Citrus Sinensis ID: 026746

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MDEFLGDQFHGEGDIFFWLDNEALPVNQSAFVAYANRPRTEFVSQNAGNGSNSLSANKRMIQFLRKIQPAKMEHPELDSERGHRHVINERMRRERERQNYLALHSILPPGTKNDKNSIVKTTANMIHELQCCKQELERKNYELESNLGLKNGGTKVRVNVDNPTSGVDSMLEVLKCLKDLGSSTRSIQAEFSDQKLTAVLDIETQMGAGAVEKDVQRALQKVEDKLLFRHYQEG
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEEccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccc
cccHHHHHHcccccEEEEEcccccccccHHHHHHcccccHHHcccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEcccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccc
mdeflgdqfhgegdiffwldnealpvnqsafvayanrprtefvsqnagngsnslSANKRMIQFLRKiqpakmehpeldserghrHVINERMRRERERQNYLALhsilppgtkndknsIVKTTANMIHELQCCKQELERKNYelesnlglknggtkvrvnvdnptsgvDSMLEVLKCLKDLGSSTRSIQAEFSDQKLTAVLDIETQMGAGAVEKDVQRALQKVEDKLLFRHYQEG
MDEFLGDQFHGEGDIFFWLDNEALPVNQSAFVAYANRPRTEFVsqnagngsnslsANKRMIQFLRKIQPakmehpeldserghrhvINERMRRERERQNYLAlhsilppgtkndkNSIVKTTANMIHELQCCKQELERKNYELEsnlglknggtkvrvnVDNPTSGVDSMLEVLKCLKDLGSSTRSIqaefsdqklTAVLDIETQMGAGAVEKDVQRALQKVEDKLlfrhyqeg
MDEFLGDQFHGEGDIFFWLDNEALPVNQSAFVAYANRPRTEFVsqnagngsnslsanKRMIQFLRKIQPAKMEHPELDSERGHRHVINermrrererQNYLALHSILPPGTKNDKNSIVKTTANMIHELQCCKQELERKNYELESNLGLKNGGTKVRVNVDNPTSGVDSMLEVLKCLKDLGSSTRSIQAEFSDQKLTAVLDIETQMGAGAVEKDVQRALQKVEDKLLFRHYQEG
******DQFHGEGDIFFWLDNEALPVNQSAFVAYANR***************************************************************LALHSI***********IVKTTANMIHELQCCKQELERKNYELESNLGLKNGGTKVRVNVD***SGVDSMLEVLKCLKDLG*********F*DQKLTAVLDIETQMGAGAVE**V***L**V**KLLF******
**EFL**QFHGEGDIFFWL**************************************************************************ERERQNYLALHSILPPGTKNDKNSIVKTTANMIHELQ************************************************D***********FSDQKLTAVLDIE*********KDVQRALQKVEDKLL*******
MDEFLGDQFHGEGDIFFWLDNEALPVNQSAFVAYANRPRTEFVSQNAGNGSNSLSANKRMIQFLRKIQPAKMEHPELDSERGHRHVINERMRRERERQNYLALHSILPPGTKNDKNSIVKTTANMIHELQCCKQELERKNYELESNLGLKNGGTKVRVNVDNPTSGVDSMLEVLKCLKDLGSSTRSIQAEFSDQKLTAVLDIETQMGAGAVEKDVQRALQKVEDKLLFRHYQEG
*DEFLGDQFHGEGDIFFWLDNEALPVNQSAFVAYANRPR**************************************************RMRRERERQNYLALHSILPPGTKNDKNSIVKTTANMIHELQCCKQELERKNYELESNLGLKNGGTKVRVNVDNPTSGVDSMLEVLKCLKDLGSSTRSIQAEFSDQKLTAVLDIETQMGAGAVEKDVQRALQKVEDKLLFRHY***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEFLGDQFHGEGDIFFWLDNEALPVNQSAFVAYANRPRTEFVSQNAGNGSNSLSANKRMIQFLRKIQPAKMEHPELDSERGHRHVINERMRRERERQNYLALHSILPPGTKNDKNSIVKTTANMxxxxxxxxxxxxxxxxxxxxxLGLKNGGTKVRVNVDNPTSGVDSMLEVLKCLKDLGSSTRSIQAEFSDQKLTAVLDIETQMGAGAVEKDVQRALQKVEDKLLFRHYQEG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query234 2.2.26 [Sep-21-2011]
Q9FIX5247 Transcription factor bHLH yes no 0.863 0.817 0.431 1e-36
Q9LTS4466 Putative transcription fa no no 0.273 0.137 0.406 4e-06
Q2HIV9248 Transcription factor bHLH no no 0.290 0.274 0.382 9e-05
Q9CAD0596 Transcription factor EGL1 no no 0.628 0.246 0.238 0.0002
Q9FT81518 Transcription factor TT8 no no 0.585 0.264 0.255 0.0002
Q9LNJ5590 Transcription factor bHLH no no 0.337 0.133 0.325 0.0008
>sp|Q9FIX5|BH092_ARATH Transcription factor bHLH92 OS=Arabidopsis thaliana GN=BHLH92 PE=2 SV=1 Back     alignment and function desciption
 Score =  152 bits (385), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 129/211 (61%), Gaps = 9/211 (4%)

Query: 23  ALPVNQSAFVAYANRPRTEFVSQNAGNGSNSLSANKRMIQFLRKIQPAKMEHPELDSERG 82
           ++P+ +SAF +Y     TE    +    S+ ++  KRM+  LRK    K      + ER 
Sbjct: 31  SVPI-RSAFRSYMKD--TELRMMSPKISSSKVNVKKRMVNLLRKNWEEKKNTVAPEKERS 87

Query: 83  HRHVINERMRRERERQNYLALHSILPPGTKNDKNSIVKTTANMIHELQCCKQELERKNYE 142
            RH++ ER RRE+++Q+YLALHS+LP  TKNDKNSIV+   + I +LQ  K+EL R+   
Sbjct: 88  RRHMLKERTRREKQKQSYLALHSLLPFATKNDKNSIVEKAVDEIAKLQRLKKELVRRIKV 147

Query: 143 LESNLGLKNGG-----TKVRVNVDNPTSGVDSMLEVLKCLKDLGSSTRSIQAEFSDQKLT 197
           +E     K+G      TKVRVN+  P SG+DSMLE L  LK +G+  +++ A FS Q+ +
Sbjct: 148 IEEK-SAKDGHDEMSETKVRVNLKEPLSGLDSMLEALHYLKSMGTKLKTVHANFSPQEFS 206

Query: 198 AVLDIETQMGAGAVEKDVQRALQKVEDKLLF 228
           A + IETQ+    VEK V+R LQ+ E KLLF
Sbjct: 207 ATMTIETQIRGEEVEKRVERRLQETEWKLLF 237

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LTS4|BH041_ARATH Putative transcription factor bHLH041 OS=Arabidopsis thaliana GN=BHLH41 PE=4 SV=1 Back     alignment and function description
>sp|Q2HIV9|BH035_ARATH Transcription factor bHLH35 OS=Arabidopsis thaliana GN=BHLH35 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAD0|EGL1_ARATH Transcription factor EGL1 OS=Arabidopsis thaliana GN=BHLH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FT81|TT8_ARATH Transcription factor TT8 OS=Arabidopsis thaliana GN=TT8 PE=1 SV=2 Back     alignment and function description
>sp|Q9LNJ5|BH013_ARATH Transcription factor bHLH13 OS=Arabidopsis thaliana GN=BHLH13 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
224099891301 predicted protein [Populus trichocarpa] 0.905 0.704 0.491 5e-50
255551943234 DNA binding protein, putative [Ricinus c 0.944 0.944 0.457 1e-43
224111044219 predicted protein [Populus trichocarpa] 0.914 0.977 0.497 4e-41
114145390247 basic helix-loop-helix protein [Nicotian 0.978 0.927 0.418 4e-39
225432921240 PREDICTED: transcription factor bHLH92 [ 0.935 0.912 0.402 7e-38
297788979247 basic helix-loop-helix family protein [A 0.965 0.914 0.416 6e-37
388507722257 unknown [Medicago truncatula] 0.961 0.875 0.437 3e-36
114145388221 basic helix-loop-helix protein [Nicotian 0.876 0.927 0.429 2e-35
356501781278 PREDICTED: transcription factor bHLH92-l 0.952 0.802 0.429 2e-35
15239929247 transcription factor bHLH92 [Arabidopsis 0.863 0.817 0.431 8e-35
>gi|224099891|ref|XP_002311662.1| predicted protein [Populus trichocarpa] gi|222851482|gb|EEE89029.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 153/228 (67%), Gaps = 16/228 (7%)

