Citrus Sinensis ID: 027131


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MSLLRNAIKSSVSLRTIKPIHSLPSLLRQSPKHFSTETEAPPPPPPNDASIDLFLQTPTKGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAYDNAFRLIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVLQ
cHHHHHHHHHccEEEEEccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHcccccccccEEEEEcccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEEccccccEEccccccEEEEEEcccccccHHHHHHHHccccccccccEEEEccccccccEEEEEEEccHHHHHHHHHHHcccccccccEEEEEcc
ccHHHHHHHccccHHccccccccHHHHccccccccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHccccccHHHEEEEcccccccHHHHHccccHHHHHHHHHHHHHcccEEEEEEccHHHccccccccccEEEEEcccccccHHHHHHHHccccccccccEEEEcccccccEEEEEEEcccHHHHHHHHHHHcccccccccEEEEEEc
MSLLRNAIKssvslrtikpihslpsllrqspkhfsteteappppppndasidlflqtptkgvfygklLGISRQTLKSDIINLlegcnltpddlkvnytRNYMPfammmqfpsfsayDNAFRLIGRKGRLYRLERaeqsewdivmpyngktvllqnvpriavAEDVERFLSGCEYEASSISFMLRQslpdsikwatvrfpsqTQAMDAFIRKnrgfclnnQVSVRVLQ
MSLLRNAIkssvslrtikpihslpsllrqSPKHFSTETEAPPPPPPNDASIDLFLQTPTKGVFYGKLLGISRQTLKSDIINLLegcnltpddlkVNYTRNYMPFAMMMQFPSFSAYDNAFRLIGRKGRLYRLERAeqsewdivmpynGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRknrgfclnnqvsvrvlq
MSLLRNAIKSSVSLRTIKPIHSLPSLLRQSPKHFSTETEAppppppNDASIDLFLQTPTKGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAYDNAFRLIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVLQ
**************************************************IDLFLQTPTKGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAYDNAFRLIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSV****
**************************************************************FYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAYDNAFRLIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVLQ
MSLLRNAIKSSVSLRTIKPIHSLPSLLRQSP*************PPNDASIDLFLQTPTKGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAYDNAFRLIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVLQ
*********SSVSLRTIKPIHSLPSLLRQSPKHF****E*************LFL*TPTKGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAYDNAFRLIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVLQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLRNAIKSSVSLRTIKPIHSLPSLLRQSPKHFSTETEAPPPPPPNDASIDLFLQTPTKGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAYDNAFRLIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
255568482221 conserved hypothetical protein [Ricinus 0.955 0.981 0.584 2e-66
297741512218 unnamed protein product [Vitis vinifera] 0.960 1.0 0.550 6e-65
359481534221 PREDICTED: uncharacterized protein LOC10 0.960 0.986 0.550 7e-65
449448687226 PREDICTED: uncharacterized protein LOC10 0.977 0.982 0.552 2e-63
388506092224 unknown [Lotus japonicus] gi|388519667|g 0.969 0.982 0.475 3e-54
38564731225 unknown [Helianthus annuus] 0.977 0.986 0.504 7e-52
297806205228 hypothetical protein ARALYDRAFT_487048 [ 0.986 0.982 0.497 1e-50
110738780228 hypothetical protein [Arabidopsis thalia 0.986 0.982 0.497 3e-50
18414012228 Ribosomal protein S24e family protein [A 0.986 0.982 0.493 7e-50
21553856228 unknown [Arabidopsis thaliana] 0.986 0.982 0.484 3e-49
>gi|255568482|ref|XP_002525215.1| conserved hypothetical protein [Ricinus communis] gi|223535512|gb|EEF37181.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 173/226 (76%), Gaps = 9/226 (3%)

Query: 3   LLRNAIKSSVSLRTIKPIHSLPSLLRQSPKHFSTETEAPPPPPPNDASIDLFLQTPTKGV 62
           LLRNAIKS+ +L   KP ++L    RQS + FST    PP    + + ID FLQT  +GV
Sbjct: 4   LLRNAIKSNFAL---KPFNAL----RQSSQLFSTLPPPPPHHQDDPSPIDPFLQTAGQGV 56

Query: 63  FYGKLLGISRQTLKSDIINLL-EGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAYDNAFR 121
            YGKL GI+R TLK+D+INLL EGC LTPDD+K+ Y  +Y P A+M+QFP+  A+DNAF+
Sbjct: 57  VYGKLFGITRHTLKTDVINLLGEGCQLTPDDIKLTYA-SYDPVAVMIQFPTRQAFDNAFK 115

Query: 122 LIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISF 181
            IG+KGRL+RLERA++S+WD +MPY+GKTVLLQ +P  A  EDVERFLSGCE+++SSI  
Sbjct: 116 TIGKKGRLHRLERADRSQWDYIMPYDGKTVLLQGIPEYAAPEDVERFLSGCEFDSSSIRL 175

Query: 182 MLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVLQ 227
             RQS+P++I+ A VRF ++T AM+AFI KN+GFC NN++S+RVLQ
Sbjct: 176 FRRQSVPEAIRVALVRFHTRTAAMNAFITKNQGFCSNNKISMRVLQ 221




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297741512|emb|CBI32644.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481534|ref|XP_002274013.2| PREDICTED: uncharacterized protein LOC100241364 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449448687|ref|XP_004142097.1| PREDICTED: uncharacterized protein LOC101220680 [Cucumis sativus] gi|449502590|ref|XP_004161686.1| PREDICTED: uncharacterized LOC101220680 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388506092|gb|AFK41112.1| unknown [Lotus japonicus] gi|388519667|gb|AFK47895.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|38564731|gb|AAR23805.1| unknown [Helianthus annuus] Back     alignment and taxonomy information
>gi|297806205|ref|XP_002870986.1| hypothetical protein ARALYDRAFT_487048 [Arabidopsis lyrata subsp. lyrata] gi|297316823|gb|EFH47245.1| hypothetical protein ARALYDRAFT_487048 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|110738780|dbj|BAF01313.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18414012|ref|NP_568106.1| Ribosomal protein S24e family protein [Arabidopsis thaliana] gi|117168203|gb|ABK32184.1| At5g02740 [Arabidopsis thaliana] gi|332003129|gb|AED90512.1| Ribosomal protein S24e family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21553856|gb|AAM62949.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
TAIR|locus:2151226228 AT5G02740 [Arabidopsis thalian 0.986 0.982 0.484 4.1e-49
TAIR|locus:2151226 AT5G02740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 512 (185.3 bits), Expect = 4.1e-49, P = 4.1e-49
 Identities = 112/231 (48%), Positives = 150/231 (64%)

Query:     1 MSLLRNAIKSSVSLRTIKPIHSLPSL--LRQSPKHFSTETEAXXXXXXNDASIDLFLQTP 58
             MS+ R+AI+SS+ LR + P  S  SL  L++  K  ST TE                 +P
Sbjct:     1 MSITRSAIRSSLCLRKLDPEISRSSLPFLQEWRKCLSTATEQPPPASPLPPPPG---GSP 57

Query:    59 TKGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTR--NYMPFAMMMQFPSFSAY 116
              +G FYGK  G S+  LK+DI+N+LEGC+LT DDLK NY R  N  P A+ +QFPS SAY
Sbjct:    58 GEGRFYGKFSGFSKHALKTDIMNVLEGCSLTSDDLKFNYPRGGNLTPAAVFVQFPSLSAY 117

Query:   117 DNAFRLIGRKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEA 176
             D A R I +KG+LYRLE+A +++WD ++PY GK V L  +P  A+ +D++RFLSGC Y  
Sbjct:   118 DKALRNIAKKGKLYRLEKAARAQWDPIVPYEGKVVALHGIPVNAITDDIDRFLSGCLYYP 177

Query:   177 SSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVLQ 227
              SI F+  Q L  S + A VRF SQTQAM+A+I KNR F LN +++++VLQ
Sbjct:   178 GSIQFLTVQGLGTSKRVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVLQ 228


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.322   0.135   0.390    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      227       221   0.00095  112 3  11 22  0.49    32
                                                     32  0.40    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  605 (64 KB)
  Total size of DFA:  168 KB (2099 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  19.03u 0.11s 19.14t   Elapsed:  00:00:00
  Total cpu time:  19.03u 0.11s 19.14t   Elapsed:  00:00:00
  Start:  Fri May 10 01:08:59 2013   End:  Fri May 10 01:08:59 2013


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 1e-04
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
 Score = 38.7 bits (91), Expect = 1e-04
 Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 2/75 (2%)

Query: 150 TVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFI 209
            V L+ +P  A  ED+  F SG +     I  ++          A V F S   A  A +
Sbjct: 1   VVRLRGLPFSATEEDIRDFFSGLDIPPDGI-HIVYDDDGRPTGEAYVEFASPEDARRA-L 58

Query: 210 RKNRGFCLNNQVSVR 224
           RK+        + V 
Sbjct: 59  RKHNNKMGGRYIEVF 73


The family includes RRM domains in the hnRNP H protein family, G-rich sequence factor 1 (GRSF-1), ESRPs (also termed RBM35), Drosophila Fusilli, RBM12 (also termed SWAN), RBM12B, RBM19 (also termed RBD-1) and similar proteins. The hnRNP H protein family includes hnRNP H (also termed mcs94-1), hnRNP H2 (also termed FTP-3 or hnRNP H'), hnRNP F and hnRNP H3 (also termed hnRNP 2H9), which represent a group of nuclear RNA binding proteins that are involved in pre-mRNA processing. GRSF-1 is a cytoplasmic poly(A)+ mRNA binding protein which interacts with RNA in a G-rich element-dependent manner. It may function in RNA packaging, stabilization of RNA secondary structure, or other macromolecular interactions. ESRP1 (also termed RBM35A) and ESRP2 (also termed RBM35B) are epithelial-specific RNA binding proteins that promote splicing of the epithelial variant of fibroblast growth factor receptor 2 (FGFR2), ENAH (also termed hMena), CD44 and CTNND1 (also termed p120-Catenin) transcripts. Fusilli shows high sequence homology to ESRPs. It can regulate endogenous FGFR2 splicing and functions as a splicing factor. The biological roles of both, RBM12 and RBM12B, remain unclear. RBM19 is a nucleolar protein conserved in eukaryotes. It is involved in ribosome biogenesis by processing rRNA. In addition, it is essential for preimplantation development. Members in this family contain 2~6 conserved RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). . Length = 73

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 227
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 100.0
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.96
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 99.93
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 99.9
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 99.78
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.75
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.72
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.71
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.67
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.65
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.64
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.62
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.61
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 99.61
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.5
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.49
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.46
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.4
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.38
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.37
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.28
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.26
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.12
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.12
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.01
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.0
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 98.91
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.88
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.85
smart0036071 RRM RNA recognition motif. 98.83
smart0036272 RRM_2 RNA recognition motif. 98.82
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.8
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.8
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 98.78
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 98.64
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.63
PLN03120 260 nucleic acid binding protein; Provisional 98.51
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.49
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.48
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 98.44
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.43
COG0724 306 RNA-binding proteins (RRM domain) [General functio 98.41
PLN03121 243 nucleic acid binding protein; Provisional 98.4
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.4
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.37
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.32
PLN03120260 nucleic acid binding protein; Provisional 98.28
smart0036272 RRM_2 RNA recognition motif. 98.21
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.2
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 98.18
smart0036071 RRM RNA recognition motif. 98.17
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.17
PLN03121243 nucleic acid binding protein; Provisional 98.12
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.97
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 97.91
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 97.88
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 97.8
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 97.79
smart0036170 RRM_1 RNA recognition motif. 97.74
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.73
KOG0533243 consensus RRM motif-containing protein [RNA proces 97.58
KOG0114124 consensus Predicted RNA-binding protein (RRM super 97.58
KOG0122270 consensus Translation initiation factor 3, subunit 97.57
KOG0110 725 consensus RNA-binding protein (RRM superfamily) [G 97.57
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.51
KOG0114124 consensus Predicted RNA-binding protein (RRM super 97.48
KOG0122270 consensus Translation initiation factor 3, subunit 97.36
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 97.29
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 97.17
KOG0107 195 consensus Alternative splicing factor SRp20/9G8 (R 97.12
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 97.08
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.07
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.07
KOG0121153 consensus Nuclear cap-binding protein complex, sub 97.01
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 96.91
KOG4207256 consensus Predicted splicing factor, SR protein su 96.88
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 96.86
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 96.81
KOG4207 256 consensus Predicted splicing factor, SR protein su 96.77
KOG0533243 consensus RRM motif-containing protein [RNA proces 96.73
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 96.7
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 96.63
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 96.6
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 96.5
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 96.44
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 96.4
PLN03213 759 repressor of silencing 3; Provisional 96.23
KOG4210285 consensus Nuclear localization sequence binding pr 96.21
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 96.18
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 96.16
KOG1457 284 consensus RNA binding protein (contains RRM repeat 95.97
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 95.97
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 95.81
smart0036170 RRM_1 RNA recognition motif. 95.65
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 95.54
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 95.49
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 95.32
KOG0121153 consensus Nuclear cap-binding protein complex, sub 95.32
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 95.26
KOG1548 382 consensus Transcription elongation factor TAT-SF1 95.26
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 95.21
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.06
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 95.04
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 95.02
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 95.0
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 94.99
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 94.7
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 94.7
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 94.66
PLN03213 759 repressor of silencing 3; Provisional 94.65
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 94.46
KOG0105 241 consensus Alternative splicing factor ASF/SF2 (RRM 94.24
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 93.81
KOG1995 351 consensus Conserved Zn-finger protein [General fun 93.65
KOG0106 216 consensus Alternative splicing factor SRp55/B52/SR 93.64
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 93.27
KOG4206 221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 93.18
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 93.12
KOG0153377 consensus Predicted RNA-binding protein (RRM super 92.92
KOG0126 219 consensus Predicted RNA-binding protein (RRM super 92.34
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 92.05
KOG0226290 consensus RNA-binding proteins [General function p 91.17
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 90.43
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 89.06
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 88.51
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 87.87
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 87.84
KOG0151 877 consensus Predicted splicing regulator, contains R 87.77
KOG0126219 consensus Predicted RNA-binding protein (RRM super 87.44
KOG1995 351 consensus Conserved Zn-finger protein [General fun 86.9
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 86.89
KOG2202 260 consensus U2 snRNP splicing factor, small subunit, 85.31
KOG2591 684 consensus c-Mpl binding protein, contains La domai 83.89
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 80.75
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=6e-41  Score=317.15  Aligned_cols=146  Identities=25%  Similarity=0.337  Sum_probs=131.8

Q ss_pred             eEEEEEeCCCCCCCHHHHHHhcCCCCCCCCCeEEEecC-CCCc-ceEEEEeCCHHHHHHHHH----HhCccceEEEEEEc
Q 027131           62 VFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTR-NYMP-FAMMMQFPSFSAYDNAFR----LIGRKGRLYRLERA  135 (227)
Q Consensus        62 ~~yv~lrgLP~s~~K~DI~~FF~g~~I~~d~I~~~ydr-~g~~-~eAfV~F~S~~d~~~AL~----~lg~~gRyv~i~~~  135 (227)
                      -++|+|||||||||.+||++||++|+|..    |++.| +|++ +||+|+|.|++||++||+    .||+  |||+|+.+
T Consensus        10 ~~~vr~rGLPwsat~~ei~~Ff~~~~I~~----~~~~r~~Gr~sGeA~Ve~~seedv~~AlkkdR~~mg~--RYIEVf~~   83 (510)
T KOG4211|consen   10 AFEVRLRGLPWSATEKEILDFFSNCGIEN----LEIPRRNGRPSGEAYVEFTSEEDVEKALKKDRESMGH--RYIEVFTA   83 (510)
T ss_pred             ceEEEecCCCccccHHHHHHHHhcCceeE----EEEeccCCCcCcceEEEeechHHHHHHHHhhHHHhCC--ceEEEEcc
Confidence            34599999999999999999999999987    88888 5885 699999999999999999    6778  99999999


Q ss_pred             ccccccccc-------CCCCcEEEEeccCCCCCHHHHHHccCCCcccCCceEEEeecCCCCcceeEEEEcCCHHHHHHHH
Q 027131          136 EQSEWDIVM-------PYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAF  208 (227)
Q Consensus       136 ~~~~~~~~~-------~~~g~~V~LrgLPf~~tkeEI~~FFsG~~i~p~~I~l~~d~~~g~ptGeA~V~F~S~e~A~~Al  208 (227)
                      +..++++..       +..+++|+||||||.||++||++||+||+|++++|.|++++++ +|||||+|+|+|+++|++||
T Consensus        84 ~~~e~d~~~~~~g~~s~~~d~vVRLRGLPfscte~dI~~FFaGL~Iv~~gi~l~~d~rg-R~tGEAfVqF~sqe~ae~Al  162 (510)
T KOG4211|consen   84 GGAEADWVMRPGGPNSSANDGVVRLRGLPFSCTEEDIVEFFAGLEIVPDGILLPMDQRG-RPTGEAFVQFESQESAEIAL  162 (510)
T ss_pred             CCccccccccCCCCCCCCCCceEEecCCCccCcHHHHHHHhcCCcccccceeeeccCCC-CcccceEEEecCHHHHHHHH
Confidence            988755432       1246799999999999999999999999999999999999995 89999999999999999999


Q ss_pred             HHhcCc
Q 027131          209 IRKNRG  214 (227)
Q Consensus       209 ~~~n~r  214 (227)
                      .+++.+
T Consensus       163 ~rhre~  168 (510)
T KOG4211|consen  163 GRHREN  168 (510)
T ss_pred             HHHHHh
Confidence            988765



>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.88
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.88
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.87
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.86
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.86
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.85
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.85
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.83
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.83
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.83
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.82
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.82
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.81
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.8
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.78
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.77
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.74
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.72
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.71
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.67
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.51
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.5
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.46
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.46
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.46
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.44
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.43
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.41
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.4
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.4
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.39
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.39
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.39
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.38
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.38
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.35
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.35
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.32
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.32
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.31
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.31
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.3
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.29
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.29
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.28
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.28
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.28
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.27
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.26
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.25
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.24
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.22
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.22
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.22
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.21
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.21
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.21
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.19
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.18
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.18
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.17
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.17
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.17
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.17
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.16
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.16
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.16
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.15
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.15
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.15
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.15
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.15
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.14
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.14
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.13
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.13
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.12
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.12
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.11
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.11
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.11
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.11
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.11
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.1
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.1
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.1
2div_A99 TRNA selenocysteine associated protein; structural 99.1
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.1
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.1
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.09
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.09
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.09
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.08
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.07
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.07
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.07
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.06
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.06
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.06
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.06
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.06
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.06
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.05
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.05
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.05
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.04
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.04
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.04
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.04
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.03
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.03
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.02
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.02
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.02
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.02
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.02
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.02
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.01
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.01
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.0
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.0
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.0
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.0
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.99
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.99
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.99
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.98
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.98
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.97
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.97
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.96
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.95
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.95
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.95
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.94
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.93
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.93
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.93
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.92
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.92
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.92
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.91
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.91
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.91
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.91
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.91
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.91
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.9
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.9
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.89
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.89
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.41
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 98.88
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.87
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.87
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.87
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.87
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.87
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.87
2dis_A109 Unnamed protein product; structural genomics, RRM 98.86
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.86
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.86
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.85
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.85
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.85
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.85
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.85
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.85
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.85
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.85
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.84
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.83
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.82
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.81
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.81
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.81
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.81
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.81
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.81
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.81
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.8
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.8
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.8
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.8
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.8
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.79
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.79
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.79
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.79
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.79
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.79
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.78
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.78
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.78
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.78
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.78
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.78
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.77
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.77
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.77
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.77
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.77
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.76
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.76
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.76
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.76
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.75
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.75
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.75
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.74
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.74
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.74
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.74
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.74
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.74
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.74
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.74
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.73
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.73
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.73
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.73
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.73
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.72
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.72
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.71
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.71
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.71
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.69
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.69
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.69
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.68
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.68
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.68
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.67
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.67
2div_A99 TRNA selenocysteine associated protein; structural 98.67
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.67
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.66
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.66
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.66
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.66
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.66
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.65
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.65
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.65
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.65
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.64
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.64
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.64
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.64
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.63
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.63
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.63
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.62
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.62
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.62
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.62
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.61
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.61
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.61
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.6
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.59
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.59
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.59
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.59
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.59
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.58
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.58
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.57
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.56
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.55
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.55
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.55
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.55
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.55
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.55
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.54
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.53
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.53
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 98.53
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.52
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.51
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.51
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.51
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.49
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.49
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.49
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.48
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.48
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.47
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.47
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.46
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.46
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.46
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.46
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.45
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.45
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.45
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.44
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.43
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.43
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.43
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.42
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.41
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.41
2dis_A109 Unnamed protein product; structural genomics, RRM 98.41
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.4
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.39
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.38
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.37
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.36
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.36
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.35
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.35
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.33
1x5p_A97 Negative elongation factor E; structure genomics, 98.33
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.32
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.32
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.32
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.65
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.31
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.29
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.28
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.28
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.24
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.23
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.21
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.2
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.18
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.18
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.18
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.18
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.17
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.15
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.14
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.14
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.12
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.11
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.1
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.1
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.06
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.01
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.0
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.0
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 97.99
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 97.99
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 97.99
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 97.96
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 97.93
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 97.88
1x5p_A97 Negative elongation factor E; structure genomics, 97.83
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 97.82
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 97.67
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 97.67
2dit_A112 HIV TAT specific factor 1 variant; structural geno 97.55
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 97.51
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 97.42
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 97.41
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 97.38
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 97.25
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 97.16
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.02
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 96.98
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 96.97
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.68
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 96.59
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 96.55
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 96.41
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 96.29
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 95.94
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 95.32
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 95.18
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 93.78
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 93.53
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 93.48
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 92.66
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 91.84
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 91.41
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 91.04
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 90.71
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 90.63
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 90.39
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 86.38
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 82.13
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 81.33
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.88  E-value=1.4e-21  Score=153.40  Aligned_cols=157  Identities=11%  Similarity=0.049  Sum_probs=126.9

Q ss_pred             EEEeCCCCCCCHHHHHHhcCCCCCCCCCeEEEecCCCCc-ceEEEEeCCHHHHHHHHHHh-C--ccceEEEEEEcccccc
Q 027131           65 GKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMP-FAMMMQFPSFSAYDNAFRLI-G--RKGRLYRLERAEQSEW  140 (227)
Q Consensus        65 v~lrgLP~s~~K~DI~~FF~g~~I~~d~I~~~ydr~g~~-~eAfV~F~S~~d~~~AL~~l-g--~~gRyv~i~~~~~~~~  140 (227)
                      +++.|||++++++||.++|+.+. ....|++..++++.. +.|||+|.+.+++.+|++.+ |  ..|+.+.+........
T Consensus         3 l~V~nlp~~~t~~~l~~~f~~~G-~i~~v~i~~~~~~~~~g~afV~f~~~~~a~~A~~~l~~~~~~g~~i~v~~~~~~~~   81 (166)
T 3md3_A            3 LYVGNLDKAITEDILKQYFQVGG-PIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQ   81 (166)
T ss_dssp             EEEEEEETTCCHHHHHHHHGGGS-CEEEEEEECCCC-CCEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCCCCC
T ss_pred             EEECCCCCcCCHHHHHHHHHhcC-CeEEEEEEECCCCCCCCEEEEEeCCHHHHHHHHHHcCCCccCCCeeEEEEcCCCCC
Confidence            68999999999999999999886 456788988886665 68999999999999999743 4  4456666655432221


Q ss_pred             ccccCCCCcEEEEeccCCCCCHHHHHHccCCCcccCCceEEEeecCCCCcceeEEEEcCCHHHHHHHHHHhcCcccCCce
Q 027131          141 DIVMPYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQ  220 (227)
Q Consensus       141 ~~~~~~~g~~V~LrgLPf~~tkeEI~~FFsG~~i~p~~I~l~~d~~~g~ptGeA~V~F~S~e~A~~Al~~~n~rf~gn~~  220 (227)
                        .......+|++.|||+++|.+||.++|+.|.-+ ..+.+..+...|++.|.|+|+|.+.++|.+|+...|+..++.++
T Consensus        82 --~~~~~~~~l~v~nl~~~~t~~~l~~~f~~~G~i-~~~~i~~~~~~~~~~g~afV~f~~~~~A~~A~~~l~g~~~~g~~  158 (166)
T 3md3_A           82 --SSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSY-LSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRP  158 (166)
T ss_dssp             --CCCTTCEEEEEESCCTTCCHHHHHHHHTTSTTE-EEEEEEECTTTCCEEEEEEEEESCHHHHHHHHHHHTTCEETTEE
T ss_pred             --CCCCCCceEEECCCCCCCCHHHHHHHHhccCCe-eEEEEEecCCCCCcceEEEEEeCCHHHHHHHHHHhCCCccCCcE
Confidence              122345689999999999999999999999543 36788888666789999999999999999999988888888888


Q ss_pred             eEEEe
Q 027131          221 VSVRV  225 (227)
Q Consensus       221 v~lrv  225 (227)
                      |.+..
T Consensus       159 i~v~~  163 (166)
T 3md3_A          159 LRINW  163 (166)
T ss_dssp             CEEEE
T ss_pred             EEEEe
Confidence            88764



>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.83
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.64
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.63
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.63
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.62
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.61
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.6
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.56
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.56
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.53
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.44
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.27
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.27
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.27
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.25
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.23
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.22
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.22
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.22
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.21
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.21
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.21
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.2
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.19
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.19
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.17
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.17
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.17
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.17
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.15
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.15
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.14
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.14
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.14
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.14
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.13
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.11
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.11
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.1
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.09
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.08
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.07
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.07
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.07
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.07
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.07
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.04
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.04
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.03
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.03
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.03
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.03
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.02
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.02
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.02
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.0
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.99
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.99
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.99
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.98
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.95
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.94
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.94
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.93
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.93
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.92
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.92
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.92
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.9
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.9
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.89
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.89
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.89
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.87
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.87
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.87
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.86
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.85
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.85
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.85
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.85
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.84
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.82
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.81
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.81
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.81
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.81
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.79
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.79
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.78
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.78
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.77
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.77
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.76
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.76
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.76
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.76
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.75
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.74
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.74
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.74
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.73
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.72
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.71
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.71
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.71
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.7
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.7
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.69
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.69
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.68
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.65
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.65
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.65
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.64
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.61
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.61
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.61
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.59
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.59
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.58
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.56
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.55
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.54
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.53
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.53
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.52
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.5
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.45
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.44
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.42
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.42
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.42
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.41
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.4
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.39
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.35
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.35
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.34
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.34
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.32
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.29
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.29
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.29
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.27
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.24
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.21
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.2
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.19
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.17
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.15
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.12
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.11
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.05
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.02
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 97.94
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 97.93
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.91
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 97.86
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.85
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.82
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.73
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 97.7
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 97.66
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.43
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.0
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.99
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 96.53
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 96.36
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 96.32
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=6.3e-20  Score=147.32  Aligned_cols=157  Identities=15%  Similarity=0.090  Sum_probs=121.9

Q ss_pred             EEEeCCCCCCCHHHHHHhcCCCCCCCCCeEEEecC-CCCc-ceEEEEeCCHHHHHHHHHHhC--ccceEEEEEEcccccc
Q 027131           65 GKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTR-NYMP-FAMMMQFPSFSAYDNAFRLIG--RKGRLYRLERAEQSEW  140 (227)
Q Consensus        65 v~lrgLP~s~~K~DI~~FF~g~~I~~d~I~~~ydr-~g~~-~eAfV~F~S~~d~~~AL~~lg--~~gRyv~i~~~~~~~~  140 (227)
                      |++.|||++++++||.++|+.|.- ...|.+..+. .|.. +.|||+|.+++++++|+..++  .+++.+.+.......+
T Consensus         9 lfV~nLp~~~te~~L~~~F~~~G~-v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~~~~~~~   87 (183)
T d1u1qa_           9 LFIGGLSFETTDESLRSHFEQWGT-LTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSRED   87 (183)
T ss_dssp             EEEESCCTTCCHHHHHHHHGGGSC-EEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEECCCTTG
T ss_pred             EEEECCCCCCCHHHHHHHHHHcCC-EEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhhhhhccc
Confidence            578999999999999999998863 3567777776 5555 589999999999999999554  3345555555543333


Q ss_pred             cccc--CCCCcEEEEeccCCCCCHHHHHHccCCCcccCCceEEEeecCCCCcceeEEEEcCCHHHHHHHHHHhcCcccCC
Q 027131          141 DIVM--PYNGKTVLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLPDSIKWATVRFPSQTQAMDAFIRKNRGFCLN  218 (227)
Q Consensus       141 ~~~~--~~~g~~V~LrgLPf~~tkeEI~~FFsG~~i~p~~I~l~~d~~~g~ptGeA~V~F~S~e~A~~Al~~~n~rf~gn  218 (227)
                      ....  .....+|++.|||+++|++||.+||..|.-+ ..+.+..+...|++.|-|+|.|.++++|.+|+..++..+.|.
T Consensus        88 ~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v-~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~~~~~~~~G~  166 (183)
T d1u1qa_          88 SQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGH  166 (183)
T ss_dssp             GGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCE-EEEEEEECTTTCCEEEEEEEEESCHHHHHHHHTSSCEEETTE
T ss_pred             ccccccccccceeEEccCCCcCCHHHHhhhhccCCce-eeeeeecccccCccceeEEEEECCHHHHHHHHHhCCCeECCE
Confidence            2222  1234589999999999999999999999644 357777777767999999999999999999998766666554


Q ss_pred             ceeEEE
Q 027131          219 NQVSVR  224 (227)
Q Consensus       219 ~~v~lr  224 (227)
                       +|.++
T Consensus       167 -~i~V~  171 (183)
T d1u1qa_         167 -NCEVR  171 (183)
T ss_dssp             -EEEEE
T ss_pred             -EEEEE
Confidence             77665



>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure