Citrus Sinensis ID: 026815

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MRIPNPRRGSFSNTQQNPDNPFNVQNLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQHSSSQFELNKNNHEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDFNVWKDL
cccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEccccccccccccccccccHHHHHHHHHccccccEEEEEEEEEEEccccccccccccccccEEEEEccEEEEEEEEcccccccEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEEEEEccccccccccccEEccccc
cccccccEEEEcccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEcccccccHHHHccccccHcHHHHHHHcccccccEEEEEEEEEEEccccccccccccccccEEEEEEccEEEEEEccccccccEEEEEEccccEEEEEcccccEEEEEEccccccEEEEEEcccccccccccccccEHccc
mripnprrgsfsntqqnpdnpfnvqnLSTVSILLNFlkrpqafpFLLSIFVLLTWLSLRlqhsssqfelnknnhekwsstkdddvkanlvrfksdhlpslilkdrrgwllNPISLAIDAGVKGGAVSCVSLhvgeiqpgalrgnhrhytlnETFVIWGAKTkfrlennqiddkgyAEVIVGADEVaiaaspqgtaHALVNADLIHSTFfigcqdgvinnnastsdfnvwkdl
mripnprrgsfsntqqnpdnpfnVQNLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQHSSSQfelnknnhekwsstkdddVKANLVrfksdhlpslilkdrrGWLLNPISLAIDAGVKGGAVSCVSLHVGEIqpgalrgnhrhYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVInnnastsdfnvwkdl
MRIPNPRRGSFSNTQQNPDNPFNVQNLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQHSSSQFELNKNNHEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDFNVWKDL
***********************VQNLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQ*************************ANLVRFKSDHLPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDFNV****
*******************************ILLNFLKRPQAFPFLLSIFVLLTWLSL***************************KANLVRFKSDHLPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDFNVWKDL
************NTQQNPDNPFNVQNLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQHSSSQFELNKNNHEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDFNVWKDL
***PNPRRGSF**T***********NLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQ******************TKDDDVKANLVRFKSDHLPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDFNVWKDL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIPNPRRGSFSNTQQNPDNPFNVQNLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQHSSSQFELNKNNHEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDFNVWKDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
255572893232 conserved hypothetical protein [Ricinus 0.978 0.978 0.663 2e-84
449453111241 PREDICTED: uncharacterized protein LOC10 0.982 0.946 0.617 6e-79
224086691222 predicted protein [Populus trichocarpa] 0.956 1.0 0.639 4e-78
242054729229 hypothetical protein SORBIDRAFT_03g03762 0.952 0.965 0.568 8e-66
449453113240 PREDICTED: uncharacterized protein LOC10 0.853 0.825 0.610 1e-65
226531267227 LOC100286137 [Zea mays] gi|195656861|gb| 0.952 0.973 0.556 8e-65
297741719219 unnamed protein product [Vitis vinifera] 0.935 0.990 0.609 4e-64
225440220220 PREDICTED: uncharacterized protein LOC10 0.935 0.986 0.609 4e-64
297820456218 hypothetical protein ARALYDRAFT_486120 [ 0.913 0.972 0.576 4e-63
124359547229 Cupin, RmlC-type [Medicago truncatula] g 0.827 0.838 0.584 8e-63
>gi|255572893|ref|XP_002527378.1| conserved hypothetical protein [Ricinus communis] gi|223533249|gb|EEF35003.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 187/235 (79%), Gaps = 8/235 (3%)

Query: 3   IPNPRRGSFSNTQQNPDNPFNVQNLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQH 62
           + NPRR S+SN+ +NP   F VQNLS +S L +FLK+P AFPFLLSIF+ LTWLSL+LQH
Sbjct: 1   MANPRRSSYSNSSENP---FQVQNLSRLSSLKHFLKKPHAFPFLLSIFLFLTWLSLKLQH 57

Query: 63  SSSQFELNKNN-----HEKWSSTKDDDVKANLVRFKSDHLPSLILKDRRGWLLNPISLAI 117
            ++    + ++     H++  STK DD  ANL+RFKSD   S I+KD+RGWLL+P+SLA+
Sbjct: 58  RNASNFASSSSSSFNLHQQTKSTKVDDKNANLIRFKSDFFASPIIKDKRGWLLDPVSLAL 117

Query: 118 DAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAE 177
           D+G+ GGAVSC SLHVGEI+PG +RGNHRHYT NETFVIWGAKT FRLEN QI DKGYAE
Sbjct: 118 DSGITGGAVSCASLHVGEIRPGTVRGNHRHYTCNETFVIWGAKTLFRLENGQIVDKGYAE 177

Query: 178 VIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDFNVWKDL 232
           V++GADEVAIAASP GTAH LVN D I STFFIGCQD ++N N ST+DFNVWKD 
Sbjct: 178 VVIGADEVAIAASPSGTAHLLVNLDPILSTFFIGCQDNLMNYNDSTTDFNVWKDF 232

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449453111|ref|XP_004144302.1| PREDICTED: uncharacterized protein LOC101212156 isoform 1 [Cucumis sativus] gi|449525636|ref|XP_004169822.1| PREDICTED: uncharacterized protein LOC101231634 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224086691|ref|XP_002307933.1| predicted protein [Populus trichocarpa] gi|222853909|gb|EEE91456.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|242054729|ref|XP_002456510.1| hypothetical protein SORBIDRAFT_03g037620 [Sorghum bicolor] gi|241928485|gb|EES01630.1| hypothetical protein SORBIDRAFT_03g037620 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|449453113|ref|XP_004144303.1| PREDICTED: uncharacterized protein LOC101212156 isoform 2 [Cucumis sativus] gi|449525638|ref|XP_004169823.1| PREDICTED: uncharacterized protein LOC101231634 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|226531267|ref|NP_001152497.1| LOC100286137 [Zea mays] gi|195656861|gb|ACG47898.1| cupin, RmlC-type [Zea mays] gi|414880051|tpg|DAA57182.1| TPA: cupin, RmlC-type [Zea mays] Back     alignment and taxonomy information
>gi|297741719|emb|CBI32851.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225440220|ref|XP_002283750.1| PREDICTED: uncharacterized protein LOC100249949 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297820456|ref|XP_002878111.1| hypothetical protein ARALYDRAFT_486120 [Arabidopsis lyrata subsp. lyrata] gi|297323949|gb|EFH54370.1| hypothetical protein ARALYDRAFT_486120 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|124359547|gb|ABN05965.1| Cupin, RmlC-type [Medicago truncatula] gi|388520779|gb|AFK48451.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2103630220 AT3G56820 "AT3G56820" [Arabido 0.883 0.931 0.615 1.1e-64
TAIR|locus:2103630 AT3G56820 "AT3G56820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 659 (237.0 bits), Expect = 1.1e-64, P = 1.1e-64
 Identities = 133/216 (61%), Positives = 162/216 (75%)

Query:    24 VQNLSTVSILLNFLKRPQAFPFLLSIFVLLTWLSLRLQHSSSQFELNKNNHEKWSSTK-- 81
             ++N   +S L+N LK+PQA P LLS+F+LLTW+SLRLQHSS     + ++H K +     
Sbjct:     9 IEN-QRLSPLINLLKKPQAIPLLLSLFLLLTWISLRLQHSSQSHVSSSSSHPKSTVNSHP 67

Query:    82 -----DDDVKANLVRFKSDHLPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEI 136
                  DDD KANLVRF    L S   KD RGWLL+P+ LA D+ +KGGA SCVS+HVGEI
Sbjct:    68 DLKVYDDDDKANLVRFGLASL-SPARKDDRGWLLDPVILARDSELKGGAASCVSIHVGEI 126

Query:   137 QPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAH 196
             +PG LRGNHRH+T NETFVIWGAKTKFRLEN+++D KGYAEV++G DEVA+A S  GTAH
Sbjct:   127 RPGGLRGNHRHHTCNETFVIWGAKTKFRLENHEVD-KGYAEVLIGEDEVAVAVSQSGTAH 185

Query:   197 ALVNADLIHSTFFIGCQDGVINNNASTSDFNVWKDL 232
             ALVN D + STFFIGCQD +  NN+STSD+ VW DL
Sbjct:   186 ALVNVDPVRSTFFIGCQDHM-QNNSSTSDYKVWNDL 220


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.135   0.408    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      232       232   0.00085  113 3  11 22  0.41    33
                                                     32  0.42    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  613 (65 KB)
  Total size of DFA:  202 KB (2113 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  20.30u 0.08s 20.38t   Elapsed:  00:00:01
  Total cpu time:  20.30u 0.08s 20.38t   Elapsed:  00:00:01
  Start:  Sat May 11 06:38:22 2013   End:  Sat May 11 06:38:23 2013
GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 99.67
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 99.53
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 98.91
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 98.89
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 98.87
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 98.35
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 98.19
PRK04190191 glucose-6-phosphate isomerase; Provisional 97.97
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 97.96
smart00835146 Cupin_1 Cupin. This family represents the conserve 97.89
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 97.18
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 97.09
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 97.09
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 97.01
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 96.9
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 96.77
COG3837161 Uncharacterized conserved protein, contains double 96.75
PRK13290125 ectC L-ectoine synthase; Reviewed 96.4
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 96.3
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 96.02
COG1917131 Uncharacterized conserved protein, contains double 95.69
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 94.82
PRK11171 266 hypothetical protein; Provisional 94.09
PLN00212493 glutelin; Provisional 92.87
PRK11171266 hypothetical protein; Provisional 92.79
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 92.06
PLN00212 493 glutelin; Provisional 87.41
PF0931382 DUF1971: Domain of unknown function (DUF1971); Int 86.69
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 84.57
PRK12335 287 tellurite resistance protein TehB; Provisional 84.44
PRK13502 282 transcriptional activator RhaR; Provisional 83.15
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 80.92
TIGR03214 260 ura-cupin putative allantoin catabolism protein. T 80.59
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=99.67  E-value=3.4e-16  Score=132.67  Aligned_cols=115  Identities=16%  Similarity=0.150  Sum_probs=93.7

Q ss_pred             cccceeccCCccchhhhhhhhhhccCCCceeeeeEEEeeecCCccccccccccc-ceEEEEEecceeEEEeecCCCCc--
Q 026815           97 LPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTL-NETFVIWGAKTKFRLENNQIDDK--  173 (232)
Q Consensus        97 ypl~m~~D~RGsftE~ikt~~~agl~gGa~~cgQvsVn~~kPGitRGNHwHhTK-nEkFiVv~G~g~iRlR~i~~~de--  173 (232)
                      ++++++.|+||+|+|.++.....-.. =.+..+|.+++.++||++||.|||+.+ .+.+.+++|+..+.+.++- .++  
T Consensus        14 ~~~~~~~D~RG~F~E~~~~~~~~~~~-~~~~~~Q~n~S~S~~GvlRGlHyq~~~q~klv~~v~G~v~dv~vDlR-~~SpT   91 (173)
T COG1898          14 IEPKVFGDERGFFTETFKAEEFSTLG-LPLDFVQDNHSFSYPGVLRGLHYQHKPQGKLVRVVSGKVFDVAVDLR-KDSPT   91 (173)
T ss_pred             ECCcccccccceeeehhhhhhhhhcc-CccccccceEEEecCCeeEEEEcccCCCCeEEEEecCeEEEEEEEcc-CCCCC
Confidence            57899999999999999944222111 112788999999999999999999999 9999999999999999998 333  


Q ss_pred             --ceEEEEEcCceEEEEecCCCceeeeeecCccceeeeecccc
Q 026815          174 --GYAEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQD  214 (232)
Q Consensus       174 --g~~Ey~Vsgdev~Vv~~P~GyTHnIiNlg~~~~~~f~gCqD  214 (232)
                        -+..++++++..+.+.+|+|+||.+.|++..- ++..=|.|
T Consensus        92 yg~~~~~~ls~~N~~~l~IP~G~AHGf~~L~d~~-~~~y~~~~  133 (173)
T COG1898          92 YGKWVGVVLSAENKRQLYIPPGFAHGFQVLSDDA-EVVYKVTE  133 (173)
T ss_pred             cceEEEEEecCCCceEEEeCCcccceeEEccCce-EEEEEecc
Confidence              27788889998999999999999999999554 44444443

>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2zkl_A369 Crystal Structure Of Capsular Polysaccharide Assemb 6e-04
3st7_A369 Crystal Structure Of Capsular Polysaccharide Assemb 7e-04
>pdb|2ZKL|A Chain A, Crystal Structure Of Capsular Polysaccharide Assembling Protein Capf From Staphylococcus Aureus Length = 369 Back     alignment and structure 
Iteration: 1

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
Query: 137 QPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVAIAASPQGTAH 196
           +PG  +GNH H+T NE F++   K   R     ++D    E  V  D++ +   P G  H
Sbjct: 280 KPGITKGNHWHHTKNEKFLVVSGKGVIRFR--HVNDDEIIEYYVSGDKLEVVDIPVGYTH 337
Query: 197 ALVN 200
            + N
Sbjct: 338 NIEN 341
>pdb|3ST7|A Chain A, Crystal Structure Of Capsular Polysaccharide Assembling Protein Capf From Staphylococcus Aureus Length = 369 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 1e-04
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 2e-04
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
 Score = 41.4 bits (97), Expect = 1e-04
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 127 SCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYAEVIVGADEVA 186
               + V   +PG  +GNH H+T NE F++   K   R  +  ++D    E  V  D++ 
Sbjct: 270 DRGQVSVNISKPGITKGNHWHHTKNEKFLVVSGKGVIRFRH--VNDDEIIEYYVSGDKLE 327

Query: 187 IAASPQGTAHALVN 200
           +   P G  H + N
Sbjct: 328 VVDIPVGYTHNIEN 341
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.87
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural geno 99.6
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 99.51
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 99.44
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesi 99.42
1dzr_A183 DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 99.42
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 99.41
3ryk_A205 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 99.39
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 99.39
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic 99.35
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 99.17
4hn1_A201 Putative 3-epimerase in D-allose pathway; 3'-monoe 98.85
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 98.66
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 98.16
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 97.85
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 97.76
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 97.72
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 97.72
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 97.69
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 97.66
3h8u_A125 Uncharacterized conserved protein with double-STR 97.65
1v70_A105 Probable antibiotics synthesis protein; structural 97.6
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 97.58
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 97.58
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 97.55
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 97.53
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 97.53
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 97.51
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 97.46
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 97.44
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 97.4
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 97.36
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 97.36
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 97.33
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 97.32
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 97.31
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 97.3
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 97.25
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 97.19
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 97.19
1uij_A416 Beta subunit of beta conglycinin; double-stranded 97.19
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 97.15
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 97.13
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 97.12
4i4a_A128 Similar to unknown protein; structural genomics, P 97.08
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 97.07
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 97.06
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 97.06
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 97.04
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 96.99
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 96.95
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 96.94
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 96.87
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 96.87
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 96.86
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 96.86
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 96.81
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 96.8
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 96.79
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 96.78
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 96.75
4axo_A151 EUTQ, ethanolamine utilization protein; structural 96.65
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 96.65
2q30_A110 Uncharacterized protein; double-stranded beta-heli 96.63
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 96.63
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 96.62
1vj2_A126 Novel manganese-containing cupin TM1459; structura 96.6
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 96.6
3d82_A102 Cupin 2, conserved barrel domain protein; structur 96.56
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 96.56
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 96.49
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 96.47
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 96.44
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 96.39
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 96.36
3lwc_A119 Uncharacterized protein; structural genomics, unkn 96.35
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 96.33
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 96.31
1sef_A274 Conserved hypothetical protein; structural genomic 96.27
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 95.99
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 95.98
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 95.96
1rc6_A 261 Hypothetical protein YLBA; structural genomics, NY 95.92
3bcw_A123 Uncharacterized protein; structural genomics, join 95.86
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 95.85
1sfn_A246 Conserved hypothetical protein; structural genomic 95.83
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 95.82
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 95.81
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 95.79
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 95.78
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 95.71
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 95.69
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 95.62
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 95.46
1sef_A 274 Conserved hypothetical protein; structural genomic 95.4
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 95.36
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 95.24
1sq4_A 278 GLXB, glyoxylate-induced protein; structural genom 95.18
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 95.15
3h7j_A 243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 95.1
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 94.9
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 94.79
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 94.65
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 94.61
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 94.57
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 94.38
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 94.37
3rns_A227 Cupin 2 conserved barrel domain protein; structura 93.73
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 93.65
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 93.19
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 92.04
3rns_A227 Cupin 2 conserved barrel domain protein; structura 91.78
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 91.23
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 89.74
1sfn_A 246 Conserved hypothetical protein; structural genomic 89.18
3bb6_A127 Uncharacterized protein YEAR; structural genomics, 89.13
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 89.0
4e2q_A 266 Ureidoglycine aminohydrolase; BI-cupin, manganese 88.29
3kmh_A246 D-lyxose isomerase; cupin beta-barrel, structural 88.12
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 87.85
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 85.89
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 84.72
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 83.33
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
Probab=99.87  E-value=2.8e-22  Score=169.11  Aligned_cols=117  Identities=26%  Similarity=0.368  Sum_probs=103.5