Query: 1   MDEFLGDQFHGEGDIFFWLDNEALPVNQSAFVAYANRPRTEFVSQNAGNGSNSLSA---- 56
           MD F   QF  +GD+F + +    PVNQSAFV Y  RP   +     G GS+S+      
Sbjct: 80  MDHFFQQQFL-QGDVFCYANG---PVNQSAFVPYICRP---WGGSEVGVGSSSIGVYPTN 132

Query: 57  -NKRMIQFLRKIQPAKMEHPELDSERGHRHVINERMRRERERQNYLALHSILPPGTKNDK 115
            N+RMI+F+R+    K+E  E DS+R +RH ++ER+RR+RER  YLALHS+LP  TK DK
Sbjct: 133 MNRRMIEFMRRSFTVKIETQEPDSKRCYRHKMSERLRRQRERNGYLALHSLLPHDTKKDK 192

Query: 116 NSIVKTTANMIHELQCCKQELERKNYELESNL---GLKN-GGTKVRVNVDNPTSGVDSML 171
           NSI+   A  I EL+  K+ L+R+N E+E  L   G++N   TK+R+ V NPTSGVD M+
Sbjct: 193 NSIMLMAAKKIQELEMYKEMLKRRNDEIEERLAASGIRNVESTKIRIEVANPTSGVDPMI 252

Query: 172 EVLKCLKDLGSSTRSIQAEFSDQKLTAVLDIETQMGAGAVEKDVQRAL 219
           +VLKCLK LG+ TRSIQ++FSDQ+L AV++IET++ A  +E  V+R L
Sbjct: 253 DVLKCLKSLGTKTRSIQSQFSDQELVAVMEIETKIEAAEIENAVKRTL 300

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255551943|ref|XP_002517016.1| DNA binding protein, putative [Ricinus communis] gi|223543651|gb|EEF45179.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111044|ref|XP_002315728.1| predicted protein [Populus trichocarpa] gi|222864768|gb|EEF01899.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|114145390|dbj|BAF30984.1| basic helix-loop-helix protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|225432921|ref|XP_002284231.1| PREDICTED: transcription factor bHLH92 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297788979|ref|XP_002862509.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] gi|297308072|gb|EFH38767.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388507722|gb|AFK41927.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|114145388|dbj|BAF30983.1| basic helix-loop-helix protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|356501781|ref|XP_003519702.1| PREDICTED: transcription factor bHLH92-like [Glycine max] Back     alignment and taxonomy information
>gi|15239929|ref|NP_199178.1| transcription factor bHLH92 [Arabidopsis thaliana] gi|75309129|sp|Q9FIX5.1|BH092_ARATH RecName: Full=Transcription factor bHLH92; AltName: Full=Basic helix-loop-helix protein 92; Short=AtbHLH92; Short=bHLH 92; AltName: Full=Transcription factor EN 22; AltName: Full=bHLH transcription factor bHLH092 gi|10178204|dbj|BAB11628.1| unnamed protein product [Arabidopsis thaliana] gi|17529208|gb|AAL38831.1| unknown protein [Arabidopsis thaliana] gi|20466035|gb|AAM20352.1| unknown protein [Arabidopsis thaliana] gi|332007608|gb|AED94991.1| transcription factor bHLH92 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
TAIR|locus:2158392247 BHLH92 "AT5G43650" [Arabidopsi 0.863 0.817 0.402 3.8e-30
UNIPROTKB|Q75KV9299 OJ1365_D05.18 "Putative helix- 0.632 0.494 0.344 7.2e-20
UNIPROTKB|Q5SMX2412 P0498B01.25 "Basic helix-loop- 0.645 0.366 0.268 9.5e-06
UNIPROTKB|Q5SMX4439 P0498B01.36 "cDNA clone:J03311 0.273 0.145 0.375 0.00038
TAIR|locus:2158392 BHLH92 "AT5G43650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 333 (122.3 bits), Expect = 3.8e-30, P = 3.8e-30
 Identities = 85/211 (40%), Positives = 116/211 (54%)

Query:    23 ALPVNQSAFVAYANRPRTEFVXXXXXXXXXXXXXXKRMIQFLRKIQPAKMEHPELDSERG 82
             ++P+ +SAF +Y     TE                KRM+  LRK    K      + ER 
Sbjct:    31 SVPI-RSAFRSYMKD--TELRMMSPKISSSKVNVKKRMVNLLRKNWEEKKNTVAPEKERS 87

Query:    83 HRHVINXXXXXXXXXQNYLALHSILPPGTKNDKNSIVKTTANMIHELQCCKQELERKNYE 142
              RH++          Q+YLALHS+LP  TKNDKNSIV+   + I +LQ  K+EL R+   
Sbjct:    88 RRHMLKERTRREKQKQSYLALHSLLPFATKNDKNSIVEKAVDEIAKLQRLKKELVRRIKV 147

Query:   143 LESNLGLKNGG-----TKVRVNVDNPTSGVDSMLEVLKCLKDLGSSTRSIQAEFSDQKLT 197
             +E     K+G      TKVRVN+  P SG+DSMLE L  LK +G+  +++ A FS Q+ +
Sbjct:   148 IEEK-SAKDGHDEMSETKVRVNLKEPLSGLDSMLEALHYLKSMGTKLKTVHANFSPQEFS 206

Query:   198 AVLDIETQMGAGAVEKDVQRALQKVEDKLLF 228
             A + IETQ+    VEK V+R LQ+ E KLLF
Sbjct:   207 ATMTIETQIRGEEVEKRVERRLQETEWKLLF 237
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
UNIPROTKB|Q75KV9 OJ1365_D05.18 "Putative helix-loop-helix DNA-binding protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SMX2 P0498B01.25 "Basic helix-loop-helix protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SMX4 P0498B01.36 "cDNA clone:J033115I17, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FIX5BH092_ARATHNo assigned EC number0.43120.86320.8178yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_VIII001444
hypothetical protein (301 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 1e-05
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 9e-04
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information 
 Score = 41.0 bits (97), Expect = 1e-05
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 84  RHVINERMRRERERQNYLALHSILP---PGTKNDKNSIVKTTANMIHELQ 130
            H + ER RRER    +  L S+LP   P  K  K  I++   + I  LQ
Sbjct: 7   AHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQ 56

A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and have a PAS domain which allows the dimerization between PAS proteins, the binding of small molecules (e.g., dioxin), and interactions with non-PAS proteins. Length = 60
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 234
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.43
smart0035353 HLH helix loop helix domain. 99.41
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.38
KOG1318411 consensus Helix loop helix transcription factor EB 98.49
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.37
KOG0561 373 consensus bHLH transcription factor [Transcription 98.35
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.21
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 97.91
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 97.83
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 97.82
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 97.72
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 97.63
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 97.59
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 97.33
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 97.31
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.23
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.23
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.18
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.01
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.01
PRK0019490 hypothetical protein; Validated 96.99
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.92
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.89
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 96.8
KOG4029228 consensus Transcription factor HAND2/Transcription 96.61
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.55
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 96.5
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 96.49
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 96.36
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 96.22
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 96.12
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 95.95
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 95.88
PLN0321793 transcription factor ATBS1; Provisional 95.82
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 95.81
PRK05007884 PII uridylyl-transferase; Provisional 95.22
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 94.65
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 94.54
PRK05092931 PII uridylyl-transferase; Provisional 94.53
PRK04435147 hypothetical protein; Provisional 94.45
PRK04374869 PII uridylyl-transferase; Provisional 94.23
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 94.23
PRK00275895 glnD PII uridylyl-transferase; Provisional 94.18
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 93.92
cd0211660 ACT ACT domains are commonly involved in specifica 93.67
PRK03059856 PII uridylyl-transferase; Provisional 93.65
PRK03381774 PII uridylyl-transferase; Provisional 93.64
PRK01759854 glnD PII uridylyl-transferase; Provisional 93.63
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 93.41
PRK03381774 PII uridylyl-transferase; Provisional 93.34
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 93.32
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 93.29
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 92.63
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 92.44
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 92.2
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 92.14
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 91.91
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 91.79
PRK08577136 hypothetical protein; Provisional 91.49
KOG4447173 consensus Transcription factor TWIST [Transcriptio 90.62
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 90.47
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 90.4
PRK01759854 glnD PII uridylyl-transferase; Provisional 90.3
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 90.11
PRK07334403 threonine dehydratase; Provisional 90.1
PRK05007 884 PII uridylyl-transferase; Provisional 90.03
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 89.53
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 89.34
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 88.88
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 88.16
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 87.95
KOG3910632 consensus Helix loop helix transcription factor [T 87.24
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 86.67
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 86.62
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 86.04
PRK00275 895 glnD PII uridylyl-transferase; Provisional 85.84
PRK03059856 PII uridylyl-transferase; Provisional 85.5
PRK05092 931 PII uridylyl-transferase; Provisional 85.49
PRK11589 190 gcvR glycine cleavage system transcriptional repre 84.67
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 84.64
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 84.38
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 83.42
PRK04374869 PII uridylyl-transferase; Provisional 83.41
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 82.5
COG383090 ACT domain-containing protein [Signal transduction 82.44
COG4492150 PheB ACT domain-containing protein [General functi 82.1
KOG3898254 consensus Transcription factor NeuroD and related 82.05
PRK11589190 gcvR glycine cleavage system transcriptional repre 80.98
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information 
Probab=99.43  E-value=2.2e-13  Score=94.93  Aligned_cols=54  Identities=33%  Similarity=0.441  Sum_probs=50.4

Q ss_pred             cccccchHHHHHHHHHHHHhHHHHHhCCCCC---CCCchhhhHHHHHHHHHHHHHHH
Q 026746           80 ERGHRHVINERMRRERERQNYLALHSILPPG---TKNDKNSIVKTTANMIHELQCCK  133 (234)
Q Consensus        80 ~~~~~H~~sER~RRekln~~f~~LrslvP~~---~K~DKaSIL~~aI~yIk~Le~~v  133 (234)
                      .....|..+||+||++||+.|..|+++||..   .|+||++||..||+||+.|+..+
T Consensus         3 ~~r~~~~~~Er~RR~~~n~~~~~L~~llp~~~~~~k~~k~~iL~~a~~yI~~L~~~~   59 (60)
T cd00083           3 SRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELL   59 (60)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            3467899999999999999999999999998   89999999999999999999875

A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 4e-05
1hlo_A80 Protein (transcription factor MAX); transcriptiona 9e-05
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 1e-04
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 1e-04
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
 Score = 40.1 bits (94), Expect = 4e-05
 Identities = 14/70 (20%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 79  SERGHRHVINERMRRERERQNYLALHSILP-PGTKNDKNSIVKTTANMIHELQCCKQELE 137
            E+   H   E+  R       + L  ++     K +K+++++   + I  LQ   Q+L+
Sbjct: 4   GEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLK 63

Query: 138 RKNYELESNL 147
           ++N  L + +
Sbjct: 64  QENLSLRTAV 73
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.69
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.6
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.58
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.58
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.57
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.54
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.5
4ati_A118 MITF, microphthalmia-associated transcription fact 99.5
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.49
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.44
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.38
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.07
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.06
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.0
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.85
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.61
4ath_A83 MITF, microphthalmia-associated transcription fact 98.17
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.96
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.56
1u8s_A 192 Glycine cleavage system transcriptional repressor, 96.16
2nyi_A195 Unknown protein; protein structure initiative, PSI 96.0
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 95.91
1u8s_A192 Glycine cleavage system transcriptional repressor, 95.71
2nyi_A 195 Unknown protein; protein structure initiative, PSI 95.36
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 94.65
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 94.65
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 94.13
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 93.65
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 93.48
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 91.78
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 91.25
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 84.63
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 81.55
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.69  E-value=2.1e-17  Score=123.40  Aligned_cols=67  Identities=21%  Similarity=0.324  Sum_probs=62.1

Q ss_pred             cccccchHHHHHHHHHHHHhHHHHHhCCCCC-CCCchhhhHHHHHHHHHHHHHHHHHHHhhHHHHhhh
Q 026746           80 ERGHRHVINERMRRERERQNYLALHSILPPG-TKNDKNSIVKTTANMIHELQCCKQELERKNYELESN  146 (234)
Q Consensus        80 ~~~~~H~~sER~RRekln~~f~~LrslvP~~-~K~DKaSIL~~aI~yIk~Le~~v~~Le~~~~~le~~  146 (234)
                      ....+|.++||+||++||++|..|+++||+. .|+||++||.+||+||++|+.+++.|+.+++.++..
T Consensus         5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~   72 (82)
T 1am9_A            5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA   72 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4677899999999999999999999999997 899999999999999999999999999988776653
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 234
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 7e-07
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 7e-06
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 7e-05
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 1e-04
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 1e-04
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 1e-04
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 3e-04
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 8e-04
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Max protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.7 bits (103), Expect = 7e-07
 Identities = 12/68 (17%), Positives = 28/68 (41%), Gaps = 2/68 (2%)

Query: 80  ERGHRHVINERMRRERERQNYLALHSILP--PGTKNDKNSIVKTTANMIHELQCCKQELE 137
           ++   H   ER RR+  + ++ +L   +P   G K  +  I+      I  ++      +
Sbjct: 1   DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQ 60

Query: 138 RKNYELES 145
           +   +L+ 
Sbjct: 61  QDIDDLKR 68
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.53
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.5
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.47
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.42
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.64
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 96.95
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 96.88
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 94.45
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 89.17
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 84.84
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 84.34
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.59  E-value=8.2e-16  Score=112.26  Aligned_cols=66  Identities=21%  Similarity=0.330  Sum_probs=60.2

Q ss_pred             cccccchHHHHHHHHHHHHhHHHHHhCCCCC-CCCchhhhHHHHHHHHHHHHHHHHHHHhhHHHHhh
Q 026746           80 ERGHRHVINERMRRERERQNYLALHSILPPG-TKNDKNSIVKTTANMIHELQCCKQELERKNYELES  145 (234)
Q Consensus        80 ~~~~~H~~sER~RRekln~~f~~LrslvP~~-~K~DKaSIL~~aI~yIk~Le~~v~~Le~~~~~le~  145 (234)
                      +....|..+||+||++||+.|..|++|||+. .|+||++||..||+||+.|+.+++.|..++..++.
T Consensus         5 ~kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk~   71 (80)
T d1am9a_           5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRT   71 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4567899999999999999999999999985 69999999999999999999999999987766554
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure