Citrus Sinensis ID: 026841

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MASSSCSTCMMNKSSFAPRVTNCKKELMFSYSSLVDKLPVHRNSFSLSADVSKSRLLLSHEKSMKWKQTQQLPLRNSIQCQAVETQSTPSFTIGKKFQLDDVIESQQFDRDILNAIFEDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW
cccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccEEEEEEHHHHHcccHHHHHcccHHHHHHHHHHcccEEEEEccHHHHcccccEEEEEcccccccccccHHHHHHcccccccHHHHHccccccEEccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHccc
cccccccHHHHcHHcccccccccccHHccccccHHcccccccccccccccccccEEEEEccccccHHHHcccccHHHHHHHHHccccccHHHHHHHHHHcccEEEEEccHHHHcccccHHHHHHHHHcccEEEEcccHHHHHHcccEEEEEEEEHHcccccHHHHHHccccccEcHHHHHccccccEEEccccccccEcHHHcccccEcHHHHHHcHHHHHHHHHHHHHccc
massscstcmmnkssfaprvtncKKELMFSYSSLvdklpvhrnsfslsadvsksRLLLSHEKSMKwkqtqqlplrnsiqcqavetqstpsftigkkfqlddviesqQFDRDILNAIFEDDIKDYLTsqgveweesADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAvvlhplprldeitvdvdadpraAYFRQAKNGLYIRMALLKLLLVGW
massscstcmmnkssfaprvtNCKKELMFSYSSLVDKLPVHRNSFSLSADVSKSRLLLSHEKSMKWKQTQQLPLRNSIQCQAVETQSTPSFTIGKKFQLDDVIESQQFDRDILNAIFEDDIKDYLTSQGVEWEESADLMEVASKCDVVYQtriqrerfgertdlyeeARGKYIVDQNVLRVMQKHAvvlhplprldeitvdvdaDPRAAYFRQAKNGLYIRMALLKLLLVGW
MASSSCSTCMMNKSSFAPRVTNCKKELMFSYSSLVDKLPVHRNSFSLSADVSKSRLLLSHEKSMKWKQTQQLPLRNSIQCQAVETQSTPSFTIGKKFQLDDVIESQQFDRDILNAIFEDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW
*******************VTNCKKELMFSYSSLVDKLPVHR***********************************IQCQAV*****PSFTIGKKFQLDDVIESQQFDRDILNAIFEDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVG*
**************SFAPRVTNCKKELMFSYSSLVDKLPVHRNSFSLSADVSKSRL*****************LRNSIQCQAVETQSTPSFTIGKKFQLDDVIESQQFDRDILNAIFEDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW
**********MNKSSFAPRVTNCKKELMFSYSSLVDKLPVHRNSFSLSADVSKSRLLLSHEKSMKWKQTQQLPLRNSIQCQAVETQSTPSFTIGKKFQLDDVIESQQFDRDILNAIFEDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW
***************FAPRVTNCKKELMFSYSSLVDKLPVHRNSFSLSADVSKSRLLLSHEKSMKWKQTQQLPLRNSIQCQAVETQSTPSFTIGKKFQLDDVIESQQFDRDILNAIFEDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSCSTCMMNKSSFAPRVTNCKKELMFSYSSLVDKLPVHRNSFSLSADVSKSRLLLSHEKSMKWKQTQQLPLRNSIQCQAVETQSTPSFTIGKKFQLDDVIESQQFDRDILNAIFEDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
P49077390 Aspartate carbamoyltransf yes no 0.422 0.251 0.869 4e-57
Q43087385 Aspartate carbamoyltransf N/A no 0.405 0.244 0.843 9e-56
Q43064391 Aspartate carbamoyltransf N/A no 0.413 0.245 0.843 1e-55
Q43086386 Aspartate carbamoyltransf N/A no 0.5 0.300 0.827 2e-55
A1RZC5315 Aspartate carbamoyltransf yes no 0.482 0.355 0.513 3e-26
P089552225 CAD protein OS=Mesocricet N/A no 0.456 0.047 0.504 1e-25
P277082225 CAD protein OS=Homo sapie yes no 0.465 0.048 0.486 2e-25
Q914372242 CAD protein OS=Squalus ac N/A no 0.469 0.048 0.481 7e-25
P059902224 CAD protein OS=Drosophila yes no 0.482 0.050 0.460 3e-22
Q97FS3307 Aspartate carbamoyltransf yes no 0.461 0.348 0.435 8e-22
>sp|P49077|PYRB_ARATH Aspartate carbamoyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PYRB PE=2 SV=2 Back     alignment and function desciption
 Score =  221 bits (563), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 100/115 (86%), Positives = 109/115 (94%)

Query: 118 EDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQN 177
           +DDIKDYLTS GVEWEES+DLMEVASKCDVVYQTRIQRERFGER DLYE ARGKYIVD++
Sbjct: 276 KDDIKDYLTSSGVEWEESSDLMEVASKCDVVYQTRIQRERFGERLDLYEAARGKYIVDKD 335

Query: 178 VLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW 232
           +L VMQK A+++HPLPRLDEIT DVDADPRAAYFRQAKNGL+IRMALLKLLLVGW
Sbjct: 336 LLGVMQKKAIIMHPLPRLDEITADVDADPRAAYFRQAKNGLFIRMALLKLLLVGW 390

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|Q43087|PYRB2_PEA Aspartate carbamoyltransferase 2, chloroplastic OS=Pisum sativum GN=PYRB2 PE=2 SV=1 Back     alignment and function description
>sp|Q43064|PYRB3_PEA Aspartate carbamoyltransferase 3, chloroplastic OS=Pisum sativum GN=PYRB3 PE=2 SV=1 Back     alignment and function description
>sp|Q43086|PYRB1_PEA Aspartate carbamoyltransferase 1, chloroplastic OS=Pisum sativum GN=PYRB1 PE=2 SV=1 Back     alignment and function description
>sp|A1RZC5|PYRB_THEPD Aspartate carbamoyltransferase OS=Thermofilum pendens (strain Hrk 5) GN=pyrB PE=3 SV=1 Back     alignment and function description
>sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 Back     alignment and function description
>sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 Back     alignment and function description
>sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 Back     alignment and function description
>sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 Back     alignment and function description
>sp|Q97FS3|PYRB_CLOAB Aspartate carbamoyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyrB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
255577165 360 Aspartate carbamoyltransferase 2, chloro 0.491 0.316 0.921 2e-57
297737481265 unnamed protein product [Vitis vinifera] 0.5 0.437 0.913 4e-57
359494069 403 PREDICTED: aspartate carbamoyltransferas 0.491 0.282 0.913 4e-57
356501558 391 PREDICTED: aspartate carbamoyltransferas 0.5 0.296 0.870 2e-56
255646592 391 unknown [Glycine max] 0.5 0.296 0.870 2e-56
224061045332 predicted protein [Populus trichocarpa] 0.5 0.349 0.896 2e-56
15231112 390 aspartate carbamoyltransferase [Arabidop 0.422 0.251 0.869 2e-55
443820 390 aspartate carbamoyltransferase [Arabidop 0.422 0.251 0.860 5e-55
356512197 343 PREDICTED: aspartate carbamoyltransferas 0.5 0.338 0.853 1e-54
15215706 390 AT3g20330/MQC12_8 [Arabidopsis thaliana] 0.422 0.251 0.860 1e-54
>gi|255577165|ref|XP_002529466.1| Aspartate carbamoyltransferase 2, chloroplast precursor, putative [Ricinus communis] gi|223531082|gb|EEF32932.1| Aspartate carbamoyltransferase 2, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  228 bits (581), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 110/115 (95%)

Query: 118 EDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQN 177
           +DDIKDYL S+GVEWEESADLMEVASKCDVVYQTRIQRERFGER DLYEEARGKYIVD +
Sbjct: 246 KDDIKDYLASRGVEWEESADLMEVASKCDVVYQTRIQRERFGERIDLYEEARGKYIVDSD 305

Query: 178 VLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW 232
           VL VMQKHAVV+HPLPRLDEITVDVD DPRAAYFRQAKNGLYIRMALLKLLLVGW
Sbjct: 306 VLNVMQKHAVVMHPLPRLDEITVDVDVDPRAAYFRQAKNGLYIRMALLKLLLVGW 360

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297737481|emb|CBI26682.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494069|ref|XP_002277415.2| PREDICTED: aspartate carbamoyltransferase 2, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356501558|ref|XP_003519591.1| PREDICTED: aspartate carbamoyltransferase 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255646592|gb|ACU23770.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224061045|ref|XP_002300331.1| predicted protein [Populus trichocarpa] gi|222847589|gb|EEE85136.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15231112|ref|NP_188668.1| aspartate carbamoyltransferase [Arabidopsis thaliana] gi|14917032|sp|P49077.2|PYRB_ARATH RecName: Full=Aspartate carbamoyltransferase, chloroplastic; AltName: Full=Aspartate transcarbamylase; Short=ATCase; Flags: Precursor gi|9294550|dbj|BAB02813.1| aspartate carbamoyltransferase [Arabidopsis thaliana] gi|51968378|dbj|BAD42881.1| aspartate carbamoyltransferase precursor [Arabidopsis thaliana] gi|332642844|gb|AEE76365.1| aspartate carbamoyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|443820|emb|CAA50687.1| aspartate carbamoyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356512197|ref|XP_003524807.1| PREDICTED: aspartate carbamoyltransferase 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|15215706|gb|AAK91399.1| AT3g20330/MQC12_8 [Arabidopsis thaliana] gi|19699266|gb|AAL90999.1| AT3g20330/MQC12_8 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2092369390 PYRB "PYRIMIDINE B" [Arabidops 0.495 0.294 0.869 6.1e-60
UNIPROTKB|F1MVC02225 CAD "Uncharacterized protein" 0.469 0.048 0.490 4.2e-23
UNIPROTKB|P089552225 CAD "CAD protein" [Mesocricetu 0.456 0.047 0.504 8.7e-23
RGD|15886062225 Cad "carbamoyl-phosphate synth 0.456 0.047 0.495 1.4e-22
UNIPROTKB|F8VPD42162 CAD "CAD protein" [Homo sapien 0.465 0.049 0.486 1.8e-22
UNIPROTKB|P277082225 CAD "CAD protein" [Homo sapien 0.465 0.048 0.486 1.8e-22
UNIPROTKB|H7C2E4293 CAD "CAD protein" [Homo sapien 0.413 0.327 0.525 2.1e-22
ZFIN|ZDB-GENE-021030-42230 cad "carbamoyl-phosphate synth 0.469 0.048 0.472 7.9e-22
UNIPROTKB|J9P2662162 CAD "Uncharacterized protein" 0.469 0.050 0.463 1.2e-21
UNIPROTKB|E2RAV22228 CAD "Uncharacterized protein" 0.469 0.048 0.463 1.3e-21
TAIR|locus:2092369 PYRB "PYRIMIDINE B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 529 (191.3 bits), Expect = 6.1e-60, Sum P(2) = 6.1e-60
 Identities = 100/115 (86%), Positives = 109/115 (94%)

Query:   118 EDDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQN 177
             +DDIKDYLTS GVEWEES+DLMEVASKCDVVYQTRIQRERFGER DLYE ARGKYIVD++
Sbjct:   276 KDDIKDYLTSSGVEWEESSDLMEVASKCDVVYQTRIQRERFGERLDLYEAARGKYIVDKD 335

Query:   178 VLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW 232
             +L VMQK A+++HPLPRLDEIT DVDADPRAAYFRQAKNGL+IRMALLKLLLVGW
Sbjct:   336 LLGVMQKKAIIMHPLPRLDEITADVDADPRAAYFRQAKNGLFIRMALLKLLLVGW 390
GO:0004070 "aspartate carbamoyltransferase activity" evidence=IEA;IGI
GO:0006207 "'de novo' pyrimidine nucleobase biosynthetic process" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016597 "amino acid binding" evidence=IEA;ISS
GO:0016743 "carboxyl- or carbamoyltransferase activity" evidence=IEA;ISS
GO:0016036 "cellular response to phosphate starvation" evidence=IEP
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005829 "cytosol" evidence=IDA
GO:0006164 "purine nucleotide biosynthetic process" evidence=RCA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=IGI;RCA
UNIPROTKB|F1MVC0 CAD "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P08955 CAD "CAD protein" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
RGD|1588606 Cad "carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F8VPD4 CAD "CAD protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P27708 CAD "CAD protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H7C2E4 CAD "CAD protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021030-4 cad "carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9P266 CAD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAV2 CAD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P49077PYRB_ARATH2, ., 1, ., 3, ., 20.86950.42240.2512yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.3LOW CONFIDENCE prediction!
3rd Layer2.1.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
PLN02527306 PLN02527, PLN02527, aspartate carbamoyltransferase 4e-79
pfam00185156 pfam00185, OTCace, Aspartate/ornithine carbamoyltr 1e-36
COG0540316 COG0540, PyrB, Aspartate carbamoyltransferase, cat 4e-35
PRK00856305 PRK00856, pyrB, aspartate carbamoyltransferase cat 7e-35
TIGR00670301 TIGR00670, asp_carb_tr, aspartate carbamoyltransfe 1e-31
PRK08192338 PRK08192, PRK08192, aspartate carbamoyltransferase 4e-19
PRK11891429 PRK11891, PRK11891, aspartate carbamoyltransferase 9e-18
PRK13814310 PRK13814, pyrB, aspartate carbamoyltransferase cat 3e-07
PRK00779304 PRK00779, PRK00779, ornithine carbamoyltransferase 4e-06
COG0078310 COG0078, ArgF, Ornithine carbamoyltransferase [Ami 5e-06
PRK13376 525 PRK13376, pyrB, bifunctional aspartate carbamoyltr 6e-05
TIGR00658304 TIGR00658, orni_carb_tr, ornithine carbamoyltransf 0.002
>gnl|CDD|178142 PLN02527, PLN02527, aspartate carbamoyltransferase Back     alignment and domain information 
 Score =  239 bits (612), Expect = 4e-79
 Identities = 98/114 (85%), Positives = 107/114 (93%)

Query: 119 DDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNV 178
           DDIKDYLTS+GVEWEES+DLMEVASKCDV+YQTRIQRERFGER DLYE ARGKYIVD+ V
Sbjct: 193 DDIKDYLTSKGVEWEESSDLMEVASKCDVLYQTRIQRERFGERIDLYEAARGKYIVDKKV 252

Query: 179 LRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVGW 232
           + V+ KHAVV+HPLPRLDEIT DVD+DPRAAYFRQAKNGL+IRMALLKLLL GW
Sbjct: 253 MDVLPKHAVVMHPLPRLDEITTDVDSDPRAAYFRQAKNGLFIRMALLKLLLGGW 306

Length = 306
>gnl|CDD|215776 pfam00185, OTCace, Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>gnl|CDD|223614 COG0540, PyrB, Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|234849 PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|233083 TIGR00670, asp_carb_tr, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|169269 PRK08192, PRK08192, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183362 PRK11891, PRK11891, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|139876 PRK13814, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|234835 PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223156 COG0078, ArgF, Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237369 PRK13376, pyrB, bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|129743 TIGR00658, orni_carb_tr, ornithine carbamoyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 100.0
PLN02527306 aspartate carbamoyltransferase 100.0
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 100.0
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 100.0
PLN02342348 ornithine carbamoyltransferase 100.0
PRK04284332 ornithine carbamoyltransferase; Provisional 100.0
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 100.0
PRK14805302 ornithine carbamoyltransferase; Provisional 100.0
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 99.98
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 99.98
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 99.97
PRK02255338 putrescine carbamoyltransferase; Provisional 99.97
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 99.97
PRK02102331 ornithine carbamoyltransferase; Validated 99.97
KOG1504346 consensus Ornithine carbamoyltransferase OTC/ARG3 99.97
PRK00779304 ornithine carbamoyltransferase; Provisional 99.97
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 99.97
PRK01713334 ornithine carbamoyltransferase; Provisional 99.97
PRK14804311 ornithine carbamoyltransferase; Provisional 99.97
PRK07200395 aspartate/ornithine carbamoyltransferase family pr 99.97
PRK11891429 aspartate carbamoyltransferase; Provisional 99.97
PRK08192338 aspartate carbamoyltransferase; Provisional 99.97
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 99.97
PRK13376 525 pyrB bifunctional aspartate carbamoyltransferase c 99.95
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 99.94
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 85.75
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 82.37
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.7e-38  Score=286.72  Aligned_cols=149  Identities=19%  Similarity=0.233  Sum_probs=130.5

Q ss_pred             cceeccCCCccccCccchh--------hhHH-HhhccCcccccccChHHHH----------HHHHhCCCEEEEEcCHHHh
Q 026841           81 QAVETQSTPSFTIGKKFQL--------DDVI-ESQQFDRDILNAIFEDDIK----------DYLTSQGVEWEESADLMEV  141 (232)
Q Consensus        81 ~~~~~~~~~~~~~~~k~~l--------~~li-~A~~~~~~~L~va~P~~i~----------e~l~~~G~~v~~~~D~~EA  141 (232)
                      -.++|.+-.+=..|+|+.|        ||++ .|+.||++ +++++|+++.          +.++++|+++++++|++||
T Consensus       140 Dl~Ti~E~~g~l~g~k~a~vGDgNNv~nSl~~~~a~~G~d-v~ia~Pk~~~p~~~~~~~a~~~a~~~g~~i~~t~d~~eA  218 (310)
T COG0078         140 DLMTIKEHFGSLKGLKLAYVGDGNNVANSLLLAAAKLGMD-VRIATPKGYEPDPEVVEKAKENAKESGGKITLTEDPEEA  218 (310)
T ss_pred             HHHHHHHhcCcccCcEEEEEcCcchHHHHHHHHHHHhCCe-EEEECCCcCCcCHHHHHHHHHHHHhcCCeEEEecCHHHH
Confidence            3567888777688999999        4554 55889999 9999997663          3456779999999999999


Q ss_pred             hCcCCEEEEccccccccCCChhH-HHHhhcCCccCHHHHHhcCCCcEEeCCCC--CCccccccccCCCCchHHHHHhhcH
Q 026841          142 ASKCDVVYQTRIQRERFGERTDL-YEEARGKYIVDQNVLRVMQKHAVVLHPLP--RLDEITVDVDADPRAAYFRQAKNGL  218 (232)
Q Consensus       142 l~~ADVVYtdrwqsEr~~~~~~e-~~~~~~~YqVt~elL~~Ak~dai~MHcLP--Rg~EIs~eV~dsp~S~if~QAeNrL  218 (232)
                      ++||||||||+|.+|+++.+.++ +...+.+||||+++|+.+++|++||||||  ||+||++||+|+|+|++|+|||||+
T Consensus       219 v~gADvvyTDvWvSMGee~e~~~~~~~~~~~yQVn~~lm~~a~~~~ifmHCLPA~rG~EVTdeV~dg~~svvfdeAENRl  298 (310)
T COG0078         219 VKGADVVYTDVWVSMGEEAEAEERRIAFLPPYQVNEELMALAGPDAIFMHCLPAHRGEEVTDEVFEGPASVVFDEAENRL  298 (310)
T ss_pred             hCCCCEEEecCcccCcchhhhHHHHHhhCCCceeCHHHHhhcCCCeEEEeCCCCCCCCccCHHHhCCCceeeeehhhhhH
Confidence            99999999999999999876444 44555669999999999999999999999  9999999999999999999999999


Q ss_pred             HHHHHHHHHHhc
Q 026841          219 YIRMALLKLLLV  230 (232)
Q Consensus       219 ~vrmALL~~lLg  230 (232)
                      |+|||||.++++
T Consensus       299 H~qKAvl~~~l~  310 (310)
T COG0078         299 HTQKAVLAALLG  310 (310)
T ss_pred             HHHHHHHHHhhC
Confidence            999999999985

>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>KOG1504 consensus Ornithine carbamoyltransferase OTC/ARG3 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2be7_A326 Crystal Structure Of The Unliganded (T-State) Aspar 9e-20
2a0f_A310 Structure Of D236a Mutant E. Coli Aspartate Transca 3e-19
9atc_A310 Atcase Y165f Mutant Length = 310 6e-19
1acm_A310 Arginine 54 In The Active Site Of Escherichia Coli 6e-19
1i5o_A310 Crystal Structure Of Mutant R105a Of E. Coli Aspart 6e-19
4e2f_I310 Crystal Structure Of E. Coli Aspartate Transcarbamo 6e-19
1tth_A310 Aspartate Transcarbamoylase Catalytic Chain Mutant 6e-19
1xjw_A310 The Structure Of E. Coli Aspartate Transcarbamoylas 6e-19
1ekx_A311 The Isolated, Unregulated Catalytic Trimer Of Aspar 6e-19
1raa_A310 Crystal Structure Of Ctp-Ligated T State Aspartate 6e-19
1at1_A310 Crystal Structures Of Phosphonoacetamide Ligated T 6e-19
1d09_A310 Aspartate Transcarbamoylase Complexed With N-Phosph 6e-19
1sku_A310 E. Coli Aspartate Transcarbamylase 240's Loop Mutan 1e-18
3mpu_A310 Crystal Structure Of The C47aA241C DISULFIDE-Linked 2e-18
1ezz_A310 Crystal Structure Of E. Coli Aspartate Transcarbamo 8e-18
1ml4_A308 The Pala-Liganded Aspartate Transcarbamoylase Catal 1e-17
3lxm_A335 2.00 Angstrom Resolution Crystal Structure Of A Cat 3e-17
2be9_A300 Crystal Structure Of The Ctp-Liganded (T-State) Asp 1e-16
1pg5_A299 Crystal Structure Of The Unligated (t-state) Aspart 1e-16
2atc_A305 Crystal And Molecular Structures Of Native And Ctp- 4e-15
2rgw_A306 Catalytic Subunit Of M. Jannaschii Aspartate Transc 2e-14
2at2_A300 Molecular Structure Of Bacillus Subtilis Aspartate 3e-06
3r7d_A304 Crystal Structure Of Unliganded Aspartate Transcarb 4e-06
>pdb|2BE7|A Chain A, Crystal Structure Of The Unliganded (T-State) Aspartate Transcarbamoylase Of The Psychrophilic Bacterium Moritella Profunda Length = 326 Back     alignment and structure 
Iteration: 1

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 2/109 (1%)
Query: 121 IKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLR 180
           I D L  Q + +   A + EV  + DV+Y TR+Q+ERF E    Y+  +  +I+  + L 
Sbjct: 214 ICDELDEQNISYATYASIEEVVPEIDVLYMTRVQKERFDETE--YQHMKAGFILSASSLV 271
Query: 181 VMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLL 229
             + +  VLHPLPR+DEI  DVD  P A YF+QA+NG+Y R ALL L+L
Sbjct: 272 HAKPNLKVLHPLPRVDEIATDVDKTPYAYYFQQAENGVYAREALLALVL 320
>pdb|2A0F|A Chain A, Structure Of D236a Mutant E. Coli Aspartate Transcarbamoylase In Presence Of Phosphonoacetamide At 2.90 A Resolution Length = 310 Back     alignment and structure
>pdb|9ATC|A Chain A, Atcase Y165f Mutant Length = 310 Back     alignment and structure
>pdb|1ACM|A Chain A, Arginine 54 In The Active Site Of Escherichia Coli Aspartate Transcarbamoylase Is Critical For Catalysis: A Site-Specific Mutagenesis, Nmr And X-Ray Crystallography Study Length = 310 Back     alignment and structure
>pdb|1I5O|A Chain A, Crystal Structure Of Mutant R105a Of E. Coli Aspartate Transcarbamoylase Length = 310 Back     alignment and structure
>pdb|4E2F|I Chain I, Crystal Structure Of E. Coli Aspartate Transcarbamoylase K164eE239K Mutant In An Intermediate State Length = 310 Back     alignment and structure
>pdb|1TTH|A Chain A, Aspartate Transcarbamoylase Catalytic Chain Mutant Glu50ala Complexed With N-(Phosphonacetyl-L-Aspartate) (Pala) Length = 310 Back     alignment and structure
>pdb|1XJW|A Chain A, The Structure Of E. Coli Aspartate Transcarbamoylase Q137a Mutant In The R-State Length = 310 Back     alignment and structure
>pdb|1EKX|A Chain A, The Isolated, Unregulated Catalytic Trimer Of Aspartate Transcarbamoylase Complexed With Bisubstrate Analog Pala (N-(Phosphonacetyl)-L-Aspartate) Length = 311 Back     alignment and structure
>pdb|1RAA|A Chain A, Crystal Structure Of Ctp-Ligated T State Aspartate Transcarbamoylase At 2.5 Angstroms Resolution: Implications For Atcase Mutants And The Mechanism Of Negative Cooperativity Length = 310 Back     alignment and structure
>pdb|1AT1|A Chain A, Crystal Structures Of Phosphonoacetamide Ligated T And Phosphonoacetamide And Malonate Ligated R States Of Aspartate Carbamoyltransferase At 2.8-Angstroms Resolution And Neutral PH Length = 310 Back     alignment and structure
>pdb|1D09|A Chain A, Aspartate Transcarbamoylase Complexed With N-Phosphonacetyl-L- Aspartate (Pala) Length = 310 Back     alignment and structure
>pdb|1SKU|A Chain A, E. Coli Aspartate Transcarbamylase 240's Loop Mutant (K244n) Length = 310 Back     alignment and structure
>pdb|3MPU|A Chain A, Crystal Structure Of The C47aA241C DISULFIDE-Linked E. Coli Aspartate Transcarbamoylase Holoenzyme Length = 310 Back     alignment and structure
>pdb|1EZZ|A Chain A, Crystal Structure Of E. Coli Aspartate Transcarbamoylase P268a Mutant In The T-State Length = 310 Back     alignment and structure
>pdb|1ML4|A Chain A, The Pala-Liganded Aspartate Transcarbamoylase Catalytic Subunit From Pyrococcus Abyssi Length = 308 Back     alignment and structure
>pdb|3LXM|A Chain A, 2.00 Angstrom Resolution Crystal Structure Of A Catalytic Subunit Of An Aspartate Carbamoyltransferase (Pyrb) From Yersinia Pestis Co92 Length = 335 Back     alignment and structure
>pdb|2BE9|A Chain A, Crystal Structure Of The Ctp-Liganded (T-State) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 300 Back     alignment and structure
>pdb|1PG5|A Chain A, Crystal Structure Of The Unligated (t-state) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 299 Back     alignment and structure
>pdb|2ATC|A Chain A, Crystal And Molecular Structures Of Native And Ctp-Liganded Aspartate Carbamoyltransferase From Escherichia Coli Length = 305 Back     alignment and structure
>pdb|2RGW|A Chain A, Catalytic Subunit Of M. Jannaschii Aspartate Transcarbamoylase Length = 306 Back     alignment and structure
>pdb|2AT2|A Chain A, Molecular Structure Of Bacillus Subtilis Aspartate Transcarbamoylase At 3.0 Angstroms Resolution Length = 300 Back     alignment and structure
>pdb|3R7D|A Chain A, Crystal Structure Of Unliganded Aspartate Transcarbamoylase From Bacillus Subtilis Length = 304 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 9e-54
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 1e-52
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 2e-50
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 3e-49
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 2e-18
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 8e-13
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 4e-07
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 5e-07
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 8e-07
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 2e-06
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 2e-06
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 3e-06
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 3e-06
1oth_A321 Protein (ornithine transcarbamoylase); transferase 6e-06
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 7e-06
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 6e-05
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 6e-05
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 1e-04
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 1e-04
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 4e-04
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 5e-04
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 6e-04
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Length = 310 Back     alignment and structure
 Score =  174 bits (443), Expect = 9e-54
 Identities = 43/111 (38%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 119 DDIKDYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNV 178
             I D L  +G+ W   + + EV ++ D++Y TR+Q+ER       Y   + ++++  + 
Sbjct: 196 QYILDMLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDP--SEYANVKAQFVLRASD 253

Query: 179 LRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLL 229
           L   + +  VLHPLPR+DEI  DVD  P A YF+QA NG++ R ALL L+L
Sbjct: 254 LHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQALLALVL 304
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Length = 308 Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Length = 306 Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Length = 299 Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Length = 304 Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Length = 291 Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Length = 309 Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Length = 340 Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Length = 307 Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Length = 323 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 301 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Length = 307 Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Length = 315 Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Length = 321 Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Length = 353 Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Length = 324 Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Length = 399 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Length = 328 Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Length = 325 Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Length = 339 Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Length = 355 Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Length = 418 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 100.0
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 100.0
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 100.0
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 100.0
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 100.0
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 100.0
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 100.0
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 100.0
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 100.0
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 100.0
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 100.0
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 100.0
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 100.0
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 100.0
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 100.0
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 100.0
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 100.0
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 100.0
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 100.0
1oth_A321 Protein (ornithine transcarbamoylase); transferase 100.0
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 100.0
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 100.0
3kzn_A359 Aotcase, N-acetylornithine carbamoyltransferase; t 100.0
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 100.0
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 100.0
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 99.97
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 99.97
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 99.97
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 99.97
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 91.6
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 86.94
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 86.19
2b0j_A 358 5,10-methenyltetrahydromethanopterin hydrogenase; 84.63
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
Probab=100.00  E-value=3.5e-37  Score=280.66  Aligned_cols=148  Identities=36%  Similarity=0.526  Sum_probs=130.1

Q ss_pred             ceeccCCCccccCccchh----------hhHHHh-hccCcccccccChHHH------HHHHHhCCCEEEEEcCHHHhhCc
Q 026841           82 AVETQSTPSFTIGKKFQL----------DDVIES-QQFDRDILNAIFEDDI------KDYLTSQGVEWEESADLMEVASK  144 (232)
Q Consensus        82 ~~~~~~~~~~~~~~k~~l----------~~li~A-~~~~~~~L~va~P~~i------~e~l~~~G~~v~~~~D~~EAl~~  144 (232)
                      .++|.+..+=..|.|+.|          +|++.+ +.||++ +++++|+++      .+.+++.|+++++++|++||+++
T Consensus       143 l~Ti~e~~g~l~gl~va~vGD~~~~rva~Sl~~~~~~~G~~-v~~~~P~~~~~~~~~~~~~~~~g~~~~~~~d~~eav~~  221 (308)
T 1ml4_A          143 LYTIKKEFGRIDGLKIGLLGDLKYGRTVHSLAEALTFYDVE-LYLISPELLRMPRHIVEELREKGMKVVETTTLEDVIGK  221 (308)
T ss_dssp             HHHHHHHSSCSSSEEEEEESCTTTCHHHHHHHHHGGGSCEE-EEEECCGGGCCCHHHHHHHHHTTCCEEEESCTHHHHTT
T ss_pred             HHHHHHHhCCCCCeEEEEeCCCCcCchHHHHHHHHHHCCCE-EEEECCccccCCHHHHHHHHHcCCeEEEEcCHHHHhcC
Confidence            356777666667888887          455555 689998 999999766      46677889999999999999999


Q ss_pred             CCEEEEccccccccCCChhHHHHhhcCCccCHHHHHhcCCCcEEeCCCCCCccccccccCCCCchHHHHHhhcHHHHHHH
Q 026841          145 CDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMAL  224 (232)
Q Consensus       145 ADVVYtdrwqsEr~~~~~~e~~~~~~~YqVt~elL~~Ak~dai~MHcLPRg~EIs~eV~dsp~S~if~QAeNrL~vrmAL  224 (232)
                      ||||||||||+||+++. +++.+++.+||||.++|+.+++|++||||||||+||+++|+++|+|+||+||+||+|+||||
T Consensus       222 aDvvyt~~~q~er~~~~-~~~~~~~~~y~v~~~ll~~a~~~ai~mH~lPrg~EI~~eV~d~p~s~if~QaeNrl~~r~Al  300 (308)
T 1ml4_A          222 LDVLYVTRIQKERFPDE-QEYLKVKGSYQVNLKVLEKAKDELRIMHPLPRVDEIHPEVDNTKHAIYFRQVFNGVPVRMAL  300 (308)
T ss_dssp             CSEEEECCCCGGGSSSH-HHHHTTTTCCCBCTTGGGGSCTTCEEECCSCCSSSBCGGGGGSTTBCHHHHHHTHHHHHHHH
T ss_pred             CCEEEECCccccccCCH-HHHHHHhcCcccCHHHHhhcCCCCEEECCCCCCCeecHHHhCCCchHHHHHHhcCHHHHHHH
Confidence            99999999999997643 56767778999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcC
Q 026841          225 LKLLLVG  231 (232)
Q Consensus       225 L~~lLg~  231 (232)
                      |.+++++
T Consensus       301 L~~ll~~  307 (308)
T 1ml4_A          301 LALVLGV  307 (308)
T ss_dssp             HHHHHTC
T ss_pred             HHHHHhc
Confidence            9999875
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>3kzn_A Aotcase, N-acetylornithine carbamoyltransferase; transcarbamylase, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: KCX AOR; 1.80A {Xanthomonas campestris PV} PDB: 3kzc_A* 3kzm_A* 3kzk_A* 3kzo_A* 3m4j_A* 3m5d_A* 3m5c_A* 3l05_A* 3l02_A* 3m4n_A* 3l06_A* 3l04_A* Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1pg5a2153 c.78.1.1 (A:147-299) Aspartate carbamoyltransferas 1e-21
d1ml4a2157 c.78.1.1 (A:152-308) Aspartate carbamoyltransferas 3e-20
d1ekxa2160 c.78.1.1 (A:151-310) Aspartate carbamoyltransferas 5e-20
d1pvva2163 c.78.1.1 (A:151-313) Ornithine transcarbamoylase { 4e-19
d1otha2170 c.78.1.1 (A:185-354) Ornithine transcarbamoylase { 4e-19
d1tuga1310 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltr 1e-18
d1vlva2161 c.78.1.1 (A:153-313) Ornithine transcarbamoylase { 8e-17
d1js1x2161 c.78.1.1 (X:164-324) Transcarbamylase-like protein 2e-15
d1dxha2185 c.78.1.1 (A:151-335) Ornithine transcarbamoylase { 2e-15
d1duvg2183 c.78.1.1 (G:151-333) Ornithine transcarbamoylase { 3e-14
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 153 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/ornithine carbamoyltransferase
family: Aspartate/ornithine carbamoyltransferase
domain: Aspartate carbamoyltransferase catalytic subunit
species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]

 Score = 85.2 bits (210), Expect = 1e-21
 Identities = 40/102 (39%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 128 QGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIVDQNVLRVMQKHAV 187
                +E  +  EV ++ DV+Y TRIQ+ERF      YE+ +G YIV  ++   M+K ++
Sbjct: 51  LNYPVKEVENPFEVINEVDVLYVTRIQKERF-VDEMEYEKIKGSYIVSLDLANKMKKDSI 109

Query: 188 VLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLL 229
           +LHPLPR++EI   VD   +A YF QA  G+ +RM++L  + 
Sbjct: 110 ILHPLPRVNEIDRKVDKTTKAKYFEQASYGVPVRMSILTKIY 151
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 157 Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 160 Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 163 Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 310 Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Length = 161 Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 185 Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Length = 183 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 100.0
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 100.0
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 100.0
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 100.0
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 100.0
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1js1x2161 Transcarbamylase-like protein {Bacteroides fragili 100.0
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 89.03
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 88.16
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 87.74
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/ornithine carbamoyltransferase
family: Aspartate/ornithine carbamoyltransferase
domain: Aspartate carbamoyltransferase catalytic subunit
species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]

Probab=100.00  E-value=4.1e-38  Score=256.25  Aligned_cols=130  Identities=33%  Similarity=0.579  Sum_probs=116.8

Q ss_pred             hhHHHh-hccCcccccccChHHHH----HHHHhCCCEEEEEcCHHHhhCcCCEEEEccccccccCCChhHHHHhhcCCcc
Q 026841          100 DDVIES-QQFDRDILNAIFEDDIK----DYLTSQGVEWEESADLMEVASKCDVVYQTRIQRERFGERTDLYEEARGKYIV  174 (232)
Q Consensus       100 ~~li~A-~~~~~~~L~va~P~~i~----e~l~~~G~~v~~~~D~~EAl~~ADVVYtdrwqsEr~~~~~~e~~~~~~~YqV  174 (232)
                      +|++.+ +.||++ +.+++|+++.    +.+...|.++++++|++||+++||||||++||.|++.+. +++.+++..|||
T Consensus        19 ~Sl~~~l~~~g~~-~~~~~p~~~~~~~~~~~~~~~~~~~~~~d~~eai~~aDvvy~~~~q~~~~~~~-~~~~~~~~~y~v   96 (153)
T d1pg5a2          19 NSLLRILTRFRPK-LVYLISPQLLRARKEILDELNYPVKEVENPFEVINEVDVLYVTRIQKERFVDE-MEYEKIKGSYIV   96 (153)
T ss_dssp             HHHHHHGGGSCCS-EEEEECCGGGCCCHHHHTTCCSCEEEESCGGGTGGGCSEEEEECCCSTTSSCH-HHHHHHGGGGSB
T ss_pred             HHHHHHHHHcCCe-eEEEecccccccchhhcccCCCeEEEEeCHHHHhhcCCeEEEeeeeehhccch-hHHHHHHHhhhh
Confidence            677776 788987 7777776663    456678999999999999999999999999999988753 556678889999


Q ss_pred             CHHHHHhcCCCcEEeCCCCCCccccccccCCCCchHHHHHhhcHHHHHHHHHHHhcC
Q 026841          175 DQNVLRVMQKHAVVLHPLPRLDEITVDVDADPRAAYFRQAKNGLYIRMALLKLLLVG  231 (232)
Q Consensus       175 t~elL~~Ak~dai~MHcLPRg~EIs~eV~dsp~S~if~QAeNrL~vrmALL~~lLg~  231 (232)
                      |.++|+.++++++||||||||.||+++|+++|+|+||+||+||+|+|||||.++||.
T Consensus        97 ~~~~l~~~~~~~i~mH~LPR~~EI~~~v~~~~~s~v~~Qa~Nrl~~rmAlL~~llg~  153 (153)
T d1pg5a2          97 SLDLANKMKKDSIILHPLPRVNEIDRKVDKTTKAKYFEQASYGVPVRMSILTKIYGE  153 (153)
T ss_dssp             CHHHHHTSCTTCEEECCSCCSSSBCGGGGGSTTBCHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             hHHHHhccCCCeEEecCCCCcCCcchhhccCcccHHHHHHHcCHHHHHHHHHHHhCC
Confidence            999999999999999999999999999999999999999999999999999999984
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure