Citrus Sinensis ID: 027247

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MDYSRYFGLSTSSSRNYQSTLKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLARSSSSVSSSKKTSDPWLSFIYNMPTADESESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDDGL
cccccccHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHccccccccccccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccc
cccHHHHHHHHHHHHHHHHHHHccccHccccccccccccccHHcccHccccccccccccEHHHHHccHcccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcHHHHHHHHHHHccccccccccccccccccHHHHccccccccccccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc
mdysryfglstsssrnYQSTLKSQFADFCIdfedieeddyeevkgeyeypcpfcsedfdlvglcchideehpveaksgvcpvcvtrVTMDMVDHITtqhgnisnswhklklhkgnsnsTISSLRKELQNAHFQSLLarssssvssskktsdpwlsfiynmptadesesiqpalstgegaedkssceKTFEtnaqqsslsnedHLEKANRSNFAQGLLFSTIMDDGL
mdysryfglstsssrnyqsTLKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEehpveaksgvcPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLlarssssvssskktsdPWLSFIYNMPTADESESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSnfaqgllfstimddgl
MDYSRYFGLSTSSSRNYQSTLKSQFAdfcidfedieeddyeeVKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLARssssvssskktsDPWLSFIYNMPTADESESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDDGL
********************LKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKL*****************************************WLSFIY********************************************************************
****RY***************************DIEEDDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQ*********************************************************F******************************************************NFAQGLLFSTIMDDGL
MDYSRYFGLSTSSSRNYQSTLKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQS****************DPWLSFIYNMPTAD****************************************EKANRSNFAQGLLFSTIMDDGL
*****Y*******SRNYQSTLKS****FCIDFEDI**DDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLH****NSTISSLRKELQNAHFQSLLAR*********KTSDPWLSFIYNMPT******************************************EKANRSNFAQGLLFSTIMDDGL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYSRYFGLSTSSSRNYQSTLKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLARSSSSVSSSKKTSDPWLSFIYNMPTADESESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDDGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q84J70223 Protein DEHYDRATION-INDUC yes no 0.969 0.982 0.443 4e-41
Q8VXU6224 Protein DEHYDRATION-INDUC no no 0.814 0.821 0.489 4e-41
Q6NM26222 Protein DEHYDRATION-INDUC no no 0.969 0.986 0.414 5e-39
Q9FJ17211 Protein DEHYDRATION-INDUC no no 0.774 0.829 0.463 3e-38
O04259214 Protein DEHYDRATION-INDUC no no 0.778 0.822 0.442 7e-35
Q5W794233 Protein DEHYDRATION-INDUC yes no 0.867 0.841 0.406 4e-33
Q39083206 Protein DEHYDRATION-INDUC no no 0.876 0.961 0.392 5e-32
Q8GWK1221 Protein DEHYDRATION-INDUC no no 0.805 0.823 0.395 3e-27
Q688X9226 Protein DEHYDRATION-INDUC no no 0.929 0.929 0.337 2e-26
Q5QMP3246 Protein DEHYDRATION-INDUC no no 0.765 0.703 0.320 6e-22
>sp|Q84J70|DI193_ARATH Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Arabidopsis thaliana GN=DI19-3 PE=1 SV=1 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 139/230 (60%), Gaps = 11/230 (4%)

Query: 1   MDYSRYFGLSTSSSRNYQSTLKSQFADFCIDFEDIE-EDDYEEVKGEYEYPCPFCSEDFD 59
           MD   +     S++R YQ    S+ +D  + FE+I+ E+++ E     E+ CPFCS+ FD
Sbjct: 1   MDSDSWSDRLASATRRYQLAFPSR-SDTFLGFEEIDGEEEFRE-----EFACPFCSDYFD 54

Query: 60  LVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNST 119
           +V LCCHIDE+HP+EAK+GVCPVC  RV +DMV HIT QH NI     K K  +G S ST
Sbjct: 55  IVSLCCHIDEDHPMEAKNGVCPVCAVRVGVDMVAHITLQHANIFKMHRKRKPRRGGSYST 114

Query: 120 ISSLRKELQNAHFQSLLA---RSSSSVSSSKKTSDPWLSFIYNMPTADESESIQPALSTG 176
           +S LR+E  + +FQSL        SS SSS   +DP LS   + P AD   + +  +S  
Sbjct: 115 LSILRREFPDGNFQSLFGGSSCIVSSSSSSNVAADPLLSSFIS-PIADGFFTTESCISAE 173

Query: 177 EGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDDGL 226
            G   K++ +   E NA+++SLS EDH +K  RS F + LL STI+DD L
Sbjct: 174 TGPVKKTTIQCLPEQNAKKTSLSAEDHKQKLKRSEFVRELLSSTILDDSL 223

Arabidopsis thaliana (taxid: 3702)
>sp|Q8VXU6|DI194_ARATH Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Arabidopsis thaliana GN=DI19-4 PE=1 SV=1 Back     alignment and function description
>sp|Q6NM26|DI196_ARATH Protein DEHYDRATION-INDUCED 19 homolog 6 OS=Arabidopsis thaliana GN=DI19-6 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJ17|DI197_ARATH Protein DEHYDRATION-INDUCED 19 homolog 7 OS=Arabidopsis thaliana GN=DI19-7 PE=1 SV=2 Back     alignment and function description
>sp|O04259|DI195_ARATH Protein DEHYDRATION-INDUCED 19 homolog 5 OS=Arabidopsis thaliana GN=DI19-5 PE=1 SV=2 Back     alignment and function description
>sp|Q5W794|DI192_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Oryza sativa subsp. japonica GN=DI19-2 PE=2 SV=2 Back     alignment and function description
>sp|Q39083|DI191_ARATH Protein DEHYDRATION-INDUCED 19 OS=Arabidopsis thaliana GN=DI19-1 PE=1 SV=2 Back     alignment and function description
>sp|Q8GWK1|DI192_ARATH Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Arabidopsis thaliana GN=DI19-2 PE=1 SV=1 Back     alignment and function description
>sp|Q688X9|DI191_ORYSJ Protein DEHYDRATION-INDUCED 19 OS=Oryza sativa subsp. japonica GN=DI19-1 PE=2 SV=1 Back     alignment and function description
>sp|Q5QMP3|DI193_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Oryza sativa subsp. japonica GN=DI19-3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
255564284225 conserved hypothetical protein [Ricinus 0.951 0.955 0.533 6e-56
225437473221 PREDICTED: protein DEHYDRATION-INDUCED 1 0.964 0.986 0.570 5e-54
449435611220 PREDICTED: protein DEHYDRATION-INDUCED 1 0.964 0.990 0.495 6e-49
449517741220 PREDICTED: protein DEHYDRATION-INDUCED 1 0.964 0.990 0.495 3e-48
224122996220 predicted protein [Populus trichocarpa] 0.964 0.990 0.491 4e-48
255542834220 conserved hypothetical protein [Ricinus 0.964 0.990 0.495 6e-48
224110250215 predicted protein [Populus trichocarpa] 0.902 0.948 0.488 3e-47
25992529220 fiber protein Fb2 [Gossypium barbadense] 0.969 0.995 0.506 6e-47
225450655220 PREDICTED: protein DEHYDRATION-INDUCED 1 0.969 0.995 0.484 7e-47
224068410218 predicted protein [Populus trichocarpa] 0.787 0.816 0.567 9e-47
>gi|255564284|ref|XP_002523139.1| conserved hypothetical protein [Ricinus communis] gi|223537701|gb|EEF39324.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 150/223 (67%), Gaps = 8/223 (3%)

Query: 7   FGLSTSSSRNYQSTLKSQFADFCIDFEDIEED---DYEEVKGEYEYPCPFCSEDFDLVGL 63
           F LSTSS R+YQS L+S  +D C+DFE+++ D   +YE+     EYPCPFC EDFDLV L
Sbjct: 8   FALSTSS-RSYQSALRS-LSDLCLDFEEVDGDNINEYEDDDIRAEYPCPFCIEDFDLVEL 65

Query: 64  CCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSL 123
           C HID++HP E+K G+CPVC TRV + MV H+TTQHG++     KLKL K  S ST+S L
Sbjct: 66  CSHIDDDHPFESKPGICPVCATRVGVSMVRHLTTQHGSM---LQKLKLQKDGSYSTLSLL 122

Query: 124 RKELQNAHFQSLLARSSSSVSSSKKTSDPWLSFIYNMPTADESESIQPALSTGEGAEDKS 183
           +KELQ+ HFQ LL   S +VSSSK   DP +SF+YN   AD+S S+QP        E+KS
Sbjct: 123 KKELQDGHFQCLLDVPSPAVSSSKMEPDPLMSFLYNAIPADKSGSVQPHCLPDVVLEEKS 182

Query: 184 SCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDDGL 226
           S E   E +  QS LS ++ +EK  RS F QGLL STI +D L
Sbjct: 183 SEENILERDMHQSPLSEKEQIEKGRRSRFVQGLLLSTIFEDDL 225

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225437473|ref|XP_002273890.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449435611|ref|XP_004135588.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449517741|ref|XP_004165903.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224122996|ref|XP_002318968.1| predicted protein [Populus trichocarpa] gi|222857344|gb|EEE94891.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542834|ref|XP_002512480.1| conserved hypothetical protein [Ricinus communis] gi|223548441|gb|EEF49932.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224110250|ref|XP_002315460.1| predicted protein [Populus trichocarpa] gi|222864500|gb|EEF01631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|25992529|gb|AAN77145.1| fiber protein Fb2 [Gossypium barbadense] Back     alignment and taxonomy information
>gi|225450655|ref|XP_002282891.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224068410|ref|XP_002302738.1| predicted protein [Populus trichocarpa] gi|222844464|gb|EEE82011.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
TAIR|locus:2078062223 AT3G05700 [Arabidopsis thalian 0.787 0.798 0.461 1.9e-37
TAIR|locus:2148528222 AT5G26990 [Arabidopsis thalian 0.787 0.801 0.414 1.9e-35
TAIR|locus:2155934211 HRB1 "HYPERSENSITIVE TO RED AN 0.738 0.791 0.449 5.1e-35
TAIR|locus:2137819228 AT4G02200 [Arabidopsis thalian 0.734 0.728 0.411 3.1e-28
TAIR|locus:2196125221 AT1G02750 [Arabidopsis thalian 0.902 0.923 0.359 1.2e-26
TAIR|locus:2083363234 AT3G06760 [Arabidopsis thalian 0.778 0.752 0.377 4e-26
UNIPROTKB|I3LV30181 RNF114 "RING finger protein 11 0.252 0.314 0.353 0.00026
UNIPROTKB|Q4U5R4230 RNF114 "RING finger protein 11 0.190 0.186 0.431 0.00044
UNIPROTKB|Q6J1I8228 RNF114 "RING finger protein 11 0.252 0.25 0.353 0.00059
RGD|1303139229 Rnf114 "ring finger protein 11 0.190 0.187 0.431 0.00059
TAIR|locus:2078062 AT3G05700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 402 (146.6 bits), Expect = 1.9e-37, P = 1.9e-37
 Identities = 84/182 (46%), Positives = 109/182 (59%)

Query:    48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWH 107
             E+ CPFCS+ FD+V LCCHIDE+HP+EAK+GVCPVC  RV +DMV HIT QH NI     
Sbjct:    43 EFACPFCSDYFDIVSLCCHIDEDHPMEAKNGVCPVCAVRVGVDMVAHITLQHANIFKMHR 102

Query:   108 KLKLHKGNSNSTISSLRKELQNAHFQSLLARXX---XXXXXXXXXXDPWLSFIYNMPTAD 164
             K K  +G S ST+S LR+E  + +FQSL                  DP LS   + P AD
Sbjct:   103 KRKPRRGGSYSTLSILRREFPDGNFQSLFGGSSCIVSSSSSSNVAADPLLSSFIS-PIAD 161

Query:   165 ESESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDD 224
                + +  +S   G   K++ +   E NA+++SLS EDH +K  RS F + LL STI+DD
Sbjct:   162 GFFTTESCISAETGPVKKTTIQCLPEQNAKKTSLSAEDHKQKLKRSEFVRELLSSTILDD 221