Q ss_pred             cccceeccCCccchhhhhhhhhhccCCCceeeeeEEEeeecCCcccccccccccceEEEEEecceeEEEeecCCCCcceE
Q 026815           97 LPSLILKDRRGWLLNPISLAIDAGVKGGAVSCVSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGYA  176 (232)
Q Consensus        97 ypl~m~~D~RGsftE~ikt~~~agl~gGa~~cgQvsVn~~kPGitRGNHwHhTKnEkFiVv~G~g~iRlR~i~~~deg~~  176 (232)
                      +++++..|+||+|.|+++..          .|||+++.+++||++||.|||+.+.|.|+|++|+++|+||+.. ..+ +.
T Consensus       250 ~~l~~~~D~rg~f~e~~~~~----------~~~q~~ls~~~~g~~rg~h~h~~~~e~~~~~~G~~~~~~~~~~-~~~-~~  317 (369)
T 3st7_A          250 YPLLMNVDDRGSFTEFIKTP----------DRGQVSVNISKPGITKGNHWHHTKNEKFLVVSGKGVIRFRHVN-DDE-II  317 (369)
T ss_dssp             CCCCEEEETTEEEEEEEECS----------SSCEEEEEEECTTCEEEEEECSSCCEEEEEEESEEEEEEEETT-CCC-CE
T ss_pred             echhhccCCCcceeEEEecC----------CCceEEEEEecCCceeccccccCcceEEEEEeeeEEEEEEcCC-CCc-EE
Confidence            57899999999999999998          5779999999999999999999999999999999999999877 455 99


Q ss_pred             EEEEcCceEEEEecCCCceeeeeecCccceeeeecccccccCCCCCCCcc
Q 026815          177 EVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINNNASTSDF  226 (232)
Q Consensus       177 Ey~Vsgdev~Vv~~P~GyTHnIiNlg~~~~~~f~gCqD~~~n~n~s~tD~  226 (232)
                      +++++||+.+++.||+|++|.|.|+|.. .+.|+-+.+..-|+.+++|=|
T Consensus       318 ~~~~~~~~~~~~~ip~g~~h~~~n~~~~-~~~~~~~~~~~y~~~~~d~~~  366 (369)
T 3st7_A          318 EYYVSGDKLEVVDIPVGYTHNIENLGDT-DMVTIMWVNEMFDPNQPDTYF  366 (369)
T ss_dssp             EEEEETTBCCEEEECTTEEEEEEECSSS-CEEEEEEESSCCCSSSCCCEE
T ss_pred             EEEecCCcceEEEeCCCceEEeEEcCCC-cEEEEEecCcccCCCCCcccc
Confidence            9999999999999999999999999944 556666666677777777643
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 99.3
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 99.05
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 98.96
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 98.92
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 98.89
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 98.8
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 98.79
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 98.75
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 98.69
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 98.54
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 98.22
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 98.15
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 98.1
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 98.1
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 98.08
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 97.88
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 97.87
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 97.86
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 97.86
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 97.79
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 97.76
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 97.72
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 97.69
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 97.6
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 97.45
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 97.34
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 97.26
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 97.25
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 97.23
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 97.22
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 97.2
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 97.17
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 97.16
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 97.15
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 97.14
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 97.13
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 97.05
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 97.04
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 96.94
d1rc6a_ 253 Hypothetical protein YlbA {Escherichia coli [TaxId 96.86
d1sefa_ 250 Hypothetical protein EF2996 {Enterococcus faecalis 96.48
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 96.42
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 96.39
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 96.35
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 96.34
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 96.33
d1sq4a_ 273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 94.97
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 94.25
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 93.18
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 92.2
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 92.0
d1sfna_ 245 Hypothetical protein DR1152 {Deinococcus radiodura 89.83
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 87.59
d3dl3a196 Tellurite resistance protein B, TehB {Vibrio fisch 84.95
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 81.8
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: dTDP-sugar isomerase
domain: dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA
species: Aneurinibacillus thermoaerophilus [TaxId: 143495]

Probab=99.30  E-value=8.9e-13  Score=101.42  Aligned_cols=110  Identities=13%  Similarity=0.077  Sum_probs=80.3

Q ss_pred             cccceeccCCccchhhhhhhhhhccCCCceee-eeEEEeeecCCcccccccccccceEEEEEecceeEEEeecCCCCcce
Q 026815           97 LPSLILKDRRGWLLNPISLAIDAGVKGGAVSC-VSLHVGEIQPGALRGNHRHYTLNETFVIWGAKTKFRLENNQIDDKGY  175 (232)
Q Consensus        97 ypl~m~~D~RGsftE~ikt~~~agl~gGa~~c-gQvsVn~~kPGitRGNHwHhTKnEkFiVv~G~g~iRlR~i~~~deg~  175 (232)
                      ..++...|+||+|+++...-.   +.-   .. +..-+..+++|.+||.|+|+.+.+-|+|++|+..+.+-+..   + .
T Consensus         5 i~~~~~~D~RG~l~~i~~~~~---~~f---~~kr~~~~~~~~~g~iRG~H~Hk~~~q~~~vi~G~i~~~~~d~~---~-~   74 (135)
T d2pa7a1           5 INFKKIIDSRGSLVAIEENKN---IPF---SIKRVYYIFDTKGEEPRGFHAHKKLEQVLVCLNGSCRVILDDGN---I-I   74 (135)
T ss_dssp             EECCEEEETTEEEEEEETTTT---SSS---CCCEEEEEESCCSSCCEEEEEESSCCEEEEEEESCEEEEEECSS---C-E
T ss_pred             ecCCceECCCCCEEEEEcccc---ccc---ccceEEEEecCCCCcEEeeeccccccEEEEecccEEEEEEEecc---c-c
Confidence            457788999999998777542   111   11 23446778999999999999999999999999888886543   2 4


Q ss_pred             EEEEEcCceEEEEecCCCceeeeeecCccceeeeecccccccCC
Q 026815          176 AEVIVGADEVAIAASPQGTAHALVNADLIHSTFFIGCQDGVINN  219 (232)
Q Consensus       176 ~Ey~Vsgdev~Vv~~P~GyTHnIiNlg~~~~~~f~gCqD~~~n~  219 (232)
                      .++..+. +-..+-+|||++|.+.+++.- +++. -|.|..-|+
T Consensus        75 ~~~~l~~-~~~~l~IPpg~~h~~~~l~~~-s~ll-~l~~~~y~~  115 (135)
T d2pa7a1          75 QEITLDS-PAVGLYVGPAVWHEMHDFSSD-CVMM-VLASDYYDE  115 (135)
T ss_dssp             EEEEECC-TTEEEEECTTCEEEEECCCTT-CEEE-EEESSCCCG
T ss_pred             ceeeccc-CCceeeeCCCEeeeEEecCCC-cEEE-EEcCCCCCh
Confidence            5565554 456779999999999999843 4433 356665544
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure