Citrus Sinensis ID: 027247
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| 255564284 | 225 | conserved hypothetical protein [Ricinus | 0.951 | 0.955 | 0.533 | 6e-56 | |
| 225437473 | 221 | PREDICTED: protein DEHYDRATION-INDUCED 1 | 0.964 | 0.986 | 0.570 | 5e-54 | |
| 449435611 | 220 | PREDICTED: protein DEHYDRATION-INDUCED 1 | 0.964 | 0.990 | 0.495 | 6e-49 | |
| 449517741 | 220 | PREDICTED: protein DEHYDRATION-INDUCED 1 | 0.964 | 0.990 | 0.495 | 3e-48 | |
| 224122996 | 220 | predicted protein [Populus trichocarpa] | 0.964 | 0.990 | 0.491 | 4e-48 | |
| 255542834 | 220 | conserved hypothetical protein [Ricinus | 0.964 | 0.990 | 0.495 | 6e-48 | |
| 224110250 | 215 | predicted protein [Populus trichocarpa] | 0.902 | 0.948 | 0.488 | 3e-47 | |
| 25992529 | 220 | fiber protein Fb2 [Gossypium barbadense] | 0.969 | 0.995 | 0.506 | 6e-47 | |
| 225450655 | 220 | PREDICTED: protein DEHYDRATION-INDUCED 1 | 0.969 | 0.995 | 0.484 | 7e-47 | |
| 224068410 | 218 | predicted protein [Populus trichocarpa] | 0.787 | 0.816 | 0.567 | 9e-47 |
| >gi|255564284|ref|XP_002523139.1| conserved hypothetical protein [Ricinus communis] gi|223537701|gb|EEF39324.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 223 bits (567), Expect = 6e-56, Method: Compositional matrix adjust.
Identities = 119/223 (53%), Positives = 150/223 (67%), Gaps = 8/223 (3%)
Query: 7 FGLSTSSSRNYQSTLKSQFADFCIDFEDIEED---DYEEVKGEYEYPCPFCSEDFDLVGL 63
F LSTSS R+YQS L+S +D C+DFE+++ D +YE+ EYPCPFC EDFDLV L
Sbjct: 8 FALSTSS-RSYQSALRS-LSDLCLDFEEVDGDNINEYEDDDIRAEYPCPFCIEDFDLVEL 65
Query: 64 CCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSL 123
C HID++HP E+K G+CPVC TRV + MV H+TTQHG++ KLKL K S ST+S L
Sbjct: 66 CSHIDDDHPFESKPGICPVCATRVGVSMVRHLTTQHGSM---LQKLKLQKDGSYSTLSLL 122
Query: 124 RKELQNAHFQSLLARSSSSVSSSKKTSDPWLSFIYNMPTADESESIQPALSTGEGAEDKS 183
+KELQ+ HFQ LL S +VSSSK DP +SF+YN AD+S S+QP E+KS
Sbjct: 123 KKELQDGHFQCLLDVPSPAVSSSKMEPDPLMSFLYNAIPADKSGSVQPHCLPDVVLEEKS 182
Query: 184 SCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDDGL 226
S E E + QS LS ++ +EK RS F QGLL STI +D L
Sbjct: 183 SEENILERDMHQSPLSEKEQIEKGRRSRFVQGLLLSTIFEDDL 225
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225437473|ref|XP_002273890.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449435611|ref|XP_004135588.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449517741|ref|XP_004165903.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224122996|ref|XP_002318968.1| predicted protein [Populus trichocarpa] gi|222857344|gb|EEE94891.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255542834|ref|XP_002512480.1| conserved hypothetical protein [Ricinus communis] gi|223548441|gb|EEF49932.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224110250|ref|XP_002315460.1| predicted protein [Populus trichocarpa] gi|222864500|gb|EEF01631.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|25992529|gb|AAN77145.1| fiber protein Fb2 [Gossypium barbadense] | Back alignment and taxonomy information |
|---|
| >gi|225450655|ref|XP_002282891.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224068410|ref|XP_002302738.1| predicted protein [Populus trichocarpa] gi|222844464|gb|EEE82011.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| TAIR|locus:2078062 | 223 | AT3G05700 [Arabidopsis thalian | 0.787 | 0.798 | 0.461 | 1.9e-37 | |
| TAIR|locus:2148528 | 222 | AT5G26990 [Arabidopsis thalian | 0.787 | 0.801 | 0.414 | 1.9e-35 | |
| TAIR|locus:2155934 | 211 | HRB1 "HYPERSENSITIVE TO RED AN | 0.738 | 0.791 | 0.449 | 5.1e-35 | |
| TAIR|locus:2137819 | 228 | AT4G02200 [Arabidopsis thalian | 0.734 | 0.728 | 0.411 | 3.1e-28 | |
| TAIR|locus:2196125 | 221 | AT1G02750 [Arabidopsis thalian | 0.902 | 0.923 | 0.359 | 1.2e-26 | |
| TAIR|locus:2083363 | 234 | AT3G06760 [Arabidopsis thalian | 0.778 | 0.752 | 0.377 | 4e-26 | |
| UNIPROTKB|I3LV30 | 181 | RNF114 "RING finger protein 11 | 0.252 | 0.314 | 0.353 | 0.00026 | |
| UNIPROTKB|Q4U5R4 | 230 | RNF114 "RING finger protein 11 | 0.190 | 0.186 | 0.431 | 0.00044 | |
| UNIPROTKB|Q6J1I8 | 228 | RNF114 "RING finger protein 11 | 0.252 | 0.25 | 0.353 | 0.00059 | |
| RGD|1303139 | 229 | Rnf114 "ring finger protein 11 | 0.190 | 0.187 | 0.431 | 0.00059 |
| TAIR|locus:2078062 AT3G05700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 402 (146.6 bits), Expect = 1.9e-37, P = 1.9e-37
Identities = 84/182 (46%), Positives = 109/182 (59%)
Query: 48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWH 107
E+ CPFCS+ FD+V LCCHIDE+HP+EAK+GVCPVC RV +DMV HIT QH NI
Sbjct: 43 EFACPFCSDYFDIVSLCCHIDEDHPMEAKNGVCPVCAVRVGVDMVAHITLQHANIFKMHR 102
Query: 108 KLKLHKGNSNSTISSLRKELQNAHFQSLLARXX---XXXXXXXXXXDPWLSFIYNMPTAD 164
K K +G S ST+S LR+E + +FQSL DP LS + P AD
Sbjct: 103 KRKPRRGGSYSTLSILRREFPDGNFQSLFGGSSCIVSSSSSSNVAADPLLSSFIS-PIAD 161
Query: 165 ESESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDD 224
+ + +S G K++ + E NA+++SLS EDH +K RS F + LL STI+DD
Sbjct: 162 GFFTTESCISAETGPVKKTTIQCLPEQNAKKTSLSAEDHKQKLKRSEFVRELLSSTILDD 221
Query: 225 GL 226
L
Sbjct: 222 SL 223
|
|
| TAIR|locus:2148528 AT5G26990 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155934 HRB1 "HYPERSENSITIVE TO RED AND BLUE" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2137819 AT4G02200 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196125 AT1G02750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083363 AT3G06760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LV30 RNF114 "RING finger protein 114" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4U5R4 RNF114 "RING finger protein 114" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6J1I8 RNF114 "RING finger protein 114" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1303139 Rnf114 "ring finger protein 114" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0016010201 | hypothetical protein (220 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| pfam05605 | 209 | pfam05605, Di19, Drought induced 19 protein (Di19) | 7e-69 |
| >gnl|CDD|218654 pfam05605, Di19, Drought induced 19 protein (Di19) | Back alignment and domain information |
|---|
Score = 209 bits (535), Expect = 7e-69
Identities = 109/213 (51%), Positives = 139/213 (65%), Gaps = 9/213 (4%)
Query: 12 SSSRNYQSTLKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEEH 71
S+S +YQ L S+ + FEDIE +D EV+ E+ PCPFC EDFD+V LCCHIDEEH
Sbjct: 3 SASASYQRALPSRSDLYL--FEDIEGED--EVREEF--PCPFCYEDFDIVSLCCHIDEEH 56
Query: 72 PVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAH 131
P EAK+GVCPVC RV DMV HIT QHG++ + +L +G S+S +S L++EL++ +
Sbjct: 57 PFEAKNGVCPVCADRVGKDMVAHITVQHGHLFKMQRRRRLRRGGSSSALSLLKRELRDGN 116
Query: 132 FQSLLARS--SSSVSSSKKTSDPWLS-FIYNMPTADESESIQPALSTGEGAEDKSSCEKT 188
QSLL S SSS ++S DP LS FI + P+AD S + + ST A KSS +K
Sbjct: 117 LQSLLGSSCMSSSSNASDSAPDPLLSSFICSSPSADTSSTSKSDSSTEGSASAKSSDQKL 176
Query: 189 FETNAQQSSLSNEDHLEKANRSNFAQGLLFSTI 221
E N+ SSLS E+ EKA RS F QGLL STI
Sbjct: 177 SERNSSDSSLSKEELEEKAKRSEFVQGLLLSTI 209
|
This family consists of several drought induced 19 (Di19) like proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought. The precise function of Di19 is unknown. Length = 209 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| PF14571 | 105 | Di19_C: Stress-induced protein Di19, C-terminal | 100.0 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 99.76 | |
| KOG1280 | 381 | consensus Uncharacterized conserved protein contai | 98.58 | |
| COG5216 | 67 | Uncharacterized conserved protein [Function unknow | 94.75 | |
| KOG2923 | 67 | consensus Uncharacterized conserved protein [Funct | 93.92 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 93.06 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 92.5 | |
| PF14354 | 61 | Lar_restr_allev: Restriction alleviation protein L | 90.64 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 90.54 | |
| PRK09710 | 64 | lar restriction alleviation and modification prote | 89.71 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 89.54 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 89.25 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.83 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 88.63 | |
| PHA00732 | 79 | hypothetical protein | 88.52 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 88.19 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 88.14 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 87.77 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 87.76 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 87.4 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 87.29 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 86.52 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 86.51 | |
| KOG1842 | 505 | consensus FYVE finger-containing protein [General | 86.21 | |
| PHA00733 | 128 | hypothetical protein | 85.64 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 85.44 | |
| PF08274 | 30 | PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 | 83.51 | |
| PRK14892 | 99 | putative transcription elongation factor Elf1; Pro | 83.33 | |
| TIGR02605 | 52 | CxxC_CxxC_SSSS putative regulatory protein, FmdB f | 83.16 | |
| PF14255 | 52 | Cys_rich_CPXG: Cysteine-rich CPXCG | 80.4 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 80.17 |
| >PF14571 Di19_C: Stress-induced protein Di19, C-terminal | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-34 Score=225.14 Aligned_cols=102 Identities=51% Similarity=0.661 Sum_probs=83.4
Q ss_pred chhhhhHHHHhhhhhhhccCC-CCCCCCCCCCCCCccc-cccCCCCCCCcCccCCCCCCCC-CCCCCCcccccccccccC
Q 027247 119 TISSLRKELQNAHFQSLLARS-SSSVSSSKKTSDPWLS-FIYNMPTADESESIQPALSTGE-GAEDKSSCEKTFETNAQQ 195 (226)
Q Consensus 119 ~~s~l~k~lre~~lq~llgg~-s~~~~~sn~~pDPLLS-Fi~n~~~~d~~~~~~p~~s~e~-~~~~~~s~~~~~e~~~~~ 195 (226)
|+|+|+|||||||||+||||+ +++.+++|++|||||| ||||+|.++.++.+++....++ ...++....+.+++.+ +
T Consensus 1 tlsll~kelre~~LQsllGgs~~~~~~ssn~apDPLLSSFI~n~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~s~-~ 79 (105)
T PF14571_consen 1 TLSLLRKELREGYLQSLLGGSRSSSSSSSNSAPDPLLSSFICNFPAPEAEEPSKSSSSSEEKKSSKKSSSEQNVKSSA-D 79 (105)
T ss_pred CcchhhhhhhhhhhhhhcCCCcCCCCCCCCCCCcHHHHHHhcCCCCccccccCCccccccccccccccchhccccccc-C
Confidence 689999999999999999998 6667789999999999 9999999998888887655442 2222233334444444 3
Q ss_pred CCCCHHHHHHHHhHhhHHHHHHHhhh
Q 027247 196 SSLSNEDHLEKANRSNFAQGLLFSTI 221 (226)
Q Consensus 196 ~~ls~ed~eEk~~R~eFVQ~LllSTi 221 (226)
++|++||+|||+||++||||||||||
T Consensus 80 ~~lS~ee~eEk~~RseFVQ~LllSTI 105 (105)
T PF14571_consen 80 SSLSDEEQEEKAQRSEFVQGLLLSTI 105 (105)
T ss_pred CCCCHHHHHHHHHHHHHHHHHHHhhC
Confidence 89999999999999999999999998
|
|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5216 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2923 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF14354 Lar_restr_allev: Restriction alleviation protein Lar | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PRK09710 lar restriction alleviation and modification protein; Reviewed | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >KOG1842 consensus FYVE finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues | Back alignment and domain information |
|---|
| >PRK14892 putative transcription elongation factor Elf1; Provisional | Back alignment and domain information |
|---|
| >TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family | Back alignment and domain information |
|---|
| >PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 5e-04 |
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
Score = 38.0 bits (87), Expect = 5e-04
Identities = 24/102 (23%), Positives = 38/102 (37%), Gaps = 7/102 (6%)
Query: 2 DYSRYFGLSTSSSRNYQSTLKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDF-DL 60
+ RY L+ R ++ +K+ + + E K ++ CP C F
Sbjct: 28 ELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKAISQFVCPLCLMPFSSS 87
Query: 61 VGLCCHIDEEHPVEAKSGVCPVC--VTRVTMDMVDHITTQHG 100
V L HI + VCPVC T +DH+ +H
Sbjct: 88 VSLKQHIRYTE----HTKVCPVCKKEFTSTDSALDHVCKKHN 125
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 97.24 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 97.21 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 96.5 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 96.46 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 96.38 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 96.28 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 96.26 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.1 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 96.09 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 95.99 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 95.93 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 95.87 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 95.67 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 95.47 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 95.47 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 95.4 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 95.28 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 95.23 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 95.15 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 95.12 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 95.06 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 95.04 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 94.96 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 94.93 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 94.89 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 94.88 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 94.85 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 94.79 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 94.69 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 94.56 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 94.53 | |
| 1wge_A | 83 | Hypothetical protein 2610018L09RIK; diphthamide,CS | 94.23 | |
| 2jr7_A | 89 | DPH3 homolog; DESR1, CSL zinc finger, metal bindin | 94.06 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 93.65 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 93.62 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 93.6 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 93.52 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 93.42 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 93.33 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.28 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 93.24 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 93.14 | |
| 1yop_A | 83 | KTI11P; zinc finger, metal binding protein; NMR {S | 93.12 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.99 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 92.97 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 92.97 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.74 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 92.58 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 92.57 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 92.51 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.32 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.31 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.26 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 92.24 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.12 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 92.11 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 92.09 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 92.03 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.98 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.91 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.88 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.77 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.76 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.67 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 91.62 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 91.6 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.57 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.56 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.55 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.5 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 91.46 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 91.45 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 91.29 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.24 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.16 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.07 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.07 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 91.05 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 90.95 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 90.93 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 90.9 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 90.88 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 90.8 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.8 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.73 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 90.7 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 90.7 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 90.59 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.59 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.57 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 90.56 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.5 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.49 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.33 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.29 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.24 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 89.95 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 89.95 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.6 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.56 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.52 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.25 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.17 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 88.81 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 88.79 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.57 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.53 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 88.38 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 88.17 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.11 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 87.84 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 87.77 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 87.35 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 87.2 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 86.78 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 86.33 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 86.24 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 85.88 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 85.45 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 85.01 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 83.87 | |
| 6rxn_A | 46 | Rubredoxin; electron transfer(iron-sulfur protein) | 83.72 | |
| 1wii_A | 85 | Hypothetical UPF0222 protein MGC4549; domain of un | 83.71 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 83.63 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 83.06 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.96 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 82.33 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 81.66 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.6 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 81.52 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.49 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 81.3 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 81.18 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.91 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.84 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 80.63 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 80.42 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.01 |
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
Probab=97.24 E-value=0.00017 Score=49.72 Aligned_cols=54 Identities=26% Similarity=0.441 Sum_probs=44.6
Q ss_pred eeeCCCCCCC-ccHhhhhhcccccCCCCCccccCCccccCcc--hhhHhhhhhcccc
Q 027247 48 EYPCPFCSED-FDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT--MDMVDHITTQHGN 101 (226)
Q Consensus 48 ~f~CPfC~e~-~dv~~L~~H~~~eH~~e~~~vvCPVC~~~v~--~d~i~Hl~~qH~~ 101 (226)
.|.|++|+.. .....|..|+...|..+.+.-.|++|...-. .++..|+...|+.
T Consensus 15 ~~~C~~C~k~f~~~~~L~~H~~~~h~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~ 71 (77)
T 2ct1_A 15 PYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY 71 (77)
T ss_dssp SEECTTTCCEESCHHHHHHHHHHHSSSSCSSEECSSSSCEESSHHHHHHHHHHTSCC
T ss_pred CeECCCcCchhCCHHHHHHHHHHhcCCCCCccCCCCCCCccCCHHHHHHHHHHhCCC
Confidence 5999999994 4578899999878887767889999987543 6899999888875
|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 | Back alignment and structure |
|---|
| >2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 | Back alignment and structure |
|---|
| >1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| d1wgea1 | 70 | DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus | 95.41 | |
| d1ywsa1 | 82 | Diphthamide biosynthesis protein 3, DPH3 {Baker's | 94.43 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 92.61 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 92.25 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 85.83 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 85.11 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 84.25 | |
| d1yuja_ | 54 | GAGA factor {Drosophila melanogaster [TaxId: 7227] | 83.34 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 83.22 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 82.97 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 82.82 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 81.31 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 80.78 |
| >d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: CSL zinc finger family: CSL zinc finger domain: DelGEF-interacting protein 1, DelGIP1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=95.41 E-value=0.003 Score=44.21 Aligned_cols=47 Identities=28% Similarity=0.651 Sum_probs=31.2
Q ss_pred CCccCCCcchhhhccCcceeeCCCCCCC--ccHhhhhhcccccCCCCCccccCCccccCcc
Q 027247 30 IDFEDIEEDDYEEVKGEYEYPCPFCSED--FDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT 88 (226)
Q Consensus 30 ~~~e~~~~d~d~e~~~~~~f~CPfC~e~--~dv~~L~~H~~~eH~~e~~~vvCPVC~~~v~ 88 (226)
+.+||++-|++.+.+ .|+|| ||.. +....|-.+ .-.+.||-|+-.+.
T Consensus 8 v~leD~~~dee~~~~---~ypCp-CGd~F~it~~dLe~g--------e~V~~C~sCSL~ik 56 (70)
T d1wgea1 8 VEIEDFQYDEDSETY---FYPCP-CGDNFAITKEDLENG--------EDVATCPSCSLIIK 56 (70)
T ss_dssp EEGGGSCCBTTTTEE---EECCS-SSSCEEEEHHHHHTT--------CCEEECTTTCCEEE
T ss_pred EEeeeeeEeCCCCEE---EeCCC-CCCeEEECHHHHhCC--------CeEEeCCCCceEEE
Confidence 456777766553344 89999 9994 455556443 12456999998765
|
| >d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|