Query:   225 GL 226
              L
Sbjct:   222 SL 223
GO:0005634 "nucleus" evidence=ISM
GO:0009414 "response to water deprivation" evidence=ISS
TAIR|locus:2148528 AT5G26990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155934 HRB1 "HYPERSENSITIVE TO RED AND BLUE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137819 AT4G02200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196125 AT1G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083363 AT3G06760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LV30 RNF114 "RING finger protein 114" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q4U5R4 RNF114 "RING finger protein 114" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6J1I8 RNF114 "RING finger protein 114" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1303139 Rnf114 "ring finger protein 114" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5W794DI192_ORYSJNo assigned EC number0.40680.86720.8412yesno
Q84J70DI193_ARATHNo assigned EC number0.44340.96900.9820yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0016010201
hypothetical protein (220 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
pfam05605209 pfam05605, Di19, Drought induced 19 protein (Di19) 7e-69
>gnl|CDD|218654 pfam05605, Di19, Drought induced 19 protein (Di19) Back     alignment and domain information 
 Score =  209 bits (535), Expect = 7e-69
 Identities = 109/213 (51%), Positives = 139/213 (65%), Gaps = 9/213 (4%)

Query: 12  SSSRNYQSTLKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDFDLVGLCCHIDEEH 71
           S+S +YQ  L S+   +   FEDIE +D  EV+ E+  PCPFC EDFD+V LCCHIDEEH
Sbjct: 3   SASASYQRALPSRSDLYL--FEDIEGED--EVREEF--PCPFCYEDFDIVSLCCHIDEEH 56

Query: 72  PVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAH 131
           P EAK+GVCPVC  RV  DMV HIT QHG++     + +L +G S+S +S L++EL++ +
Sbjct: 57  PFEAKNGVCPVCADRVGKDMVAHITVQHGHLFKMQRRRRLRRGGSSSALSLLKRELRDGN 116

Query: 132 FQSLLARS--SSSVSSSKKTSDPWLS-FIYNMPTADESESIQPALSTGEGAEDKSSCEKT 188
            QSLL  S  SSS ++S    DP LS FI + P+AD S + +   ST   A  KSS +K 
Sbjct: 117 LQSLLGSSCMSSSSNASDSAPDPLLSSFICSSPSADTSSTSKSDSSTEGSASAKSSDQKL 176

Query: 189 FETNAQQSSLSNEDHLEKANRSNFAQGLLFSTI 221
            E N+  SSLS E+  EKA RS F QGLL STI
Sbjct: 177 SERNSSDSSLSKEELEEKAKRSEFVQGLLLSTI 209

This family consists of several drought induced 19 (Di19) like proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought. The precise function of Di19 is unknown. Length = 209

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
PF14571105 Di19_C: Stress-induced protein Di19, C-terminal 100.0
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 99.76
KOG1280 381 consensus Uncharacterized conserved protein contai 98.58
COG521667 Uncharacterized conserved protein [Function unknow 94.75
KOG292367 consensus Uncharacterized conserved protein [Funct 93.92
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 93.06
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 92.5
PF1435461 Lar_restr_allev: Restriction alleviation protein L 90.64
PLN03086567 PRLI-interacting factor K; Provisional 90.54
PRK0971064 lar restriction alleviation and modification prote 89.71
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 89.54
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 89.25
COG5236493 Uncharacterized conserved protein, contains RING Z 88.83
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 88.63
PHA0073279 hypothetical protein 88.52
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 88.19
smart00531147 TFIIE Transcription initiation factor IIE. 88.14
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 87.77
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 87.76
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 87.4
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 87.29
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 86.52
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.51
KOG1842 505 consensus FYVE finger-containing protein [General 86.21
PHA00733128 hypothetical protein 85.64
PLN03086567 PRLI-interacting factor K; Provisional 85.44
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 83.51
PRK1489299 putative transcription elongation factor Elf1; Pro 83.33
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 83.16
PF1425552 Cys_rich_CPXG: Cysteine-rich CPXCG 80.4
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 80.17
>PF14571 Di19_C: Stress-induced protein Di19, C-terminal Back     alignment and domain information 
Probab=100.00  E-value=4.3e-34  Score=225.14  Aligned_cols=102  Identities=51%  Similarity=0.661  Sum_probs=83.4

Q ss_pred             chhhhhHHHHhhhhhhhccCC-CCCCCCCCCCCCCccc-cccCCCCCCCcCccCCCCCCCC-CCCCCCcccccccccccC
Q 027247          119 TISSLRKELQNAHFQSLLARS-SSSVSSSKKTSDPWLS-FIYNMPTADESESIQPALSTGE-GAEDKSSCEKTFETNAQQ  195 (226)
Q Consensus       119 ~~s~l~k~lre~~lq~llgg~-s~~~~~sn~~pDPLLS-Fi~n~~~~d~~~~~~p~~s~e~-~~~~~~s~~~~~e~~~~~  195 (226)
                      |+|+|+|||||||||+||||+ +++.+++|++|||||| ||||+|.++.++.+++....++ ...++....+.+++.+ +
T Consensus         1 tlsll~kelre~~LQsllGgs~~~~~~ssn~apDPLLSSFI~n~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~s~-~   79 (105)
T PF14571_consen    1 TLSLLRKELREGYLQSLLGGSRSSSSSSSNSAPDPLLSSFICNFPAPEAEEPSKSSSSSEEKKSSKKSSSEQNVKSSA-D   79 (105)
T ss_pred             CcchhhhhhhhhhhhhhcCCCcCCCCCCCCCCCcHHHHHHhcCCCCccccccCCccccccccccccccchhccccccc-C
Confidence            689999999999999999998 6667789999999999 9999999998888887655442 2222233334444444 3


Q ss_pred             CCCCHHHHHHHHhHhhHHHHHHHhhh
Q 027247          196 SSLSNEDHLEKANRSNFAQGLLFSTI  221 (226)
Q Consensus       196 ~~ls~ed~eEk~~R~eFVQ~LllSTi  221 (226)
                      ++|++||+|||+||++||||||||||
T Consensus        80 ~~lS~ee~eEk~~RseFVQ~LllSTI  105 (105)
T PF14571_consen   80 SSLSDEEQEEKAQRSEFVQGLLLSTI  105 (105)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhhC
Confidence            89999999999999999999999998

>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>COG5216 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2923 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1842 consensus FYVE finger-containing protein [General function prediction only] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-04
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
 Score = 38.0 bits (87), Expect = 5e-04
 Identities = 24/102 (23%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 2   DYSRYFGLSTSSSRNYQSTLKSQFADFCIDFEDIEEDDYEEVKGEYEYPCPFCSEDF-DL 60
           +  RY  L+    R  ++ +K+   +  +  E          K   ++ CP C   F   
Sbjct: 28  ELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKAISQFVCPLCLMPFSSS 87

Query: 61  VGLCCHIDEEHPVEAKSGVCPVC--VTRVTMDMVDHITTQHG 100
           V L  HI         + VCPVC      T   +DH+  +H 
Sbjct: 88  VSLKQHIRYTE----HTKVCPVCKKEFTSTDSALDHVCKKHN 125

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 97.24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 97.21
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 96.5
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 96.46
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 96.38
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 96.28
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 96.26
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 96.1
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 96.09
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 95.99
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 95.93
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 95.87
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 95.67
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 95.47
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 95.47
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 95.4
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 95.28
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 95.23
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 95.15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 95.12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 95.06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 95.04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 94.96
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 94.93
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 94.89
2lv2_A85 Insulinoma-associated protein 1; structural genomi 94.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 94.85
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 94.79
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 94.69
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 94.56
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 94.53
1wge_A83 Hypothetical protein 2610018L09RIK; diphthamide,CS 94.23
2jr7_A89 DPH3 homolog; DESR1, CSL zinc finger, metal bindin 94.06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 93.65
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 93.62
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 93.6
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 93.52
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 93.42
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 93.33
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.28
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 93.24
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 93.14
1yop_A83 KTI11P; zinc finger, metal binding protein; NMR {S 93.12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 92.99
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 92.97
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 92.97
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 92.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 92.58
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 92.57
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 92.51
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.32
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 92.31
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.26
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 92.24
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 92.12
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 92.11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 92.09
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 92.03
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 91.98
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 91.91
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.88
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.77
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 91.76
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 91.67
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 91.62
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 91.6
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 91.57
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 91.56
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.55
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 91.5
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 91.46
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 91.45
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 91.29
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.24
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 91.16
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 91.07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 91.05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 90.95
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 90.93
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 90.9
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 90.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 90.8
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.8
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.73
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 90.7
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 90.7
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 90.59
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.59
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 90.57
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 90.56
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.5
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.49
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.33
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.29
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.24
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 89.95
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 89.95
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.6
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 89.56
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 89.52
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.25
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.17
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 88.81
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 88.79
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.57
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.53
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 88.38
1vd4_A62 Transcription initiation factor IIE, alpha subunit 88.17
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 87.84
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 87.77
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 87.35
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 87.2
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 86.78
1tf6_A190 Protein (transcription factor IIIA); complex (tran 86.33
2ysl_A73 Tripartite motif-containing protein 31; ring-type 86.24
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 85.88
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 85.45
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 85.01
2lv2_A85 Insulinoma-associated protein 1; structural genomi 83.87
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 83.72
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 83.71
1paa_A30 Yeast transcription factor ADR1; transcription reg 83.63
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 83.06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 82.96
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 82.33
2epa_A72 Krueppel-like factor 10; transforming growth facto 81.66
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 81.6
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 81.52
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 81.49
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 81.3
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 81.18
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.91
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.84
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 80.63
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 80.42
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.01
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=97.24  E-value=0.00017  Score=49.72  Aligned_cols=54  Identities=26%  Similarity=0.441  Sum_probs=44.6

Q ss_pred             eeeCCCCCCC-ccHhhhhhcccccCCCCCccccCCccccCcc--hhhHhhhhhcccc
Q 027247           48 EYPCPFCSED-FDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT--MDMVDHITTQHGN  101 (226)
Q Consensus        48 ~f~CPfC~e~-~dv~~L~~H~~~eH~~e~~~vvCPVC~~~v~--~d~i~Hl~~qH~~  101 (226)
                      .|.|++|+.. .....|..|+...|..+.+.-.|++|...-.  .++..|+...|+.
T Consensus        15 ~~~C~~C~k~f~~~~~L~~H~~~~h~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~   71 (77)
T 2ct1_A           15 PYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY   71 (77)
T ss_dssp             SEECTTTCCEESCHHHHHHHHHHHSSSSCSSEECSSSSCEESSHHHHHHHHHHTSCC
T ss_pred             CeECCCcCchhCCHHHHHHHHHHhcCCCCCccCCCCCCCccCCHHHHHHHHHHhCCC
Confidence            5999999994 4578899999878887767889999987543  6899999888875
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Back     alignment and structure
>2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d1wgea170 DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus 95.41
d1ywsa182 Diphthamide biosynthesis protein 3, DPH3 {Baker's 94.43
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 92.61
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 92.25
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 85.83
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 85.11
d2c2la280 STIP1 homology and U box-containing protein 1, STU 84.25
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 83.34
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 83.22
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 82.97
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 82.82
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 81.31
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 80.78
>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: CSL zinc finger
family: CSL zinc finger
domain: DelGEF-interacting protein 1, DelGIP1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.41  E-value=0.003  Score=44.21  Aligned_cols=47  Identities=28%  Similarity=0.651  Sum_probs=31.2

Q ss_pred             CCccCCCcchhhhccCcceeeCCCCCCC--ccHhhhhhcccccCCCCCccccCCccccCcc
Q 027247           30 IDFEDIEEDDYEEVKGEYEYPCPFCSED--FDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (226)
Q Consensus        30 ~~~e~~~~d~d~e~~~~~~f~CPfC~e~--~dv~~L~~H~~~eH~~e~~~vvCPVC~~~v~   88 (226)
                      +.+||++-|++.+.+   .|+|| ||..  +....|-.+        .-.+.||-|+-.+.
T Consensus         8 v~leD~~~dee~~~~---~ypCp-CGd~F~it~~dLe~g--------e~V~~C~sCSL~ik   56 (70)
T d1wgea1           8 VEIEDFQYDEDSETY---FYPCP-CGDNFAITKEDLENG--------EDVATCPSCSLIIK   56 (70)
T ss_dssp             EEGGGSCCBTTTTEE---EECCS-SSSCEEEEHHHHHTT--------CCEEECTTTCCEEE
T ss_pred             EEeeeeeEeCCCCEE---EeCCC-CCCeEEECHHHHhCC--------CeEEeCCCCceEEE
Confidence            456777766553344   89999 9994  455556443        12456999998765
>d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure