Citrus Sinensis ID: 026833


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MSSEAEATDVSSLFERLLSHRDMSLFLPFVLGFTSSVSTGESSENSQNPDGETPHTNRSSSERIILVNPLNQGMVVIEGTSSLETLLRNFAGKDGQPPASKASVEAMPSIKVGESEEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKMPVEEEESGNKRDERRREIWVSFSISGGGRRSGENSNQNESTSPSRDSTDVSDSSSPSSRPDQEN
cccccccccHHHHHHHHHccccccccHHHHHHcccccccccccccccccccccccccccccccEEEEcccccHHHHHHccHHHHHHHHHHccccccccccHHHHHHcccEEEcccccccccccccccccccccccccEEccccccccHHHHHHHHcccccccccccccccccccccccHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccccccccccccHHHHHHHHHHcccccccccccHHHHHcccEEEEEHHHcccccccccEcHHHcccccEEEEcccccccccHcHHHHHHHccccccEccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccc
msseaeatDVSSLFERLLShrdmslflpFVLGftssvstgessensqnpdgetphtnrssseriilvnplnqgmvVIEGTSSLETLLRNfagkdgqppaskasveampsikvgeseeealggecvvcleeyevgevarempckhkfhANCIEKWlgingscpvcrykmpveeeesgnkrderRREIWVSFsisgggrrsgensnqnestspsrdstdvsdssspssrpdqen
msseaeatDVSSLFERLLSHRDMSLFLPFVLGFTSSVSTgessensqnpdgetphtnrssseRIILVNPLNQGMVVIEGTSSLETLLRNFAGKDGQPPASKASVEAMPSIKVGESEEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKMpveeeesgnkrderrreIWVSfsisgggrrsgensnqnestspsrdstdvsdssspssrpdqen
MSSEAEATDVSSLFERLLSHRDMSLFLPFVLGFtssvstgessensQNPDGETPHTNRSSSERIILVNPLNQGMVVIEGTSSLETLLRNFAGKDGQPPASKASVEAMPSIKVGESEEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKMPVEEEESGNKRDERRREIWVsfsisgggrrsgENSNQNEstspsrdstdvsdssspssrpdQEN
************LFERLLSHRDMSLFLPFVLGFT*****************************IILVNPLNQGMVVIEGTSSLETLLR*******************************LGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKM*****************IWVS*******************************************
***********SLFERLLSHRDMSLFLPFVLGFTS**********************RSSSERIILVNPLNQGMVVIEGTSSLE******************SVEAMPSIKVGESEEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRY******************************************************************
***********SLFERLLSHRDMSLFLPFVLGFTSS************************SERIILVNPLNQGMVVIEGTSSLETLLRNFAGK*************MPSIKVGESEEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKMP************RRREIWVSFSIS***************************************
*********VSSLFERLLSHRDMSLFLPFVLGFTSSVSTGESS***************SSSERIILVNPLNQGMVVIEGTSSLETLLRNFAGKDGQPPASKASVEAMPSIKVGESEEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKM****************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSEAEATDVSSLFERLLSHRDMSLFLPFVLGFTSSVSTGESSENSQNPDGETPHTNRSSSERIILVNPLNQGMVVIEGTSSLETLLRNFAGKDGQPPASKASVEAMPSIKVGESEEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKMPVEEEESGNKRDERRREIWVSFSISGGGRRSGENSNQNESTSPSRDSTDVSDSSSPSSRPDQEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
Q8LPN7328 E3 ubiquitin-protein liga no no 0.413 0.292 0.39 1e-20
P0CH30338 E3 ubiquitin-protein liga N/A no 0.616 0.423 0.329 6e-20
Q7ZW78156 E3 ubiquitin-protein liga yes no 0.491 0.730 0.385 3e-16
Q6GPV5156 E3 ubiquitin-protein liga N/A no 0.375 0.557 0.420 6e-16
Q6IRP0312 RING finger protein 126-B N/A no 0.443 0.330 0.380 1e-15
Q5M974156 E3 ubiquitin-protein liga no no 0.318 0.474 0.453 2e-15
Q7T0Q3312 RING finger protein 126-A N/A no 0.443 0.330 0.380 2e-15
Q91YL2313 RING finger protein 126 O yes no 0.443 0.329 0.390 2e-15
Q9CY62165 E3 ubiquitin-protein liga no no 0.370 0.521 0.411 4e-15
Q6DIP3311 RING finger protein 126 O no no 0.443 0.331 0.380 4e-15
>sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=2 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 68/100 (68%), Gaps = 4/100 (4%)

Query: 83  LETLLRNFAGKD----GQPPASKASVEAMPSIKVGESEEEALGGECVVCLEEYEVGEVAR 138
           LE L++  A  D    G PPASK++++A+P++KV +   ++   +C VC++E+E G   +
Sbjct: 171 LEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVK 230

Query: 139 EMPCKHKFHANCIEKWLGINGSCPVCRYKMPVEEEESGNK 178
           +MPCKH FH +C+  WL ++ SCPVCR+++P ++ +  N+
Sbjct: 231 QMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDDPDYENR 270




E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Promotes polyubiquitination of target proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 Back     alignment and function description
>sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 Back     alignment and function description
>sp|Q6IRP0|R126B_XENLA RING finger protein 126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 Back     alignment and function description
>sp|Q5M974|RN181_XENTR E3 ubiquitin-protein ligase RNF181 OS=Xenopus tropicalis GN=rnf181 PE=2 SV=1 Back     alignment and function description
>sp|Q7T0Q3|R126A_XENLA RING finger protein 126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 Back     alignment and function description
>sp|Q91YL2|RN126_MOUSE RING finger protein 126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 Back     alignment and function description
>sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=2 SV=1 Back     alignment and function description
>sp|Q6DIP3|RN126_XENTR RING finger protein 126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
224112257218 predicted protein [Populus trichocarpa] 0.866 0.922 0.582 1e-64
118489087225 unknown [Populus trichocarpa x Populus d 0.836 0.862 0.574 7e-61
224098884225 predicted protein [Populus trichocarpa] 0.836 0.862 0.574 8e-61
118486636212 unknown [Populus trichocarpa] 0.784 0.858 0.582 8e-59
356497902229 PREDICTED: E3 ubiquitin-protein ligase R 0.862 0.873 0.540 2e-56
255562884233 zinc finger protein, putative [Ricinus c 0.943 0.939 0.524 6e-56
356499821231 PREDICTED: E3 ubiquitin-protein ligase R 0.840 0.844 0.561 1e-55
357487057222 RING finger protein [Medicago truncatula 0.870 0.909 0.484 6e-55
255626575187 unknown [Glycine max] 0.711 0.882 0.614 8e-54
225425662233 PREDICTED: E3 ubiquitin-protein ligase R 0.862 0.858 0.510 8e-54
>gi|224112257|ref|XP_002316133.1| predicted protein [Populus trichocarpa] gi|118483434|gb|ABK93617.1| unknown [Populus trichocarpa] gi|222865173|gb|EEF02304.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 166/225 (73%), Gaps = 24/225 (10%)

Query: 1   MSSEAE-ATDVSSLFERLLSHRDMSLFLPFVLGFTSSVSTGESSENSQNPDGETPHTNRS 59
           M+SE E   + SS+FERLL HRD+SLFLPF+LGFTS+ +T       ++PD E P T   
Sbjct: 1   MASETEFPAEFSSMFERLLRHRDLSLFLPFILGFTSTNTT-----EQRDPDQEAPQTT-D 54

Query: 60  SSERIILVNPLNQGMVVIEGTSSLETLLRNFAGKDGQPPASKASVEAMPSIKVGESEEEA 119
            +ERIIL+NP  QGMVVIEG +SLE+LLR+   K GQPPASKAS+EAMP +++GE  ++ 
Sbjct: 55  PNERIILINPFTQGMVVIEGAASLESLLRDIGNKKGQPPASKASIEAMPKVEIGEDNKD- 113

Query: 120 LGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKMPVEEEESGNKR 179
             GEC +CLEE+E+G V +EMPCKH+FH  C+EKWL I+G+CPVCRYKMPV+EEE G KR
Sbjct: 114 --GECAICLEEWELGGVVKEMPCKHRFHGGCVEKWLKIHGNCPVCRYKMPVDEEELGKKR 171

Query: 180 D------ERR--REIWVSFSISGGGRRSGENSNQNESTSPSRDST 216
           D      ERR  REIWVSF+ + G RR+G +SN+N    PS DS+
Sbjct: 172 DEGDGGRERRVEREIWVSFAFN-GSRRNG-DSNEN----PSNDSS 210




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118489087|gb|ABK96350.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224098884|ref|XP_002311305.1| predicted protein [Populus trichocarpa] gi|222851125|gb|EEE88672.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118486636|gb|ABK95155.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356497902|ref|XP_003517795.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max] Back     alignment and taxonomy information
>gi|255562884|ref|XP_002522447.1| zinc finger protein, putative [Ricinus communis] gi|223538332|gb|EEF39939.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356499821|ref|XP_003518735.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max] Back     alignment and taxonomy information
>gi|357487057|ref|XP_003613816.1| RING finger protein [Medicago truncatula] gi|355515151|gb|AES96774.1| RING finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255626575|gb|ACU13632.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225425662|ref|XP_002273461.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2200610204 AT1G26800 [Arabidopsis thalian 0.737 0.838 0.492 2.2e-43
TAIR|locus:2035843179 AT1G14200 [Arabidopsis thalian 0.724 0.938 0.382 2.7e-29
TAIR|locus:2092895315 AT3G13430 [Arabidopsis thalian 0.413 0.304 0.433 2.6e-23
TAIR|locus:2148318407 RDUF2 "RING and Domain of Unkn 0.439 0.250 0.407 1.4e-21
TAIR|locus:2161058396 ATCRT1 [Arabidopsis thaliana ( 0.521 0.305 0.391 3.1e-21
TAIR|locus:2075175395 RDUF1 "RING and Domain of Unkn 0.474 0.278 0.389 3.3e-20
TAIR|locus:2092231328 AT3G19950 [Arabidopsis thalian 0.413 0.292 0.39 5.7e-20
TAIR|locus:2195573327 AT1G60360 [Arabidopsis thalian 0.474 0.336 0.404 7.2e-20
TAIR|locus:2131463356 AT4G26400 [Arabidopsis thalian 0.517 0.337 0.381 7.8e-20
TAIR|locus:2193874351 AT1G55530 [Arabidopsis thalian 0.375 0.247 0.440 1.6e-19
TAIR|locus:2200610 AT1G26800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 458 (166.3 bits), Expect = 2.2e-43, P = 2.2e-43
 Identities = 95/193 (49%), Positives = 131/193 (67%)

Query:     1 MSSEAEA---TDVSSLFERLLSHRDMSLFLPFVLGFXXXXXXXXXXXXXQNPDGETPHTN 57
             M++E EA   T+ SS+  R L +RD+ LFLPF+LGF             ++ +G+     
Sbjct:     1 MATEQEAEVGTETSSVSGRFLRNRDLYLFLPFLLGFSDQ----------ESSNGDDDDV- 49

Query:    58 RSSSERIILVNPLNQGMVVIEGTSSLETLLRNF--AGKDGQPPASKASVEAMPSIKVGES 115
              SS ERIILVNP  QGM+V+EG+S +  LLR+   + ++G+PPASKAS++AMP +++   
Sbjct:    50 ASSRERIILVNPFTQGMIVLEGSSGMNPLLRSLLESREEGRPPASKASIDAMPIVEIDGC 109

Query:   116 EEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKMPVEEEES 175
             E     GECV+CLEE++  E  +EMPCKH+FH  CIEKWLG +GSCPVCRY+MPV+ +E 
Sbjct:   110 E-----GECVICLEEWKSEETVKEMPCKHRFHGGCIEKWLGFHGSCPVCRYEMPVDGDEI 164

Query:   176 GNKRDERRREIWV 188
             G KR++   EIWV
Sbjct:   165 GKKRNDGN-EIWV 176




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2035843 AT1G14200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092895 AT3G13430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148318 RDUF2 "RING and Domain of Unknown Function 1117 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161058 ATCRT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075175 RDUF1 "RING and Domain of Unknown Function 1117 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092231 AT3G19950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195573 AT1G60360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131463 AT4G26400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2193874 AT1G55530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-18
cd0016245 cd00162, RING, RING-finger (Really Interesting New 6e-13
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 4e-11
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 6e-11
smart0018440 smart00184, RING, Ring finger 3e-10
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 2e-09
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-08
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-06
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 3e-06
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 4e-06
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 9e-05
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.001
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 0.002
pfam1290647 pfam12906, RINGv, RING-variant domain 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 76.3 bits (188), Expect = 1e-18
 Identities = 21/44 (47%), Positives = 30/44 (68%)

Query: 122 GECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCR 165
            EC +CL+E+E GE    +PC H FH  C++KWL  + +CP+CR
Sbjct: 1   DECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.56
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.49
PHA02929238 N1R/p28-like protein; Provisional 99.3
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.21
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.17
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.17
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.99
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.94
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.93
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.92
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.91
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.85
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.84
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.77
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.77
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.77
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.77
PF1463444 zf-RING_5: zinc-RING finger domain 98.76
PHA02926242 zinc finger-like protein; Provisional 98.73
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.72
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.7
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.61
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.58
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.44
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.39
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.35
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.34
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.31
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.31
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.29
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.26
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.24
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.22
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.22
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.14
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.11
COG52191525 Uncharacterized conserved protein, contains RING Z 98.03
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.95
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.92
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.78
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.76
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.69
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.68
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.62
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.61
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.52
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.52
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.5
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.49
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.42
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.11
KOG1941518 consensus Acetylcholine receptor-associated protei 97.04
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 97.02
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.99
KOG2660 331 consensus Locus-specific chromosome binding protei 96.92
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.91
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.72
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.71
COG5152259 Uncharacterized conserved protein, contains RING a 96.59
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.5
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.45
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.4
KOG1940276 consensus Zn-finger protein [General function pred 96.36
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.33
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.23
PHA02862156 5L protein; Provisional 96.16
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.06
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.93
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.89
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.82
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.81
PHA02825162 LAP/PHD finger-like protein; Provisional 95.75
PF04641260 Rtf2: Rtf2 RING-finger 95.67
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.66
COG5222427 Uncharacterized conserved protein, contains RING Z 95.63
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 95.62
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 95.55
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 95.3
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.18
KOG4739 233 consensus Uncharacterized protein involved in syna 95.06
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.91
PHA03096284 p28-like protein; Provisional 94.9
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.88
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.7
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.67
PF10272358 Tmpp129: Putative transmembrane protein precursor; 94.5
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.34
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 94.3
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 93.85
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.68
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 92.63
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 92.38
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 92.1
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 91.7
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 91.39
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 91.14
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 91.1
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 90.92
KOG3002 299 consensus Zn finger protein [General function pred 90.88
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 90.09
KOG03091081 consensus Conserved WD40 repeat-containing protein 88.72
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 88.35
KOG3899381 consensus Uncharacterized conserved protein [Funct 88.2
KOG0298 1394 consensus DEAD box-containing helicase-like transc 88.16
KOG3053 293 consensus Uncharacterized conserved protein [Funct 87.85
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 86.99
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 86.21
KOG4367 699 consensus Predicted Zn-finger protein [Function un 84.48
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 84.41
KOG1609 323 consensus Protein involved in mRNA turnover and st 83.94
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 83.49
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 82.28
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 80.99
KOG4718235 consensus Non-SMC (structural maintenance of chrom 80.4
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.56  E-value=6.2e-15  Score=132.62  Aligned_cols=82  Identities=32%  Similarity=0.744  Sum_probs=69.1

Q ss_pred             CCCCCCHHHHHcCCceeccCchhhhcCCCCcccccccccCceeeeeCCCCcccHHHHHHHHhcCC-CCCCcCcccCCCcc
Q 026833           95 GQPPASKASVEAMPSIKVGESEEEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGING-SCPVCRYKMPVEEE  173 (232)
Q Consensus        95 g~~~as~~~i~~l~~~~~~~~~~~~~~~~C~IC~e~~~~~~~~~~lpC~H~fh~~Ci~~wl~~~~-tCP~CR~~~~~~~~  173 (232)
                      +...+.+..+..+|..++....+......|+||+|+|..++++++|||+|.||..||++||.... .||+||..+.....
T Consensus       203 ~~~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di~~~~~  282 (348)
T KOG4628|consen  203 RRNRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDIRTDSG  282 (348)
T ss_pred             hhhhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcCCCCCC
Confidence            45578899999999999988655444469999999999999999999999999999999997665 59999998876665


Q ss_pred             ccc
Q 026833          174 ESG  176 (232)
Q Consensus       174 ~~~  176 (232)
                      ...
T Consensus       283 ~~~  285 (348)
T KOG4628|consen  283 SEP  285 (348)
T ss_pred             CCC
Confidence            543



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 6e-14
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 7e-11
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 6e-10
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 8e-10
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 7e-08
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 5e-06
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 3e-05
1chc_A68 Structure Of The C3hc4 Domain By 1h-Nuclear Magneti 7e-04
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure

Iteration: 1

Score = 74.3 bits (181), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 3/77 (3%) Query: 95 GQPPASKASVEAMPSIKVGESEEEALGGE--CVVCLEEYEVGEVAREMPCKHKFHANCIE 152 PPASK S++A+P I V E + A+G E C +C EY G+VA E+PC H FH C+ Sbjct: 13 ANPPASKESIDALPEILVTE-DHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVS 71 Query: 153 KWLGINGSCPVCRYKMP 169 WL +G+CPVCR P Sbjct: 72 IWLQKSGTCPVCRCMFP 88
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 9e-39
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-30
2ect_A78 Ring finger protein 126; metal binding protein, st 7e-28
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-25
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-25
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-23
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-19
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-18
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 1e-15
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 3e-14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 7e-13
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 4e-10
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 3e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-08
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-08
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 4e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-05
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 1e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-07
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 4e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 8e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 8e-07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 9e-07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-06
3nw0_A238 Non-structural maintenance of chromosomes element 1e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 8e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 1e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 1e-05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 3e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 3e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 5e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-05
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 7e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 8e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 8e-05
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 1e-04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-04
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 2e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 7e-04
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
 Score =  128 bits (324), Expect = 9e-39
 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 83  LETLLRNFAGKDGQPPASKASVEAMPSIKVGESEEEALGG-ECVVCLEEYEVGEVAREMP 141
           +     + +     PPASK S++A+P I V E          C +C  EY  G+VA E+P
Sbjct: 1   MGHHHHHHSHMVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELP 60

Query: 142 CKHKFHANCIEKWLGINGSCPVCRYKMP 169
           C H FH  C+  WL  +G+CPVCR   P
Sbjct: 61  CHHYFHKPCVSIWLQKSGTCPVCRCMFP 88


>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.67
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.64
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.5
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.5
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.48
2ect_A78 Ring finger protein 126; metal binding protein, st 99.48
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.4
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.39
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.38
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.38
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.37
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.35
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.33
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.3
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.3
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.28
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.28
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.26
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.24
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.23
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.23
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.22
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.21
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.21
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.2
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.19
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.17
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.16
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.15
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.14
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.14
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.14
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.14
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.13
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.13
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.1
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.09
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.07
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.07
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.03
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.03
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.01
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.99
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.98
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.97
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.96
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.95
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.93
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.91
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.89
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.88
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.85
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.82
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.82
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.79
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.7
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.7
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.66
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.62
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.62
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.55
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.55
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.54
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.47
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.45
2ea5_A68 Cell growth regulator with ring finger domain prot 98.42
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.39
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.36
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.98
3nw0_A238 Non-structural maintenance of chromosomes element 97.9
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.41
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.9
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.28
1wil_A89 KIAA1045 protein; ring finger domain, structural g 91.41
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.22
2k16_A75 Transcription initiation factor TFIID subunit 3; p 87.85
1we9_A64 PHD finger family protein; structural genomics, PH 87.48
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 87.19
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.25
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 84.73
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 83.93
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 83.17
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 82.43
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 82.29
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 80.19
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.67  E-value=6.2e-17  Score=118.96  Aligned_cols=77  Identities=44%  Similarity=0.905  Sum_probs=66.3

Q ss_pred             CCCCCCCHHHHHcCCceeccCch-hhhcCCCCcccccccccCceeeeeCCCCcccHHHHHHHHhcCCCCCCcCcccCC
Q 026833           94 DGQPPASKASVEAMPSIKVGESE-EEALGGECVVCLEEYEVGEVAREMPCKHKFHANCIEKWLGINGSCPVCRYKMPV  170 (232)
Q Consensus        94 ~g~~~as~~~i~~l~~~~~~~~~-~~~~~~~C~IC~e~~~~~~~~~~lpC~H~fh~~Ci~~wl~~~~tCP~CR~~~~~  170 (232)
                      .+..+++++.|+.||...+.... ....+..|+||++.|..+..++.++|+|.||..||..|+..+.+||+||..+..
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             cCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            44678999999999999887643 234567899999999988888889999999999999999999999999998864



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-19
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-14
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 5e-12
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 8e-12
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 5e-11
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-10
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 7e-10
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-09
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 4e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 5e-06
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 5e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 3e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 75.3 bits (185), Expect = 6e-19
 Identities = 27/51 (52%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 121 GGECVVCLEEYEVGEVAREMP-CKHKFHANCIEKWLGINGSCPVCRYKMPV 170
           G EC VCL E E GE AR +P C H FHA C++ WLG + +CP+CR  + V
Sbjct: 5   GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVVV 55


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.61
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.45
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.38
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.36
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.36
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.34
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.19
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.17
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.17
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.15
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.03
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.02
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.95
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.92
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.71
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.42
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 94.67
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.67
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 91.01
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 87.15
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 86.63
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 85.69
d1wema_76 Death associated transcription factor 1, Datf1 (DI 83.22
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.61  E-value=1.5e-16  Score=105.06  Aligned_cols=50  Identities=52%  Similarity=1.133  Sum_probs=44.7

Q ss_pred             cCCCCcccccccccCceeeeeC-CCCcccHHHHHHHHhcCCCCCCcCcccC
Q 026833          120 LGGECVVCLEEYEVGEVAREMP-CKHKFHANCIEKWLGINGSCPVCRYKMP  169 (232)
Q Consensus       120 ~~~~C~IC~e~~~~~~~~~~lp-C~H~fh~~Ci~~wl~~~~tCP~CR~~~~  169 (232)
                      ++.+|+||++.|..++.+..++ |+|.||..||.+|++.+.+||+||+.+.
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            3568999999999888777765 9999999999999999999999999774



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure