Citrus Sinensis ID: 026953

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGRRGSYYVWSQTHWSHRSSEIRTWNNQRRSSCCCWKVYFLTET
ccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEEEEEccccccccHHHHHHHHHHHHccEEEEEccccccHHHHHHHHHHcccccccHHHHHHHHcccEEEEEEEccHHHHHHHHHHccccccccccccccccccccccccEEEccccHHHHHHHHcccccccEEEEEccc
ccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHccHHHccEEEEEcHHHHHcccHHHHHHHHHccccEEEEEEccccccHHHHHHcccccccccHHHHHHHHcccccEEEEEEEccHHHHHHHHHHcccccccccccccccEEEEEcccEEEccccHHHHHHHHHHHHHHHHHHHHccc
MSSQIVRSASRAATARSLLSAsknsrfysegrAVSAAAAVTFsgklpylvssfgragsstasrswlsgaiaipaaaYTLQEQEVHAAEMERTFIaikpdgvqrGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYhdlkerpffnglceflssgpvIAMVGISTLYYLFDINLFSLLkhstfagmgrrgsyYVWSqthwshrsseirtwnnqrrsscccwkvyfltet
mssqivrsasraatarsllsasknsrfysEGRAVSAAAAVTFSGKLPYLVSSFGRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFiaikpdgvqrGLISEIISrferkgfklVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGRRGSYYVWSQTHWSHRSseirtwnnqrrsscccwKVYFLTET
MSSQIVrsasraatarsllsasKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGRRGSYYVWSQTHWSHRSSEIRTWNNQRRSSCCCWKVYFLTET
********************************AVSAAAAVTFSGKLPYLVSSFGRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGRRGSYYVWSQTHWSHRSSEIRTWNNQRRSSCCCWKVYFL***
****************************************************************WLSGAIAIPA***************ERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGRRGSYYVWSQTHWSHRSSEIRTWNNQRRSSCCCWKVYFLTE*
****************SLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFG*********SWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGRRGSYYVWSQTHWSHRSSEIRTWNNQRRSSCCCWKVYFLTET
***********************************************************TASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGRRGSYYVWSQTHWSHRSSEIRTWNNQRRSSCCCWKVYFLT*T
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGRRGSYYVWSQTHWSHRSSEIRTWNNQRRSSCCCWKVYFLTET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
Q8LAH8237 Nucleoside diphosphate ki yes no 0.695 0.675 0.734 1e-64
O49203238 Nucleoside diphosphate ki no no 0.695 0.672 0.766 1e-62
Q8RXA8235 Nucleoside diphosphate ki N/A no 0.678 0.663 0.725 6e-59
P81766153 Nucleoside diphosphate ki N/A no 0.330 0.496 0.763 5e-29
Q7VEG3151 Nucleoside diphosphate ki yes no 0.321 0.490 0.702 6e-26
Q46I11151 Nucleoside diphosphate ki yes no 0.321 0.490 0.702 7e-26
A5GPE9152 Nucleoside diphosphate ki yes no 0.317 0.480 0.712 1e-25
A2BZG4151 Nucleoside diphosphate ki yes no 0.321 0.490 0.689 1e-25
Q7V425152 Nucleoside diphosphate ki yes no 0.321 0.486 0.689 2e-25
Q0I6J3152 Nucleoside diphosphate ki yes no 0.317 0.480 0.684 3e-25
>sp|Q8LAH8|NDK4_ARATH Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=NDK4 PE=1 SV=2 Back     alignment and function desciption
 Score =  246 bits (628), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 141/162 (87%), Gaps = 2/162 (1%)

Query: 1   MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSST 60
           MSSQI RSASRAA  RSLLS++KN+RF+SEGRA+ AA+ V  +GK+P   S+FG++GS  
Sbjct: 1   MSSQICRSASRAA--RSLLSSAKNARFFSEGRAIGAASVVHATGKVPQYASNFGKSGSGF 58

Query: 61  ASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKL 120
            S SW++G +A+PAAA+ LQ+QE  AAEMERTFIAIKPDGVQRGLISEII+RFERKG+KL
Sbjct: 59  VSNSWITGLLALPAAAFMLQDQEALAAEMERTFIAIKPDGVQRGLISEIITRFERKGYKL 118

Query: 121 VAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMV 162
           V IK++VPSK FAQKHYHDLKERPFFNGLC FLSSGPV+AMV
Sbjct: 119 VGIKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMV 160
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Shows the highest specificity towards GDP.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6
>sp|O49203|NDK3_ARATH Nucleoside diphosphate kinase III, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=NDPK3 PE=1 SV=1 Back     alignment and function description
>sp|Q8RXA8|NDK4_SPIOL Nucleoside diphosphate kinase 4, chloroplastic OS=Spinacia oleracea GN=NDK4 PE=1 SV=1 Back     alignment and function description
>sp|P81766|NDK3_SPIOL Nucleoside diphosphate kinase 3 OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function description
>sp|Q7VEG3|NDK_PROMA Nucleoside diphosphate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ndk PE=3 SV=2 Back     alignment and function description
>sp|Q46I11|NDK_PROMT Nucleoside diphosphate kinase OS=Prochlorococcus marinus (strain NATL2A) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|A5GPE9|NDK_SYNPW Nucleoside diphosphate kinase OS=Synechococcus sp. (strain WH7803) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|A2BZG4|NDK_PROM1 Nucleoside diphosphate kinase OS=Prochlorococcus marinus (strain NATL1A) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q7V425|NDK_PROMM Nucleoside diphosphate kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q0I6J3|NDK_SYNS3 Nucleoside diphosphate kinase OS=Synechococcus sp. (strain CC9311) GN=ndk PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
255537805236 nucleoside diphosphate kinase, putative 0.686 0.669 0.797 5e-65
18416233237 nucleoside diphosphate kinase IV [Arabid 0.695 0.675 0.734 6e-63
224058260237 predicted protein [Populus trichocarpa] 0.691 0.670 0.791 1e-62
224072202236 predicted protein [Populus trichocarpa] 0.691 0.673 0.796 3e-62
21593387237 nucleoside diphosphate kinase 3 (ndpk3) 0.695 0.675 0.728 8e-62
147864944235 hypothetical protein VITISV_041718 [Viti 0.686 0.672 0.783 6e-61
15237018238 nucleoside diphosphate kinase III [Arabi 0.695 0.672 0.766 8e-61
19744167235 NDPK III [Brassica rapa] 0.686 0.672 0.771 1e-60
334186865 467 Pleckstrin homology (PH) domain-containi 0.669 0.329 0.730 2e-60
222424465238 AT4G11010 [Arabidopsis thaliana] 0.695 0.672 0.760 5e-60
>gi|255537805|ref|XP_002509969.1| nucleoside diphosphate kinase, putative [Ricinus communis] gi|223549868|gb|EEF51356.1| nucleoside diphosphate kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 130/163 (79%), Positives = 143/163 (87%), Gaps = 5/163 (3%)

Query: 1   MSSQIVRSASRAATARSLLSASKNSR-FYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSS 59
           MSSQI+RSASRAA  RSLLSASK S  FYSEGRAV  AAAV+ SGK  +L S+F + GSS
Sbjct: 1   MSSQIIRSASRAA--RSLLSASKTSSCFYSEGRAV--AAAVSLSGKASFLASAFRKTGSS 56

Query: 60  TASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 119
           T S  W+SGA+AIPAA Y LQEQE HAAEMERTFIAIKPDGVQRGLI+EI++RFERKGFK
Sbjct: 57  TVSAQWISGALAIPAAVYMLQEQEAHAAEMERTFIAIKPDGVQRGLIAEIVARFERKGFK 116

Query: 120 LVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMV 162
           LV IK+VVPSKEFAQKHYHDLKERPFF+GLC+FLSSGPVIAMV
Sbjct: 117 LVGIKVVVPSKEFAQKHYHDLKERPFFSGLCDFLSSGPVIAMV 159

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|18416233|ref|NP_567690.1| nucleoside diphosphate kinase IV [Arabidopsis thaliana] gi|45477149|sp|Q8LAH8.2|NDK4_ARATH RecName: Full=Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial; Short=NDK IV; Short=NDP kinase IV; Short=NDPK IV; AltName: Full=Nucleoside diphosphate kinase 4; Flags: Precursor gi|4972094|emb|CAB43890.1| hypothetical protein [Arabidopsis thaliana] gi|7269239|emb|CAB81308.1| hypothetical protein [Arabidopsis thaliana] gi|11990430|dbj|BAB19789.1| nucleoside diphosphate kinase 4 [Arabidopsis thaliana] gi|26450853|dbj|BAC42534.1| unknown protein [Arabidopsis thaliana] gi|105829662|gb|ABF74700.1| At4g23900 [Arabidopsis thaliana] gi|332659424|gb|AEE84824.1| nucleoside diphosphate kinase IV [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224058260|ref|XP_002299472.1| predicted protein [Populus trichocarpa] gi|222846730|gb|EEE84277.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224072202|ref|XP_002303650.1| predicted protein [Populus trichocarpa] gi|118486199|gb|ABK94942.1| unknown [Populus trichocarpa] gi|222841082|gb|EEE78629.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|21593387|gb|AAM65336.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147864944|emb|CAN83625.1| hypothetical protein VITISV_041718 [Vitis vinifera] gi|297742339|emb|CBI34488.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15237018|ref|NP_192839.1| nucleoside diphosphate kinase III [Arabidopsis thaliana] gi|6225753|sp|O49203.1|NDK3_ARATH RecName: Full=Nucleoside diphosphate kinase III, chloroplastic/mitochondrial; Short=NDK III; Short=NDP kinase III; Short=NDPK III; Flags: Precursor gi|2829275|gb|AAC00512.1| nucleoside diphosphate kinase 3 [Arabidopsis thaliana] gi|3513740|gb|AAC33956.1| contains similarity to nucleoside diphosphate kinases (Pfam: NDK.hmm, score: 301.12) [Arabidopsis thaliana] gi|4539375|emb|CAB40069.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana] gi|7267799|emb|CAB81202.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana] gi|14334560|gb|AAK59688.1| putative nucleoside diphosphate kinase ndpk3 [Arabidopsis thaliana] gi|17065632|gb|AAL33810.1| putative nucleoside diphosphate kinase 3 [Arabidopsis thaliana] gi|332657561|gb|AEE82961.1| nucleoside diphosphate kinase III [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|19744167|dbj|BAB86842.1| NDPK III [Brassica rapa] Back     alignment and taxonomy information
>gi|334186865|ref|NP_001190817.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659423|gb|AEE84823.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|222424465|dbj|BAH20188.1| AT4G11010 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
TAIR|locus:2123421238 NDPK3 "nucleoside diphosphate 0.695 0.672 0.705 2e-56
TAIR|locus:2138101237 AT4G23900 [Arabidopsis thalian 0.695 0.675 0.660 3.8e-53
UNIPROTKB|Q32Q12292 NME1-NME2 "Nucleoside diphosph 0.330 0.260 0.657 2.9e-23
UNIPROTKB|P22392152 NME2 "Nucleoside diphosphate k 0.330 0.5 0.657 2.9e-23
MGI|MGI:97356152 Nme2 "NME/NM23 nucleoside diph 0.330 0.5 0.657 2.9e-23
RGD|619877152 Nme2 "NME/NM23 nucleoside diph 0.330 0.5 0.657 2.9e-23
UNIPROTKB|O57535153 O57535 "Nucleoside diphosphate 0.334 0.503 0.649 3.8e-23
UNIPROTKB|F1MPL4114 NME2 "Nucleoside diphosphate k 0.330 0.666 0.657 3.8e-23
UNIPROTKB|Q3T0Q4152 NME2 "Nucleoside diphosphate k 0.330 0.5 0.657 3.8e-23
UNIPROTKB|Q2EN76152 NME2 "Nucleoside diphosphate k 0.330 0.5 0.644 4.8e-23
TAIR|locus:2123421 NDPK3 "nucleoside diphosphate kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 581 (209.6 bits), Expect = 2.0e-56, P = 2.0e-56
 Identities = 115/163 (70%), Positives = 133/163 (81%)

Query:     1 MSSQIVXXXXXXXXXXXXXXXXKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRA-GSS 59
             MSSQI                 KN+RF+SEGRA+ AAAAV+ SGK+P   S+F R+ GS 
Sbjct:     1 MSSQICRSASKAAKSLLSSA--KNARFFSEGRAIGAAAAVSASGKIPLYASNFARSSGSG 58

Query:    60 TASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 119
              AS+SW++G +A+PAAAY +Q+QEV AAEMERTFIAIKPDGVQRGLISEIISRFERKGFK
Sbjct:    59 VASKSWITGLLALPAAAYMIQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 118

Query:   120 LVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMV 162
             LV IK++VPSK+FAQKHYHDLKERPFFNGLC+FLSSGPVIAMV
Sbjct:   119 LVGIKVIVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMV 161
GO:0004550 "nucleoside diphosphate kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=IEA
GO:0006183 "GTP biosynthetic process" evidence=IEA
GO:0006228 "UTP biosynthetic process" evidence=IEA
GO:0006241 "CTP biosynthetic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0005743 "mitochondrial inner membrane" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IDA
GO:0009536 "plastid" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0019932 "second-messenger-mediated signaling" evidence=RCA
TAIR|locus:2138101 AT4G23900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q32Q12 NME1-NME2 "Nucleoside diphosphate kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P22392 NME2 "Nucleoside diphosphate kinase B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97356 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619877 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O57535 O57535 "Nucleoside diphosphate kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPL4 NME2 "Nucleoside diphosphate kinase B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0Q4 NME2 "Nucleoside diphosphate kinase B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2EN76 NME2 "Nucleoside diphosphate kinase B" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q46I11NDK_PROMT2, ., 7, ., 4, ., 60.70270.32170.4900yesno
Q7VEG3NDK_PROMA2, ., 7, ., 4, ., 60.70270.32170.4900yesno
A5GPE9NDK_SYNPW2, ., 7, ., 4, ., 60.71230.31730.4802yesno
Q8LAH8NDK4_ARATH2, ., 7, ., 4, ., 60.73450.69560.6751yesno
Q8RXA8NDK4_SPIOL2, ., 7, ., 4, ., 60.72560.67820.6638N/Ano
A3PA97NDK_PROM02, ., 7, ., 4, ., 60.71230.31730.4802yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.963
4th Layer2.7.4.60.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
NDK4
nucleoside diphosphate kinase 4 (NDK4); nucleoside diphosphate kinase 4 (NDK4); FUNCTIONS IN- nucleoside diphosphate kinase activity, ATP binding; INVOLVED IN- UTP biosynthetic process, GTP biosynthetic process, CTP biosynthetic process; LOCATED IN- mitochondrion; EXPRESSED IN- 24 plant structures; EXPRESSED DURING- 15 growth stages; CONTAINS InterPro DOMAIN/s- Nucleoside diphosphate kinase, core (InterPro-IPR001564); BEST Arabidopsis thaliana protein match is- NDPK3 (NUCLEOSIDE DIPHOSPHATE KINASE 3); ATP binding / nucleoside diphosphate kinase (TAIR-AT4G11010.1); Has 6327 Blast hits t [...] (237 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT3G18680
aspartate/glutamate/uridylate kinase family protein; aspartate/glutamate/uridylate kinase famil [...] (339 aa)
     •• 0.958
RNR1
RNR1 (RIBONUCLEOTIDE REDUCTASE 1); ATP binding / protein binding / ribonucleoside-diphosphate r [...] (816 aa)
     •• 0.950
ZEU1
ZEU1 (ZEUS1); ATP binding / thymidylate kinase; Encodes thymidylate kinase which exists in two [...] (271 aa)
   • •• 0.947
AT5G66005
Expressed protein; Expressed protein; FUNCTIONS IN- nucleoside-triphosphatase activity, transfe [...] (192 aa)
     •• 0.943
AT3G46940
deoxyuridine 5'-triphosphate nucleotidohydrolase family; deoxyuridine 5'-triphosphate nucleotid [...] (166 aa)
     •• 0.939
AT5G50370
adenylate kinase, putative; adenylate kinase, putative; FUNCTIONS IN- nucleobase, nucleoside, n [...] (248 aa)
     •• 0.932
AT4G02120
CTP synthase, putative / UTP--ammonia ligase, putative; CTP synthase, putative / UTP--ammonia l [...] (556 aa)
     •• 0.924
emb2742
emb2742 (embryo defective 2742); CTP synthase/ catalytic; embryo defective 2742 (emb2742); FUNC [...] (591 aa)
     •• 0.922
AT4G20320
CTP synthase/ catalytic; CTP synthase/ catalytic; FUNCTIONS IN- CTP synthase activity, catalyti [...] (597 aa)
     •• 0.922
AT3G06200
guanylate kinase, putative; guanylate kinase, putative; FUNCTIONS IN- guanylate kinase activity [...] (282 aa)
     •• 0.922

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 1e-100
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 2e-44
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 9e-43
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 6e-42
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 2e-40
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 5e-40
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 2e-38
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 1e-28
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 8e-25
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 2e-17
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 2e-17
PRK14543169 PRK14543, PRK14543, nucleoside diphosphate kinase; 5e-16
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 6e-16
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 8e-14
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 1e-13
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 1e-09
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 5e-09
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 4e-08
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 5e-08
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 1e-07
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information 
 Score =  290 bits (743), Expect = e-100
 Identities = 135/163 (82%), Positives = 147/163 (90%), Gaps = 3/163 (1%)

Query: 1   MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRA-GSS 59
           MSSQI RSASRAA  RSLLS++KN+ F SEGRAV+AAAAV+  GK P L S+FGRA GSS
Sbjct: 1   MSSQICRSASRAA--RSLLSSAKNASFLSEGRAVAAAAAVSAGGKPPLLASAFGRATGSS 58

Query: 60  TASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 119
           TAS  W+SGA+A+PAA Y LQEQE HAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK
Sbjct: 59  TASAQWISGALALPAAVYMLQEQEAHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 118

Query: 120 LVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMV 162
           LVAIK+VVPSKEFAQKHYHDLKERPFFNGLC+FLSSGPV+AMV
Sbjct: 119 LVAIKVVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVVAMV 161

Length = 238
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
PLN02619238 nucleoside-diphosphate kinase 100.0
PRK14542137 nucleoside diphosphate kinase; Provisional 100.0
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 100.0
PRK14541140 nucleoside diphosphate kinase; Provisional 100.0
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 100.0
PRK14540134 nucleoside diphosphate kinase; Provisional 100.0
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 100.0
PRK14545139 nucleoside diphosphate kinase; Provisional 100.0
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 100.0
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 100.0
PLN02931177 nucleoside diphosphate kinase family protein 100.0
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 100.0
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 100.0
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 100.0
PRK14543169 nucleoside diphosphate kinase; Provisional 100.0
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 100.0
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 100.0
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 100.0
PRK14544183 nucleoside diphosphate kinase; Provisional 100.0
KOG0888156 consensus Nucleoside diphosphate kinase [Nucleotid 100.0
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information 
Probab=100.00  E-value=3.8e-64  Score=443.72  Aligned_cols=210  Identities=69%  Similarity=0.928  Sum_probs=201.0

Q ss_pred             CchHHHHHhhhHHHHHhhhhhcccccccccchhhhhhhhhhccCCccchhhhccc-cCCccchhhhhhhhhhhhhHhhhh
Q 026953            1 MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGR-AGSSTASRSWLSGAIAIPAAAYTL   79 (230)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~   79 (230)
                      |+|||||+++|+  ||++|+++++++|+.+||++++++++++++|.|+++|+|++ +++++++++|+++++++|||+||+
T Consensus         1 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   78 (238)
T PLN02619          1 MSSQICRSASRA--ARSLLSSAKNASFLSEGRAVAAAAAVSAGGKPPLLASAFGRATGSSTASAQWISGALALPAAVYML   78 (238)
T ss_pred             CchHHHHHHHHH--HHHHHHHHhhhhhhhcchHHHHHHHHHcCCCCchHHHHHHhhcCCCchHHHHHHHhhcchhhhhhc
Confidence            899999999999  99999999999999999999999999999999999999988 899999999999999999999999


Q ss_pred             hhhhhhhhccceeEEEEcCccccCCcHHHHHHHHHHcCCeEEEEEeeCCCHHHHHhHHHHhcCCCChHHHHHHhccCcEE
Q 026953           80 QEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVI  159 (230)
Q Consensus        80 ~~~~~l~~~~E~TLaIIKPdav~~g~vGeII~~I~~~Gf~I~~~K~~~Ls~e~A~eFY~~~~gkpff~~LV~~MtSGPvv  159 (230)
                      |+|+.++..+|+||+|||||++++|++|+||++|+++||+|+++||++||++++++||.+|+|+|||++|++||+|||++
T Consensus        79 ~~~~~~a~~~ErTlaiIKPDaV~rglvGeII~rIe~~Gf~Iva~Kmv~Lt~e~AeefY~ehkgKpFf~~Lv~fMtSGPvv  158 (238)
T PLN02619         79 QEQEAHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKVVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVV  158 (238)
T ss_pred             cccccccchhceEEEEECcchhhcCchHHHHHHHHHCCCEEEehhhccCCHHHHHHHHHHhcCCCcHHHHHHHHhcCCeE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeecccccchhhhhhhccCc---CCCCc-ccccccCCcCccccccCCChhchHhhhc
Q 026953          160 AMVGISTLYYLFDINLFSLLKHST---FAGMG-RRGSYYVWSQTHWSHRSSEIRTWNNQRR  216 (230)
Q Consensus       160 ALvL~g~~n~l~~~~~~r~~~gp~---l~gPs-LRA~FG~d~~rNaVHgSDs~Eda~~~r~  216 (230)
                      +|+|.|+ |+   +..||.++||+   ...|+ ||++||++.++|+|||||++|++++|.+
T Consensus       159 amvL~Ge-na---V~~~R~LiGpTdP~~A~PgTIRg~fG~~~~rNaVHgSDS~EsA~rEI~  215 (238)
T PLN02619        159 AMVWEGE-GV---IKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIN  215 (238)
T ss_pred             EEEEECC-cH---HHHHHHHhCCCCccccCCCcchhhhcccccceeeecCCCHHHHHHHHH
Confidence            9999996 55   56678888887   45687 9999999999999999999999999974

>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>KOG0888 consensus Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 8e-37
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 8e-26
3bbc_A151 Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra 3e-25
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 3e-25
1nue_A151 X-ray Structure Of Nm23 Human Nucleoside Diphosphat 4e-25
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 6e-25
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 2e-24
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 2e-24
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 2e-24
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 2e-24
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 2e-24
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 2e-24
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 2e-24
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 2e-24
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 2e-24
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 2e-24
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 2e-24
1nsq_A153 Mechanism Of Phosphate Transfer By Nucleoside Dipho 3e-24
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 3e-24
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 3e-24
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 4e-24
2hve_A152 S120g Mutant Of Human Nucleoside Diphosphate Kinase 4e-24
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 1e-23
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 1e-23
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 1e-23
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-23
1ucn_A152 X-Ray Structure Of Human Nucleoside Diphosphate Kin 2e-23
1zs6_A169 Structure Of Human Nucleoside-diphosphate Kinase 3 5e-23
4fkx_A161 Crystal Structure Of Nucleoside Diphosphate Kinase 9e-23
4f36_A157 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-22
3prv_A157 Nucleoside Diphosphate Kinase B From Trypanosoma Cr 1e-22
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-22
1xiq_A157 Plasmodium Falciparum Nucleoside Diphosphate Kinase 2e-22
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-22
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 5e-22
3js9_A156 Crystal Structure Of Nucleoside Diphosphate Kinase 4e-21
1s57_A153 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-20
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 2e-20
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 4e-20
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 5e-20
1ehw_A162 Human Nucleoside Diphosphate Kinase 4 Length = 162 5e-20
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 6e-20
2cwk_A160 Crystal Structure Of Nucleotide Diphosphate Kinase 2e-19
3q83_A157 Crystal Structure Of Staphylococcus Aureus Nucleosi 1e-18
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 9e-18
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-16
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 6e-15
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 7e-15
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 9e-15
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 1e-14
3em1_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do 5e-14
3ddi_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 5e-14
3fbf_A142 Crystal Structure Of The Mimivirus Ndk N62l Mutant 6e-14
3fbe_A142 Crystal Structure Of The Mimivirus Ndk N62l-R107g D 6e-14
1nb2_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-13
2b8p_A157 Crystal Structure Of Acanthamoeba Polyphaga Mimivir 3e-13
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 3e-13
3ejm_A146 Crystal Structure Of The Mimivirus Ndk +kpn Mutant 4e-13
3emt_A146 Crystal Structure Of The Mimivirus Ndk +kpn-R107g D 4e-13
2b8q_A142 X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus 4e-13
3evw_A142 Crystal Structure Of The Mimivirus Ndk R107g Mutant 4e-13
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 6e-13
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 2e-12
4di6_A190 Crystal Structure Of Nucleoside-Diphosphate Kinase 4e-12
1xqi_A195 Crystal Structure Analysis Of An Ndp Kinase From Py 7e-08
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (378), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 75/76 (98%)
Query: 87  AEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFF 146
           AE+ERTFIAIKPDGVQRGLISEIISRFERKGFKLV IK+++P+K+FAQ+HYHDLKERPFF
Sbjct: 30  AELERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFF 89
Query: 147 NGLCEFLSSGPVIAMV 162
           NGLC+FLSSGPVIAMV
Sbjct: 90  NGLCDFLSSGPVIAMV 105
>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 Back     alignment and structure
>pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
>pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
>pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 Back     alignment and structure
>pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure
>pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure
>pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 Back     alignment and structure
>pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
>pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 Back     alignment and structure
>pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 Back     alignment and structure
>pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 Back     alignment and structure
>pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 Back     alignment and structure
>pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 Back     alignment and structure
>pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure
>pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 Back     alignment and structure
>pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 Back     alignment and structure
>pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 Back     alignment and structure
>pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
>pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 Back     alignment and structure
>pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
>pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 Back     alignment and structure
>pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 Back     alignment and structure
>pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 Back     alignment and structure
>pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 Back     alignment and structure
>pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 Back     alignment and structure
>pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 Back     alignment and structure
>pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 Back     alignment and structure
>pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure
>pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 Back     alignment and structure
>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 5e-49
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 9e-49
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 1e-48
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 1e-48
3js9_A156 Nucleoside diphosphate kinase family protein; niai 2e-48
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 2e-48
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 4e-48
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 5e-48
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 6e-48
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 6e-48
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 7e-48
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 7e-48
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 1e-47
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 1e-47
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 1e-47
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 1e-47
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 1e-47
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 2e-47
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 2e-47
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 2e-47
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 2e-47
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 2e-47
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 4e-47
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 6e-47
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 6e-47
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 8e-47
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 3e-46
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 3e-44
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 2e-36
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
 Score =  157 bits (400), Expect = 5e-49
 Identities = 69/102 (67%), Positives = 77/102 (75%), Gaps = 1/102 (0%)

Query: 62  SRSWLSGAIAIPA-AAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKL 120
                      P       Q      AE+ERTFIAIKPDGVQRGLISEIISRFERKGFKL
Sbjct: 4   YHHHHHHDYDYPTTENLYFQGAMDPEAELERTFIAIKPDGVQRGLISEIISRFERKGFKL 63

Query: 121 VAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMV 162
           V IK+++P+K+FAQ+HYHDLKERPFFNGLC+FLSSGPVIAMV
Sbjct: 64  VGIKVLIPTKQFAQQHYHDLKERPFFNGLCDFLSSGPVIAMV 105
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 100.0
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niai 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 100.0
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 100.0
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.93
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
Probab=100.00  E-value=7e-43  Score=288.13  Aligned_cols=125  Identities=35%  Similarity=0.411  Sum_probs=117.6

Q ss_pred             ccceeEEEEcCccccCCcHHHHHHHHHHcCCeEEEEEeeCCCHHHHHhHHHHhcCCCChHHHHHHhccCcEEEEEEEeec
Q 026953           88 EMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTL  167 (230)
Q Consensus        88 ~~E~TLaIIKPdav~~g~vGeII~~I~~~Gf~I~~~K~~~Ls~e~A~eFY~~~~gkpff~~LV~~MtSGPvvALvL~g~~  167 (230)
                      .+|+||+|||||+|++|++|+||++|+++||+|+++|+++||+++|++||.+|+|+|||++||+||+||||++|+|.|+ 
T Consensus         6 ~~ErTl~iIKPDav~~~l~g~Ii~rie~~Gf~I~~~k~~~lt~e~a~~fY~~h~~kpff~~Lv~~mtSGPvva~vleg~-   84 (145)
T 4hr2_A            6 ALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGE-   84 (145)
T ss_dssp             CEEEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEEEE-
T ss_pred             hHHHeEEEEChHHhhcCCHHHHHHHHHHCCCEEEEEeeecCCHHHHHHHHHHHhcCchHHHHHHHhcCCCEEEEEEEcC-
Confidence            5799999999999999999999999999999999999999999999999999999999999999999999999999997 


Q ss_pred             ccccchhhhhhhccCc---CCCCc-ccccccCCcCccccccCCChhchHhhhc
Q 026953          168 YYLFDINLFSLLKHST---FAGMG-RRGSYYVWSQTHWSHRSSEIRTWNNQRR  216 (230)
Q Consensus       168 n~l~~~~~~r~~~gp~---l~gPs-LRA~FG~d~~rNaVHgSDs~Eda~~~r~  216 (230)
                      |+   +..||.++||+   .+.|+ ||++||+|.++|+|||||++|+|++|..
T Consensus        85 ~a---V~~~R~l~G~tdp~~A~pgtIR~~fg~~~~~N~vHgSDs~e~A~rEi~  134 (145)
T 4hr2_A           85 DA---ILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIA  134 (145)
T ss_dssp             TH---HHHHHHHHCCSSTTTSCTTSHHHHHCSBTTBCSEEECCSHHHHHHHHH
T ss_pred             Cc---HhHHhhccCCCCcccCCCCCcHHHhcCCcCccceECCCCHHHHHHHHH
Confidence            55   56677888887   57788 9999999999999999999999999973
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-30
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-29
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 3e-29
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 5e-29
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 7e-29
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 3e-28
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 3e-28
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 4e-28
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-26
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 6e-26
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 6e-26
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-25
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 8e-24
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-23
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-23
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 7e-21
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]

 Score =  108 bits (271), Expect = 1e-30
 Identities = 47/120 (39%), Positives = 68/120 (56%), Gaps = 2/120 (1%)

Query: 87  AEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFF 146
            ++E T+I +KPDG+QRGL+ EIISRFE+KGFKL+ +K+    KE A++HY DL  + FF
Sbjct: 3   EDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFF 62

Query: 147 NGLCEFLSSGPVIAMVGISTLYYLFDINLFSLLKHSTFAGMGR-RGSYYVWSQTHWSHRS 205
             L E+++SGPV+ M     +  +              A  G  RG   V +  +  H S
Sbjct: 63  PNLIEYITSGPVVCMA-WEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGS 121
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 100.0
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 100.0
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 100.0
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens), NDK4 [TaxId: 9606]

Probab=100.00  E-value=5.7e-42  Score=279.62  Aligned_cols=125  Identities=36%  Similarity=0.614  Sum_probs=118.0

Q ss_pred             ccceeEEEEcCccccCCcHHHHHHHHHHcCCeEEEEEeeCCCHHHHHhHHHHhcCCCChHHHHHHhccCcEEEEEEEeec
Q 026953           88 EMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVGISTL  167 (230)
Q Consensus        88 ~~E~TLaIIKPdav~~g~vGeII~~I~~~Gf~I~~~K~~~Ls~e~A~eFY~~~~gkpff~~LV~~MtSGPvvALvL~g~~  167 (230)
                      .+|+||+|||||+++++++|+||++|+++||+|+++|+++||+++|++||.+|+|+|||++|++||+||||++|+|.|+ 
T Consensus         4 ~~E~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~Iv~~k~~~lt~e~a~~~Y~~~~~k~f~~~lv~~m~sGp~~a~~l~g~-   82 (143)
T d1ehwa_           4 TRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGY-   82 (143)
T ss_dssp             GGCEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEEST-
T ss_pred             ccceEEEEECchhhhcCCHHHHHHHHHHcCCEEeeeeeeecCHHHHHHHHHHHhcchhhhhhhheecCCCEEEEecchh-
Confidence            5799999999999999999999999999999999999999999999999999999999999999999999999999996 


Q ss_pred             ccccchhhhhhhccCc---CCCCc-ccccccCCcCccccccCCChhchHhhhc
Q 026953          168 YYLFDINLFSLLKHST---FAGMG-RRGSYYVWSQTHWSHRSSEIRTWNNQRR  216 (230)
Q Consensus       168 n~l~~~~~~r~~~gp~---l~gPs-LRA~FG~d~~rNaVHgSDs~Eda~~~r~  216 (230)
                      |+   +..||.++||+   .+.|+ ||++||+|.++|+|||||++|+|++|.+
T Consensus        83 na---V~~~R~l~Gpt~p~~a~p~siR~~yg~~~~~N~vH~Sds~e~A~~Ei~  132 (143)
T d1ehwa_          83 NV---VRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQ  132 (143)
T ss_dssp             TH---HHHHHHHHCCSSGGGSCTTSHHHHHCCCSSCCSEEECSSHHHHHHHHH
T ss_pred             hH---HHHHHHHhcCCCcccCCCCCcHhhhhCcccCCCeECCCCHHHHHHHHH
Confidence            54   66788889987   56787 9999999999999999999999999974
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure