprotease/Kae1 fami	96.19
PRK09604		332	UGMP family protein; Validated	96.05
PRK10854		513	exopolyphosphatase; Provisional	96.02
PF14574		412	DUF4445: Domain of unknown function (DUF4445); PDB	95.98
PRK13322		246	pantothenate kinase; Reviewed	95.63
TIGR03706		300	exo_poly_only exopolyphosphatase. It appears that	95.62
PRK13331		251	pantothenate kinase; Reviewed	95.54
TIGR00555		279	panK_eukar pantothenate kinase, eukaryotic/staphyl	95.5
PRK00109		138	Holliday junction resolvase-like protein; Reviewed	95.41
TIGR03123		318	one_C_unchar_1 probable H4MPT-linked C1 transfer p	95.19
PRK11031		496	guanosine pentaphosphate phosphohydrolase; Provisi	95.07
COG0849		418	ftsA Cell division ATPase FtsA [Cell division and	94.96
PLN02666		1275	5-oxoprolinase	94.95
PF13941		457	MutL: MutL protein	94.53
COG0816		141	Predicted endonuclease involved in recombination (	94.38
PRK09605		535	bifunctional UGMP family protein/serine/threonine	94.19
PF03652		135	UPF0081: Uncharacterised protein family (UPF0081);	94.16
COG0145		674	HyuA N-methylhydantoinase A/acetone carboxylase, b	94.1
COG1521		251	Pantothenate kinase type III (Bvg accessory factor	94.04
smart00268		373	ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki	93.87
PRK13328		255	pantothenate kinase; Reviewed	93.7
COG4820		277	EutJ Ethanolamine utilization protein, possible ch	93.67
TIGR00250		130	RNAse_H_YqgF RNAse H-fold protein YqgF. This prote	93.67
PF14450		120	FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B	93.53
TIGR03722		322	arch_KAE1 universal archaeal protein Kae1. This fa	93.49
cd00012		371	ACTIN Actin; An ubiquitous protein involved in the	93.31
PF14639		150	YqgF: Holliday-junction resolvase-like of SPT6 ; P	93.17
COG1548		330	Predicted transcriptional regulator/sugar kinase [	92.83
PRK13929		335	rod-share determining protein MreBH; Provisional	92.2
PTZ00340		345	O-sialoglycoprotein endopeptidase-like protein; Pr	92.1
PTZ00186		657	heat shock 70 kDa precursor protein; Provisional	92.02
TIGR01175		348	pilM type IV pilus assembly protein PilM. This pro	91.98
TIGR03723		314	bact_gcp putative glycoprotease GCP. This model re	91.37
COG0248		492	GppA Exopolyphosphatase [Nucleotide transport and	91.08
PF03309		206	Pan_kinase: Type III pantothenate kinase; InterPro	91.01
TIGR03725		202	bact_YeaZ universal bacterial protein YeaZ. This f	90.66
KOG1385		453	consensus Nucleoside phosphatase [Nucleotide trans	90.12
PRK14878		323	UGMP family protein; Provisional	89.62
PRK13928		336	rod shape-determining protein Mbl; Provisional	89.61
TIGR00904		333	mreB cell shape determining protein, MreB/Mrl fami	88.93
COG4972		354	PilM Tfp pilus assembly protein, ATPase PilM [Cell	88.85
COG0443		579	DnaK Molecular chaperone [Posttranslational modifi	88.45
PF06723		326	MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba	88.37
PF06277		473	EutA: Ethanolamine utilisation protein EutA; Inter	87.97
PF00022		393	Actin: Actin; InterPro: IPR004000 Actin [, ] is a	87.24
PRK13410		668	molecular chaperone DnaK; Provisional	86.37
KOG2531		545	consensus Sugar (pentulose and hexulose) kinases [	85.8
CHL00094		621	dnaK heat shock protein 70	85.69
PRK00290		627	dnaK molecular chaperone DnaK; Provisional	85.58
PRK10719		475	eutA reactivating factor for ethanolamine ammonia	85.41
PRK13411		653	molecular chaperone DnaK; Provisional	84.66
PF02075		149	RuvC: Crossover junction endodeoxyribonuclease Ruv	84.21
COG3734		306	DgoK 2-keto-3-deoxy-galactonokinase [Carbohydrate	83.83
PTZ00466		380	actin-like protein; Provisional	83.19
COG1214		220	Inactive homolog of metal-dependent proteases, put	83.07
PRK00039		164	ruvC Holliday junction resolvase; Reviewed	82.61
PRK01433		595	hscA chaperone protein HscA; Provisional	82.18
COG4020		332	Uncharacterized protein conserved in archaea [Func	82.03
COG5146		342	PanK Pantothenate kinase, acetyl-CoA regulated [Co	81.3
PRK13930		335	rod shape-determining protein MreB; Provisional	81.2
PF11104		340	PilM_2: Type IV pilus assembly protein PilM;; PDB:	80.44

>COG2971 Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=6.8e-38  Score=273.08  Aligned_cols=197  Identities=31%  Similarity=0.494  Sum_probs=175.8

Q ss_pred             CCcEEEEEEcCccceEEEEEeCccCCCCCCCCCCEEEEEEeCCCCCccCCHHHHHHHHHHHHHHHHHHcCCCcccceeeE
Q 026689           20 GREVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMADALLKSGSNRSAVRAVC   99 (235)
Q Consensus        20 m~~~~LgiD~GgT~t~~~l~d~~~~~~~~~~~g~il~~~~~~~~~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i~~ig   99 (235)
                      ||.|+||||+|||||+++|.|.         +|+++.+...++.|+...++++++.++.+++.+++.+++.+|++|..++
T Consensus         3 ~~~~~lGVDGGGTkt~a~l~~~---------~g~vlg~g~sGpAN~~~~~~e~A~~ni~~ai~~A~~~aG~~~~~i~~~~   73 (301)
T COG2971           3 PMPYFLGVDGGGTKTRAVLADE---------DGNVLGRGKSGPANIQLVGKEEAVRNIKDAIREALDEAGLKPDEIAAIV   73 (301)
T ss_pred             CccEEEEEccCCcceEEEEEcC---------CCcEEEEeccCCceecccchHHHHHHHHHHHHHHHHhcCCCHHHhCcee
Confidence            4569999999999999999998         9999999999999998666699999999999999999999999998888


Q ss_pred             EeccCCCCccHHHHHHHHHHhhCCCCc-eEEEeCcHHHHHHhhcCCCCCEEEEEeCCCceeEEEecCCcEEEeCCCCccc
Q 026689          100 LAVSGVNHPTDQQRILNWLRDIFPGNV-RLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPIL  178 (235)
Q Consensus       100 igi~G~~~~~~~~~l~~~l~~~~~~~~-~v~v~NDa~~a~~~~~~g~~~gi~li~GTGs~~~g~~~~G~~~~~Gg~G~ll  178 (235)
                      +|+++.....+  .....++..+|. . .+.|+||+..|+.++. +.++|+++++||||+++++ .+|+..|.|||||++
T Consensus        74 agla~ag~~~~--~~~~~~~~~l~~-a~~v~v~~Dg~iAl~ga~-~~~~Gii~i~GTGSi~~~~-~gg~~~r~GG~Gf~I  148 (301)
T COG2971          74 AGLALAGANVE--EAREELERLLPF-AGKVDVENDGLIALRGAL-GDDDGIIVIAGTGSIGYGR-KGGRRERVGGWGFPI  148 (301)
T ss_pred             eeeeccCcchh--HHHHHHHHhcCc-cceEEEecChHHHHhhcc-CCCCCEEEEecCCeEEEEE-eCCeeEEecCcCccc
Confidence            88888765543  222333445664 4 8999999999999765 4469999999999999988 789999999999999


Q ss_pred             cccchHHHHHHHHHHHHHHHhcCCCCCchhHHHHHHHcCCCChhhHHHHHHhh
Q 026689          179 GDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGYMIYK  231 (235)
Q Consensus       179 gd~gSg~~ig~~al~~~~~~~dg~~~~t~l~~~~~~~~~~~~~~~l~~~~y~~  231 (235)
                      ||+|||+|||+++++..++++||+.+.|+|.+.++++|+. |+++|++|+|..
T Consensus       149 gDegSga~ig~~~L~~~lra~DG~~~~t~L~d~v~~~f~~-d~edlv~~~y~a  200 (301)
T COG2971         149 GDEGSGAWIGREALQEALRAFDGRREATPLTDAVMAEFNL-DPEDLVAFIYKA  200 (301)
T ss_pred             cccchHHHHHHHHHHHHHHHhcCCccCChHHHHHHHHhCC-CHHHHHHHHHhc
Confidence            9999999999999999999999999999999999999997 999999999975

>KOG1794 consensus N-Acetylglucosamine kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis	Back alignment and domain information

>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09698 D-allose kinase; Provisional	Back alignment and domain information

>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase)	Back alignment and domain information

>PRK13311 N-acetyl-D-glucosamine kinase; Provisional	Back alignment and domain information

>PRK09557 fructokinase; Reviewed	Back alignment and domain information

>PRK13310 N-acetyl-D-glucosamine kinase; Provisional	Back alignment and domain information

>PF00480 ROK: ROK family; InterPro: IPR000600 A family of bacterial proteins has been described which groups transcriptional repressors, sugar kinases and yet uncharacterised open reading frames []	Back alignment and domain information

>PRK12408 glucokinase; Provisional	Back alignment and domain information

>PRK05082 N-acetylmannosamine kinase; Provisional	Back alignment and domain information

>PRK00292 glk glucokinase; Provisional	Back alignment and domain information

>PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional	Back alignment and domain information

>TIGR00749 glk glucokinase, proteobacterial type	Back alignment and domain information

>smart00732 YqgFc Likely ribonuclease with RNase H fold	Back alignment and domain information

>PTZ00288 glucokinase 1; Provisional	Back alignment and domain information

>PF02685 Glucokinase: Glucokinase; InterPro: IPR003836 Glucokinases 2	Back alignment and domain information

>PRK00047 glpK glycerol kinase; Provisional	Back alignment and domain information

>PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related	Back alignment and domain information

>PRK10939 autoinducer-2 (AI-2) kinase; Provisional	Back alignment and domain information

>PRK04123 ribulokinase; Provisional	Back alignment and domain information

>TIGR02707 butyr_kinase butyrate kinase	Back alignment and domain information

>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0554 GlpK Glycerol kinase [Energy production and conversion]	Back alignment and domain information

>PRK13318 pantothenate kinase; Reviewed	Back alignment and domain information

>TIGR01234 L-ribulokinase L-ribulokinase	Back alignment and domain information

>PTZ00294 glycerol kinase-like protein; Provisional	Back alignment and domain information

>COG0837 Glk Glucokinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01311 glycerol_kin glycerol kinase	Back alignment and domain information

>PLN02295 glycerol kinase	Back alignment and domain information

>PLN02362 hexokinase	Back alignment and domain information

>PLN02914 hexokinase	Back alignment and domain information

>PLN02405 hexokinase	Back alignment and domain information

>TIGR01312 XylB D-xylulose kinase	Back alignment and domain information

>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase	Back alignment and domain information

>PTZ00107 hexokinase; Provisional	Back alignment and domain information

>PRK13321 pantothenate kinase; Reviewed	Back alignment and domain information

>PRK10331 L-fuculokinase; Provisional	Back alignment and domain information

>COG1069 AraB Ribulose kinase [Energy production and conversion]	Back alignment and domain information

>TIGR02628 fuculo_kin_coli L-fuculokinase	Back alignment and domain information

>PRK15027 xylulokinase; Provisional	Back alignment and domain information

>TIGR01314 gntK_FGGY gluconate kinase, FGGY type	Back alignment and domain information

>PLN02669 xylulokinase	Back alignment and domain information

>PLN02596 hexokinase-like	Back alignment and domain information

>PRK03011 butyrate kinase; Provisional	Back alignment and domain information

>COG5026 Hexokinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG2517 consensus Ribulose kinase and related carbohydrate kinases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK15080 ethanolamine utilization protein EutJ; Provisional	Back alignment and domain information

>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative	Back alignment and domain information

>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein	Back alignment and domain information

>PF05378 Hydant_A_N: Hydantoinase/oxoprolinase N-terminal region; InterPro: IPR008040 This domain is found at the N terminus of the hydantoinase/oxoprolinase IPR002821 from INTERPRO family	Back alignment and domain information

>PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P)	Back alignment and domain information

>KOG1369 consensus Hexokinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A	Back alignment and domain information

>TIGR02627 rhamnulo_kin rhamnulokinase	Back alignment and domain information

>PRK13320 pantothenate kinase; Reviewed	Back alignment and domain information

>PRK09472 ftsA cell division protein FtsA; Reviewed	Back alignment and domain information

>PRK13324 pantothenate kinase; Reviewed	Back alignment and domain information

>smart00842 FtsA Cell division protein FtsA	Back alignment and domain information

>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit	Back alignment and domain information

>PRK13317 pantothenate kinase; Provisional	Back alignment and domain information

>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D	Back alignment and domain information

>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15	Back alignment and domain information

>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism]	Back alignment and domain information

>PRK13326 pantothenate kinase; Reviewed	Back alignment and domain information

>TIGR00671 baf pantothenate kinase, type III	Back alignment and domain information

>TIGR01174 ftsA cell division protein FtsA	Back alignment and domain information

>TIGR00329 gcp_kae1 metallohydrolase, glycoprotease/Kae1 family	Back alignment and domain information

>PRK09604 UGMP family protein; Validated	Back alignment and domain information

>PRK10854 exopolyphosphatase; Provisional	Back alignment and domain information

>PF14574 DUF4445: Domain of unknown function (DUF4445); PDB: 3ZYY_X	Back alignment and domain information

>PRK13322 pantothenate kinase; Reviewed	Back alignment and domain information

>TIGR03706 exo_poly_only exopolyphosphatase	Back alignment and domain information

>PRK13331 pantothenate kinase; Reviewed	Back alignment and domain information

>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type	Back alignment and domain information

>PRK00109 Holliday junction resolvase-like protein; Reviewed	Back alignment and domain information

>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein	Back alignment and domain information

>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional	Back alignment and domain information

>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning]	Back alignment and domain information

>PLN02666 5-oxoprolinase	Back alignment and domain information

>PF13941 MutL: MutL protein	Back alignment and domain information

>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B	Back alignment and domain information

>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated	Back alignment and domain information

>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination	Back alignment and domain information

>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG1521 Pantothenate kinase type III (Bvg accessory factor family protein) [Transcription]	Back alignment and domain information

>smart00268 ACTIN Actin	Back alignment and domain information

>PRK13328 pantothenate kinase; Reviewed	Back alignment and domain information

>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00250 RNAse_H_YqgF RNAse H-fold protein YqgF	Back alignment and domain information

>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T	Back alignment and domain information

>TIGR03722 arch_KAE1 universal archaeal protein Kae1	Back alignment and domain information

>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton	Back alignment and domain information

>PF14639 YqgF: Holliday-junction resolvase-like of SPT6 ; PDB: 3PSI_A 3PSF_A	Back alignment and domain information

>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK13929 rod-share determining protein MreBH; Provisional	Back alignment and domain information

>PTZ00340 O-sialoglycoprotein endopeptidase-like protein; Provisional	Back alignment and domain information

>PTZ00186 heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>TIGR01175 pilM type IV pilus assembly protein PilM	Back alignment and domain information

>TIGR03723 bact_gcp putative glycoprotease GCP	Back alignment and domain information

>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PF03309 Pan_kinase: Type III pantothenate kinase; InterPro: IPR004619 Pantothenate kinase (PanK or CoaA) catalyses the first step of the universal five step coenzyme A (CoA) biosynthesis pathway	Back alignment and domain information

>TIGR03725 bact_YeaZ universal bacterial protein YeaZ	Back alignment and domain information

>KOG1385 consensus Nucleoside phosphatase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14878 UGMP family protein; Provisional	Back alignment and domain information

>PRK13928 rod shape-determining protein Mbl; Provisional	Back alignment and domain information

>TIGR00904 mreB cell shape determining protein, MreB/Mrl family	Back alignment and domain information

>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes	Back alignment and domain information

>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon	Back alignment and domain information

>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton	Back alignment and domain information

>PRK13410 molecular chaperone DnaK; Provisional	Back alignment and domain information

>KOG2531 consensus Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism]	Back alignment and domain information

>CHL00094 dnaK heat shock protein 70	Back alignment and domain information

>PRK00290 dnaK molecular chaperone DnaK; Provisional	Back alignment and domain information

>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional	Back alignment and domain information

>PRK13411 molecular chaperone DnaK; Provisional	Back alignment and domain information

>PF02075 RuvC: Crossover junction endodeoxyribonuclease RuvC; InterPro: IPR002176 The Escherichia coli ruvC gene is involved in DNA repair and in the late step of RecE and RecF pathway recombination []	Back alignment and domain information

>COG3734 DgoK 2-keto-3-deoxy-galactonokinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PTZ00466 actin-like protein; Provisional	Back alignment and domain information

>COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00039 ruvC Holliday junction resolvase; Reviewed	Back alignment and domain information

>PRK01433 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>COG4020 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>COG5146 PanK Pantothenate kinase, acetyl-CoA regulated [Coenzyme metabolism]	Back alignment and domain information

>PRK13930 rod shape-determining protein MreB; Provisional	Back alignment and domain information

>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		235
2e2n_A		299	Crystal Structure Of Sulfolobus Tokodaii Hexokinase		2e-08
2ch6_A		344	Crystal Structure Of Human N-Acetylglucosamine Kina		9e-06
2ch5_A		347	Crystal Structure Of Human N-Acetylglucosamine Kina		9e-06

>pdb|2E2N|A Chain A, Crystal Structure Of Sulfolobus Tokodaii Hexokinase In The Apo Form Length = 299

Back alignment and structure

Iteration: 1

Score = 55.8 bits (133), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 50/203 (24%), Positives = 92/203 (45%), Gaps = 20/203 (9%) Query: 23 VILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMA 82 +I+G+D G T T + + ++G N+++VG A E I++ + Sbjct: 3 IIVGVDAGGTKTKAVAYDCEG---------NFIGEGSSGPGNYHNVGLTRAIENIKEAVK 53 Query: 83 DALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVHNDALAALASGT 142 A + V + V+G++ D + I P ++ + +D + AL + T Sbjct: 54 IA------AKGEADVVGMGVAGLDSKFDWENFTPLASLIAP---KVIIQHDGVIALFAET 104 Query: 143 MGKLHGCVLIAGTGTIAYGFTEXXXXXXXXXXXPILGDWGSGYGIAAQALTAVIRAYDGR 202 +G+ G V+IAGTG++ G+ +L D GS Y + +AL V++ DG Sbjct: 105 LGE-PGVVVIAGTGSVVEGYN-GKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGL 162 Query: 203 GPDTMLTSNILSTLELSSPDELI 225 T+L + +L T+ + DEL+ Sbjct: 163 ENKTILYNKVLKTINVKDLDELV 185

PyMOL of 2e2n

>pdb|2CH6|A Chain A, Crystal Structure Of Human N-Acetylglucosamine Kinase In Complex With Adp And Glucose Length = 344

Back alignment and structure

>pdb|2CH5|A Chain A, Crystal Structure Of Human N-Acetylglucosamine Kinase In Complex With N-Acetylglucosamine Length = 347

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		235
2e2o_A		299	Hexokinase; acetate and sugar kinases, HSP70, acti	5e-43
1zc6_A		305	Probable N-acetylglucosamine kinase; NESG, Q7NU07_	1e-39
2ch5_A		347	NAGK protein; transferase, N-acetylglucosamine, gl	4e-38
1zbs_A		291	Hypothetical protein PG1100; alpha-beta protein.,	1e-32
1zxo_A		291	Conserved hypothetical protein Q8A1P1; NESG, BTR25	6e-26

>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Length = 299	Back alignment and structure

 Score =  146 bits (369), Expect = 5e-43
 Identities = 53/206 (25%), Positives = 96/206 (46%), Gaps = 20/206 (9%)

Query: 23  VILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMA 82
           +I+G+D G T T  +                 +   ++G  N+++VG   A E I++ + 
Sbjct: 3   IIVGVDAGGTKTKAVA---------YDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVK 53

Query: 83  DALLKSGSNRSAVRAVCLAVSGVNHPTDQQRILNWLRDIFPGNVRLYVHNDALAALASGT 142
            A       +     V + V+G++   D +        I P   ++ + +D + AL + T
Sbjct: 54  IAA------KGEADVVGMGVAGLDSKFDWENFTPLASLIAP---KVIIQHDGVIALFAET 104

Query: 143 MGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALTAVIRAYDGR 202
           +G+  G V+IAGTG++  G+       R  G G +L D GS Y +  +AL  V++  DG 
Sbjct: 105 LGE-PGVVVIAGTGSVVEGYN-GKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGL 162

Query: 203 GPDTMLTSNILSTLELSSPDELIGYM 228
              T+L + +L T+ +   DEL+ + 
Sbjct: 163 ENKTILYNKVLKTINVKDLDELVMWS 188

PyMOL of 2e2o

>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5 Length = 305	Back alignment and structure

>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Length = 347	Back alignment and structure

>1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5 Length = 291	Back alignment and structure

>1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5 Length = 291	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		235
1zc6_A		305	Probable N-acetylglucosamine kinase; NESG, Q7NU07_	100.0
2ch5_A		347	NAGK protein; transferase, N-acetylglucosamine, gl	100.0
1zbs_A		291	Hypothetical protein PG1100; alpha-beta protein.,	99.97
1zxo_A		291	Conserved hypothetical protein Q8A1P1; NESG, BTR25	99.97
2e2o_A		299	Hexokinase; acetate and sugar kinases, HSP70, acti	99.97
2qm1_A		326	Glucokinase; alpha-beta structure, putative helix-	99.92
3vgl_A		321	Glucokinase; ROK family, transferase; HET: BGC ANP	99.87
3r8e_A		321	Hypothetical sugar kinase; ribonuclease H-like mot	99.86
1z05_A		429	Transcriptional regulator, ROK family; structural	99.86
2yhw_A		343	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N	99.86
2ap1_A		327	Putative regulator protein; zinc binding protein,	99.85
1z6r_A		406	MLC protein; transcriptional repressor, ROK family	99.85
4db3_A		327	Glcnac kinase, N-acetyl-D-glucosamine kinase; stru	99.85
2hoe_A		380	N-acetylglucosamine kinase; TM1224, structural gen	99.84
2aa4_A		289	Mannac kinase, putative N-acetylmannosamine kinase	99.84
2gup_A		292	ROK family protein; sugar kinase, streptococcus pn	99.84
4htl_A		297	Beta-glucoside kinase; structural genomics, sugar	99.84
3htv_A		310	D-allose kinase, allokinase; NP_418508.1, structur	99.83
3vov_A		302	Glucokinase, hexokinase; ROK, sugar kinase, transf	99.83
3epq_A		302	Putative fructokinase; SCRK, ADP binding, PSI2, MC	99.81
1woq_A		267	Inorganic polyphosphate/ATP-glucomannokinase; tran	99.81
3mcp_A		366	Glucokinase; structural genomics, joint center for	99.78
3lm2_A		226	Putative kinase; structural genomics, joint center	99.76
1sz2_A		332	Glucokinase, glucose kinase; ATP-dependent, glucos	99.73
2q2r_A		373	Glucokinase 1, putative; ATPase hexose kinase fami	99.73
1saz_A		381	Probable butyrate kinase 2; askha (acetate and sug	99.65
1cza_N		917	Hexokinase type I; structurally homologous domains	99.63
2yhx_A		457	Hexokinase B; transferase(phosphoryl,alcohol accep	99.62
1bdg_A		451	Hexokinase; phosphotransferase; HET: GLC; 2.60A {S	99.61
1cza_N		917	Hexokinase type I; structurally homologous domains	99.36
3o8m_A		485	Hexokinase; rnaseh-like fold, glycolysis, glucose	99.16
4e1j_A		520	Glycerol kinase; structural genomics, PSI-biology,	99.03
2zf5_O		497	Glycerol kinase; hyperthermophilic archaeon, ATP-b	98.93
3hm8_A		445	Hexokinase-3; glucose, glucose-6-phosphate, non-pr	98.92
3g25_A		501	Glycerol kinase; IDP00743, ATP-binding, glycerol m	98.92
3ezw_A		526	Glycerol kinase; glycerol metabolism, allosteric r	98.92
3ifr_A		508	Carbohydrate kinase, FGGY; xylulose kinase, SGX, s	98.9
2p3r_A		510	Glycerol kinase; glycerol metabolism, allosteric r	98.85
3hz6_A		511	Xylulokinase; xylulose, structural genomic, chromo	98.85
2w40_A		503	Glycerol kinase, putative; closed conformation, ma	98.85
3h3n_X		506	Glycerol kinase; ATP-binding, glycerol metabolism,	98.81
2dpn_A		495	Glycerol kinase; thermus thermophilus HB8, structu	98.8
3l0q_A		554	Xylulose kinase; xlylulose kinase, SGX, PSI, struc	98.74
3f9m_A		470	Glucokinase; hexokinase IV, ATP-binding, diabetes	98.73
2d4w_A		504	Glycerol kinase; alpha and beta protein, ribonucle	98.71
3ll3_A		504	Gluconate kinase; xylulose kinase, nysgx, ATP, ADP	98.69
3jvp_A		572	Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su	98.64
3h6e_A		482	Carbohydrate kinase, FGGY; novosphingobium aromati	98.59
2itm_A		484	Xylulose kinase, xylulokinase; ATPase, FGGY kinase	98.52
4bc3_A		538	Xylulose kinase; transferase, glucuronate xyluloki	98.48
3i8b_A		515	Xylulose kinase; strain ATCC 15703 / DSM 20083, 11	98.45
3djc_A		266	Type III pantothenate kinase; structural genomics,	98.37
3bex_A		249	Type III pantothenate kinase; actin-like fold, ATP	98.31
2uyt_A		489	Rhamnulokinase; rhamnose degradation, IN-LINE phos	98.25
4ehu_A		276	Activator of 2-hydroxyisocaproyl-COA dehydratase;	98.19
3h1q_A		272	Ethanolamine utilization protein EUTJ; ethanolamin	98.05
1hux_A		270	Activator of (R)-2-hydroxyglutaryl-COA dehydratase	97.8
2h3g_X		268	Biosynthetic protein; pantothenate kinase, anthrax	97.78
2ivn_A		330	O-sialoglycoprotein endopeptidase; UP1 keops compl	96.68
2f9w_A		271	Pantothenate kinase; COAA, transferase; HET: PAU;	96.58
4a2a_A		419	Cell division protein FTSA, putative; cell cycle,	96.56
1nu0_A		138	Hypothetical protein YQGF; structural genomics, st	96.19
1t6c_A		315	Exopolyphosphatase; alpha/beta protein, actin-like	96.0
3zyy_X		631	Iron-sulfur cluster binding protein; iron-sulfur-b	95.77
3mdq_A		315	Exopolyphosphatase; structural genomics, joint cen	95.7
2fxu_A		375	Alpha-actin-1, actin, alpha skeletal muscle; actin	95.69
3eno_A		334	Putative O-sialoglycoprotein endopeptidase; hydrol	94.92
3cet_A		334	Conserved archaeal protein; Q6M145, MRR63, NESG, X	94.74
1iv0_A		98	Hypothetical protein; rnaseh-like, YQGF, structura	94.59
3bzc_A		785	TEX; helix-turn-helix, helix-hairpin-helix, S1 dom	94.56
1u6z_A		513	Exopolyphosphatase; alpha/beta protein, askha (ace	94.45
2ych_A		377	Competence protein PILM; cell cycle, type IV pilus	94.32
1jce_A		344	ROD shape-determining protein MREB; MBL, actin, HS	94.25
4gni_A		409	Putative heat shock protein; HSP70-type ATPase, AT	94.21
1vhx_A		150	Putative holliday junction resolvase; structural g	94.14
1k8k_A		418	ARP3, actin-like protein 3, actin-2; beta-propelle	94.13
3r6m_A		213	YEAZ, resuscitation promoting factor; actin/HSP70	93.85
3en9_A		540	Glycoprotease, O-sialoglycoprotein endopeptidase/p	93.54
1nbw_A		607	Glycerol dehydratase reactivase alpha subunit; mol	93.42
3qfu_A		394	78 kDa glucose-regulated protein homolog; HSP70, K	93.24
3cer_A		343	Possible exopolyphosphatase-like protein; NESG, BL	93.11
3psf_A		1030	Transcription elongation factor SPT6; nucleus; 2.5	93.06
3hi0_A		508	Putative exopolyphosphatase; 17739545, structural	92.55
2a6a_A		218	Hypothetical protein TM0874; glycoprotein endopept	92.55
3psi_A		1219	Transcription elongation factor SPT6; nucleus; 3.3	92.45
3t69_A		330	Putative 2-dehydro-3-deoxygalactonokinase; structu	91.81
2d0o_A		610	DIOL dehydratase-reactivating factor large subunit	91.64
2v7y_A		509	Chaperone protein DNAK; HSP70, heat shock protein,	91.06
2gel_A		231	Putative GRAM negative resuscitation promoting FA;	90.85
1dkg_D		383	Molecular chaperone DNAK; HSP70, GRPE, nucleotide	89.66
3qb0_A		498	Actin-related protein 4; actin fold, ATP binding,	89.49
3i33_A		404	Heat shock-related 70 kDa protein 2; protein-ADP c	89.49
4b9q_A		605	Chaperone protein DNAK; HET: ATP; 2.40A {Escherich	88.79
3aap_A		353	Ectonucleoside triphosphate diphosphohydrolase I;	86.29
3d2f_A		675	Heat shock protein homolog SSE1; nucleotide exchan	85.57
1hjr_A		158	Holliday junction resolvase (RUVC); site-specific	84.93
3nuw_A		295	2-OXO-3-deoxygalactonate kinase; structural genomi	84.57
4ep4_A		166	Crossover junction endodeoxyribonuclease RUVC; res	83.7
2kho_A		605	Heat shock protein 70; molecular chaperone, HSP70,	81.32
4ijn_A		398	Acetate kinase, acetokinase; proprionate kinase, A	80.33

>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5	Back alignment and structure

Probab=100.00  E-value=2.2e-31  Score=234.58  Aligned_cols=192  Identities=24%  Similarity=0.299  Sum_probs=167.3

Q ss_pred             cEEEEEEcCccceEEEEEeCccCCCCCCCCCCEEEEEEeCCCCCccCCHHHHHHHHHHHHHHHHHHcCCCcccc--eeeE
Q 026689           22 EVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVMADALLKSGSNRSAV--RAVC   99 (235)
Q Consensus        22 ~~~LgiD~GgT~t~~~l~d~~~~~~~~~~~g~il~~~~~~~~~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i--~~ig   99 (235)
                      +|+||||+|+|++|++++|.         +|+++.+.+.++.++. ++++++++.+.+++++++++.+.++++|  .+|+
T Consensus        11 ~~~lGiDiGgT~i~~~l~d~---------~G~il~~~~~~~~~~~-~~~~~~~~~l~~~i~~~l~~~~~~~~~i~~~~ig   80 (305)
T 1zc6_A           11 RYLIGVDGGGTGTRIRLHAS---------DGTPLAMAEGGASALS-QGIAKSWQAVLSTLEAAFQQAGLPAAPASACAIG   80 (305)
T ss_dssp             CEEEEEEECSSCEEEEEEET---------TCCEEEEEEESCCCGG-GCHHHHHHHHHHHHHHHHHHTTCCCCCGGGEEEE
T ss_pred             CEEEEEEcCccceEEEEEcC---------CCCEEEEEeCCCCCcc-cCHHHHHHHHHHHHHHHHHhcCCChhhhccceEE
Confidence            49999999999999999999         8999998877555553 6899999999999999999888776676  7899


Q ss_pred             EeccCCCCccHHHHHHHHHHhhCC-CCceEEEeCcHHHHHHhhcCCCCCEEEEEeCCCceeEEEecCCcEEEeCCCCccc
Q 026689          100 LAVSGVNHPTDQQRILNWLRDIFP-GNVRLYVHNDALAALASGTMGKLHGCVLIAGTGTIAYGFTEDGRDARAAGAGPIL  178 (235)
Q Consensus       100 igi~G~~~~~~~~~l~~~l~~~~~-~~~~v~v~NDa~~a~~~~~~g~~~gi~li~GTGs~~~g~~~~G~~~~~Gg~G~ll  178 (235)
                      +|+||+.++..+..    |++.|+ . .||.|+||++++++++. +.++++++++|||+++++++.||++.++|||||++
T Consensus        81 ig~pG~v~~~~~~~----l~~~~~~~-~pv~v~NDa~aaa~ge~-~~~~~v~v~~GTGigg~~i~~~G~~~~aGe~Gh~~  154 (305)
T 1zc6_A           81 LGLSGVHNRQWAGE----FESQAPGF-ARLSLATDGYTTLLGAH-GGQPGIIVALGTGSIGEALYPDGSHREAGGWGYPS  154 (305)
T ss_dssp             EEESCCCTTSHHHH----HHHTCCCC-SEEEEECHHHHHHHHHT-TTSSEEEEEESSSEEEEEECTTSCEEEESCCCTTT
T ss_pred             EEecCCCchHHHHH----HHHhCCCC-ceEEEECCHHHHHHhhc-CCCCeEEEEecCCeEEEEEeCCCcEEEecCccccc
Confidence            99999988776543    666674 3 79999999999999875 45789999999999777776699999999999999


Q ss_pred             cccchHHHHHHHHHHHHHHHhcCCCCCchhHHHHHHHcCCCChhhHHHHHHh
Q 026689          179 GDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELIGYMIY  230 (235)
Q Consensus       179 gd~gSg~~ig~~al~~~~~~~dg~~~~t~l~~~~~~~~~~~~~~~l~~~~y~  230 (235)
                      +|+||++|+|++++...++..|++.+.+.+...+.+.++ .+.++++.++|.
T Consensus       155 ~d~g~~~~iG~~~~~~~~~~~~g~~~~~~~~~~~~~~~~-~~~~~l~~~~~~  205 (305)
T 1zc6_A          155 GDEASGAWLGQRAAQLTQMALDGRHSHSPLTRAVLDFVG-GDWQAMMAWNGR  205 (305)
T ss_dssp             SCTTSHHHHHHHHHHHHHHHHHTSSCCCHHHHHHHHHHT-SSHHHHHHHHHT
T ss_pred             CCCchHHHHHHHHHHHHHHHHhCCCCCChHHHHHHHHHC-cCHHHHHHHHhc
Confidence            999999999999999999999998888899999999998 578888887764

PyMOL of 1zc6

>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A*	Back alignment and structure

>1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5	Back alignment and structure

>1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5	Back alignment and structure

>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A*	Back alignment and structure

>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis}	Back alignment and structure

>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A*	Back alignment and structure

>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii}	Back alignment and structure

>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10	Back alignment and structure

>2yhw_A Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; transferase, sialic acid, mannac, ROK family; HET: BM3 2PE; 1.64A {Homo sapiens} PDB: 2yhy_A* 2yi1_A* 3eo3_A	Back alignment and structure

>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10	Back alignment and structure

>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A	Back alignment and structure

>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus}	Back alignment and structure

>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10	Back alignment and structure

>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10	Back alignment and structure

>2gup_A ROK family protein; sugar kinase, streptococcus pneumoniae TIGR4, AP sucrose, structural genomics, PSI; HET: SUC; 2.01A {Streptococcus pneumoniae} SCOP: c.55.1.10 c.55.1.10	Back alignment and structure

>4htl_A Beta-glucoside kinase; structural genomics, sugar kinase, ROK family, PSI-biology, center for structural genomics, MCSG, transferase; HET: MSE; 1.64A {Listeria monocytogenes}	Back alignment and structure

>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12}	Back alignment and structure

>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus}	Back alignment and structure

>1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10	Back alignment and structure

>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis}	Back alignment and structure

>3lm2_A Putative kinase; structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2, transf; HET: MSE; 1.70A {Agrobacterium tumefaciens}	Back alignment and structure

>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A*	Back alignment and structure

>2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi}	Back alignment and structure

>1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A*	Back alignment and structure

>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A*	Back alignment and structure

>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A	Back alignment and structure

>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3	Back alignment and structure

>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A*	Back alignment and structure

>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X*	Back alignment and structure

>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti}	Back alignment and structure

>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis}	Back alignment and structure

>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens}	Back alignment and structure

>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A*	Back alignment and structure

>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y*	Back alignment and structure

>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum}	Back alignment and structure

>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A*	Back alignment and structure

>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A*	Back alignment and structure

>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O	Back alignment and structure

>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus}	Back alignment and structure

>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A*	Back alignment and structure

>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A*	Back alignment and structure

>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP}	Back alignment and structure

>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A*	Back alignment and structure

>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A	Back alignment and structure

>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A*	Back alignment and structure

>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703}	Back alignment and structure

>3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp}	Back alignment and structure

>3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A	Back alignment and structure

>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A*	Back alignment and structure

>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A	Back alignment and structure

>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid}	Back alignment and structure

>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5	Back alignment and structure

>2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str}	Back alignment and structure

>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A*	Back alignment and structure

>2f9w_A Pantothenate kinase; COAA, transferase; HET: PAU; 1.90A {Pseudomonas aeruginosa} SCOP: c.55.1.13 c.55.1.13 PDB: 2f9t_A*	Back alignment and structure

>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A*	Back alignment and structure

>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A	Back alignment and structure

>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A*	Back alignment and structure

>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans}	Back alignment and structure

>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii}	Back alignment and structure

>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ...	Back alignment and structure

>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum}	Back alignment and structure

>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A	Back alignment and structure

>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8	Back alignment and structure

>3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A	Back alignment and structure

>1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A*	Back alignment and structure

>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus}	Back alignment and structure

>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A	Back alignment and structure

>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var}	Back alignment and structure

>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8	Back alignment and structure

>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A	Back alignment and structure

>3r6m_A YEAZ, resuscitation promoting factor; actin/HSP70 nucleotide-binding fold, bacterial resuscitation BUT non-culturable state, Y YJEE; 3.10A {Vibrio parahaemolyticus}	Back alignment and structure

>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A*	Back alignment and structure

>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6	Back alignment and structure

>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705}	Back alignment and structure

>3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae}	Back alignment and structure

>3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str}	Back alignment and structure

>2a6a_A Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, JOI for structural genomics, JCSG; 2.50A {Thermotoga maritima} SCOP: c.55.1.9 c.55.1.9	Back alignment and structure

>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3t69_A Putative 2-dehydro-3-deoxygalactonokinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.55A {Sinorhizobium meliloti}	Back alignment and structure

>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A	Back alignment and structure

>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>2gel_A Putative GRAM negative resuscitation promoting FA; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium} PDB: 2gem_A 1okj_A	Back alignment and structure

>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1	Back alignment and structure

>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ...	Back alignment and structure

>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D	Back alignment and structure

>3aap_A Ectonucleoside triphosphate diphosphohydrolase I; adenosine triphosphatase, ntpdase; 1.60A {Legionella pneumophila} PDB: 3aaq_A* 3aar_A*	Back alignment and structure

>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A*	Back alignment and structure

>1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6	Back alignment and structure

>4ep4_A Crossover junction endodeoxyribonuclease RUVC; resolvase, hydrolase; 1.28A {Thermus thermophilus} PDB: 4ep5_A	Back alignment and structure

>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli}	Back alignment and structure

>4ijn_A Acetate kinase, acetokinase; proprionate kinase, ATP-dependent, metabolic intermediate biosynthesis, acetyl-COA biosynthesis, hydrolysis; HET: AMP; 1.70A {Mycobacterium smegmatis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		235
d2ch5a2		117	c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAG	2e-17
d1zc6a2		171	c.55.1.5 (A:122-292) Probable N-acetylglucosamine	9e-17
d2ch5a1		227	c.55.1.5 (A:118-344) N-acetylglucosamine kinase, N	2e-16
d1zxoa2		174	c.55.1.5 (A:107-280) Hypothetical protein BT3618 {	1e-14
d1zbsa1		176	c.55.1.5 (A:108-283) Hypothetical protein PG1100 {	5e-13
d1zbsa2		107	c.55.1.5 (A:1-107) Hypothetical protein PG1100 {Po	1e-11
d1zc6a1		114	c.55.1.5 (A:8-121) Probable N-acetylglucosamine ki	5e-08

>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Length = 117	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: BadF/BadG/BcrA/BcrD-like
domain: N-acetylglucosamine kinase, NAGK
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 73.6 bits (180), Expect = 2e-17
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 11/123 (8%)

Query: 22  EVILGLDGGTTSTVCICMPVISMSDSLPDPLPVLARAAAGCSNHNSVGEDAARETIEKVM 81
            +  G++GG T +  +          + +   +LA A    +NH  +G D   E I +++
Sbjct: 3   AIYGGVEGGGTRSEVLL---------VSEDGKILAEADGLSTNHWLIGTDKCVERINEMV 53

Query: 82  ADALLKSGSNRSA-VRAVCLAVSGVNHPTDQQRILNWLRDIFPG-NVRLYVHNDALAALA 139
             A  K+G +    +R++ L++SG +     + ++  LRD FP  +    +  DA  ++A
Sbjct: 54  NRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIA 113

Query: 140 SGT 142
           + T
Sbjct: 114 TAT 116

PyMOL of d2ch5a2

>d1zc6a2 c.55.1.5 (A:122-292) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Length = 171	Back information, alignment and structure

>d2ch5a1 c.55.1.5 (A:118-344) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Length = 227	Back information, alignment and structure

>d1zxoa2 c.55.1.5 (A:107-280) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 174	Back information, alignment and structure

>d1zbsa1 c.55.1.5 (A:108-283) Hypothetical protein PG1100 {Porphyromonas gingivalis [TaxId: 837]} Length = 176	Back information, alignment and structure

>d1zbsa2 c.55.1.5 (A:1-107) Hypothetical protein PG1100 {Porphyromonas gingivalis [TaxId: 837]} Length = 107	Back information, alignment and structure

>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Length = 114	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		235
d1zc6a2		171	Probable N-acetylglucosamine kinase CV2896 {Chromo	99.86
d2ch5a2		117	N-acetylglucosamine kinase, NAGK {Human (Homo sapi	99.85
d1zc6a1		114	Probable N-acetylglucosamine kinase CV2896 {Chromo	99.84
d1zbsa1		176	Hypothetical protein PG1100 {Porphyromonas gingiva	99.76
d2ch5a1		227	N-acetylglucosamine kinase, NAGK {Human (Homo sapi	99.76
d2ap1a2		117	Putative regulator protein YcfX {Salmonella typhim	99.75
d1zxoa2		174	Hypothetical protein BT3618 {Bacteroides thetaiota	99.75
d2aa4a1		119	N-acetylmannosamine kinase NanK {Escherichia coli	99.68
d2hoea3		128	N-acetylglucosamine kinase {Thermotoga maritima [T	99.67
d1z05a3		128	Transcriptional regulator VC2007 {Vibrio cholerae	99.64
d1woqa1		129	Inorganic polyphosphate/ATP-glucomannokinase PPGMK	99.63
d1zbsa2		107	Hypothetical protein PG1100 {Porphyromonas gingiva	99.6
d2gupa1		114	Hypothetical protein SP2142 {Streptococcus pneumon	99.59
d1z6ra2		129	Mlc protein {Escherichia coli [TaxId: 562]}	99.56
d1xc3a1		118	Putative fructokinase YhdR {Bacillus subtilis [Tax	99.56
d1sz2a1		319	Glucokinase Glk {Escherichia coli [TaxId: 562]}	99.56
d1q18a1		110	Glucokinase Glk {Escherichia coli [TaxId: 562]}	99.47
d1huxa_		259	Hydroxyglutaryl-CoA dehydratase component A {Acida	99.2
d2p3ra1		252	Glycerol kinase {Escherichia coli [TaxId: 562]}	98.94
d1zxoa1		104	Hypothetical protein BT3618 {Bacteroides thetaiota	98.69
d1r59o1		252	Glycerol kinase {Enterococcus casseliflavus [TaxId	98.53
d1bdga1		208	Hexokinase {Blood fluke (Schistosoma mansoni) [Tax	97.73
d3bzka5		149	Transcriptional accessory factor Tex {Pseudomonas	97.71
d2ewsa1		267	Type II pantothenate kinase, CoaW {Staphylococcus	97.69
d1czan3		205	Mammalian type I hexokinase {Human (Homo sapiens)	97.56
d1czan1		207	Mammalian type I hexokinase {Human (Homo sapiens)	97.52
d2gupa2		175	Hypothetical protein SP2142 {Streptococcus pneumon	97.49
d1v4sa1		205	Glucokinase {Human (Homo sapiens) [TaxId: 9606]}	97.46
d1ig8a1		207	Hexokinase {Baker's yeast (Saccharomyces cerevisia	97.31
d1z05a2		197	Transcriptional regulator VC2007 {Vibrio cholerae	97.3
d1z6ra3		196	Mlc protein {Escherichia coli [TaxId: 562]}	97.24
d2ap1a1		186	Putative regulator protein YcfX {Salmonella typhim	97.09
d2aa4a2		170	N-acetylmannosamine kinase NanK {Escherichia coli	96.87
d1woqa2		124	Inorganic polyphosphate/ATP-glucomannokinase PPGMK	96.84
d2hoea2		169	N-acetylglucosamine kinase {Thermotoga maritima [T	96.81
d1xc3a2		176	Putative fructokinase YhdR {Bacillus subtilis [Tax	96.75
d1e4ft1		193	Cell division protein FtsA {Thermotoga maritima [T	96.57
d1t6ca1		126	Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6	95.56
d2d0oa2		241	Diol dehydratase-reactivating factor large subunit	95.44
d1nbwa2		239	ATPase domain of the glycerol dehydratase reactiva	95.26
d1nu0a_		138	Hypothetical protein YqgF (RuvX) {Escherichia coli	94.99
d3bexa1		118	Type III pantothenate kinase, CoaX {Thermotoga mar	94.9
d1iv0a_		98	Hypothetical protein, YqgF homologue {Thermus ther	94.06
d1jcea1		137	Prokaryotic actin homolog MreB {Thermotoga maritim	93.9
d1saza1		172	butyrate kinase 2 {Thermotoga maritima [TaxId: 233	93.33
d1okja1		106	Hypothetical protein YeaZ {Escherichia coli [TaxId	93.32
d1vhxa_		140	Hypothetical protein YrrK (RuvX) {Bacillus subtili	92.79
d2f9wa2		114	Type III pantothenate kinase, CoaX {Pseudomonas ae	92.34
d1u6za2		124	Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5	92.02
d1hjra_		158	RuvC resolvase {Escherichia coli [TaxId: 562]}	87.3
d1g99a1		197	Acetate kinase {Archaeon Methanosarcina thermophil	82.45

>d1zc6a2 c.55.1.5 (A:122-292) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: BadF/BadG/BcrA/BcrD-like
domain: Probable N-acetylglucosamine kinase CV2896
species: Chromobacterium violaceum [TaxId: 536]

Probab=99.86  E-value=1e-21  Score=158.19  Aligned_cols=85  Identities=26%  Similarity=0.293  Sum_probs=80.5

Q ss_pred             CCEEEEEeCCCceeEEEecCCcEEEeCCCCccccccchHHHHHHHHHHHHHHHhcCCCCCchhHHHHHHHcCCCChhhHH
Q 026689          146 LHGCVLIAGTGTIAYGFTEDGRDARAAGAGPILGDWGSGYGIAAQALTAVIRAYDGRGPDTMLTSNILSTLELSSPDELI  225 (235)
Q Consensus       146 ~~gi~li~GTGs~~~g~~~~G~~~~~Gg~G~llgd~gSg~~ig~~al~~~~~~~dg~~~~t~l~~~~~~~~~~~~~~~l~  225 (235)
                      ++|+++++||||++++++.+|+..++|||||++||+|||||||+++++..++++|++.++|+|.+.++++|+. +...++
T Consensus         1 ~pGivviaGTGSi~~~~~~~g~~~r~GGwG~~lGD~GSg~wiG~~al~~~l~~~Dg~~~~t~L~~~~~~~~~~-~~~~~~   79 (171)
T d1zc6a2           1 QPGIIVALGTGSIGEALYPDGSHREAGGWGYPSGDEASGAWLGQRAAQLTQMALDGRHSHSPLTRAVLDFVGG-DWQAMM   79 (171)
T ss_dssp             SSEEEEEESSSEEEEEECTTSCEEEESCCCTTTSCTTSHHHHHHHHHHHHHHHHHTSSCCCHHHHHHHHHHTS-SHHHHH
T ss_pred             CCeEEEEecCCceeEEECCCCCEEEcCCCCcccCCCccHHHHHHHHHHHHHHHHHCCCCCcHHHHHHHHhcCC-CHHHHH
Confidence            4799999999999999999999999999999999999999999999999999999999999999999999996 788899


Q ss_pred             HHHHhh
Q 026689          226 GYMIYK  231 (235)
Q Consensus       226 ~~~y~~  231 (235)
                      .+.|+.
T Consensus        80 ~~~~~~   85 (171)
T d1zc6a2          80 AWNGRA   85 (171)
T ss_dssp             HHHHTC
T ss_pred             HHHhcC
Confidence            888864

PyMOL of d1zc6a2

>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]}	Back information, alignment and structure

>d1zbsa1 c.55.1.5 (A:108-283) Hypothetical protein PG1100 {Porphyromonas gingivalis [TaxId: 837]}	Back information, alignment and structure

>d2ch5a1 c.55.1.5 (A:118-344) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1zxoa2 c.55.1.5 (A:107-280) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]}	Back information, alignment and structure

>d1zbsa2 c.55.1.5 (A:1-107) Hypothetical protein PG1100 {Porphyromonas gingivalis [TaxId: 837]}	Back information, alignment and structure

>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]}	Back information, alignment and structure

>d1zxoa1 c.55.1.5 (A:3-106) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}	Back information, alignment and structure

>d1bdga1 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}	Back information, alignment and structure

>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1czan1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gupa2 c.55.1.10 (A:115-289) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]}	Back information, alignment and structure

>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1z6ra3 c.55.1.10 (A:211-406) Mlc protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2aa4a2 c.55.1.10 (A:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1woqa2 c.55.1.10 (A:140-263) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]}	Back information, alignment and structure

>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xc3a2 c.55.1.10 (A:119-294) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2d0oa2 c.55.1.6 (A:1-92,A:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]}	Back information, alignment and structure

>d1nbwa2 c.55.1.6 (A:2-91,A:257-405) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3bexa1 c.55.1.13 (A:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2f9wa2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1u6za2 c.55.1.8 (A:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g99a1 c.55.1.2 (A:1-197) Acetate kinase {Archaeon Methanosarcina thermophila [TaxId: 2210]}	Back information, alignment and structure