Citrus Sinensis ID: 027405

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MVEEKSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGGL
cccccccHHHHHHHHHcccccEEccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHcccEEEcccccccccHHHHHHcHHHHHHccccccccEEEEccccccccccHHHHHHHHccccEEEEEcccccccccccccccc
cccHHHHHHHHHHHHHccccEEEEEcccccccccEEEEEccccHHHEcHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHcHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccc
MVEEKSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEmmepcssvkdrigySMIADAeekglirpgesvlieptsgntgIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAelvltdpargmkGAVQKAEeirdktpnsyvlqqfenpanpkihyettgpeiwkgtggkiDALVsgigtggtvtgagkylkehnpeiklygvepvesavlsggkpggl
mveeksviakdvteligktplvylnRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAeeirdktpnsyvlqqfenpanpkihYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIklygvepvesavlsggkpggl
MVEEKSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSgigtggtvtgagKYLKEHNPEIKLYGVEPVESAVLSGGKPGGL
*******IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPA********************YVLQQF****NPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVE***************
*****SV***DVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGG*****
MVEEKSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAV*********
****KSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVE************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEEKSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query224 2.2.26 [Sep-21-2011]
Q43317 325 Cysteine synthase OS=Citr N/A no 0.991 0.683 0.896 1e-106
Q00834 325 Cysteine synthase OS=Spin N/A no 0.991 0.683 0.869 1e-104
O81154 325 Cysteine synthase OS=Sola N/A no 0.991 0.683 0.833 1e-100
Q9XEA6321 Cysteine synthase OS=Oryz yes no 0.959 0.669 0.851 6e-99
O23733 322 Cysteine synthase OS=Bras N/A no 0.968 0.673 0.838 9e-99
P47998 322 Cysteine synthase OS=Arab yes no 0.968 0.673 0.843 3e-98
P38076325 Cysteine synthase OS=Trit N/A no 0.959 0.661 0.841 5e-98
Q9XEA8 325 Cysteine synthase OS=Oryz no no 0.991 0.683 0.815 4e-97
O23735 324 Cysteine synthase OS=Bras N/A no 0.959 0.663 0.837 2e-96
P80608 325 Cysteine synthase OS=Zea N/A no 0.991 0.683 0.819 2e-96
>sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function desciption
 Score =  384 bits (986), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/222 (89%), Positives = 210/222 (94%)

Query: 1   MVEEKSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADA 60
           M + KS IAKDVTELIG TPLVYLNR+VDGCVAR+AAKLEMMEPCSSVKDRIGYSMI+DA
Sbjct: 1   MADAKSTIAKDVTELIGNTPLVYLNRVVDGCVARVAAKLEMMEPCSSVKDRIGYSMISDA 60

Query: 61  EEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELV 120
           E KGLI PGESVLIEPTSGNTGIGLAF+AAAKGYRLII MPASMSLERR +L AFGAELV
Sbjct: 61  ENKGLITPGESVLIEPTSGNTGIGLAFIAAAKGYRLIICMPASMSLERRTILRAFGAELV 120

Query: 121 LTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALV 180
           LTDPARGMKGAVQKAEEI+ KTPNSY+LQQFENPANPKIHYETTGPEIW+G+GGKIDALV
Sbjct: 121 LTDPARGMKGAVQKAEEIKAKTPNSYILQQFENPANPKIHYETTGPEIWRGSGGKIDALV 180

Query: 181 SGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPG 222
           SGIGTGGTVTGAGKYLKE NP IKLYGVEPVESA+LSGGKPG
Sbjct: 181 SGIGTGGTVTGAGKYLKEQNPNIKLYGVEPVESAILSGGKPG 222
Produces L-cysteine from O-acetyl-L-serine and hydrogen sulfide. Can also use pyrazole and 3,4-dihydroxypyridine instead of the hydrogen sulfide to produce two plant specific non-protein amino acids beta-pyrazolylalanine and L-mimosine.
Citrullus lanatus (taxid: 3654)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 5EC: 2
>sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function description
>sp|O81154|CYSK_SOLTU Cysteine synthase OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q9XEA6|CYSK1_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2 Back     alignment and function description
>sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description
>sp|P47998|CYSK1_ARATH Cysteine synthase OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2 Back     alignment and function description
>sp|P38076|CYSK_WHEAT Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 Back     alignment and function description
>sp|O23735|CYSK2_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description
>sp|P80608|CYSK_MAIZE Cysteine synthase OS=Zea mays PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
224144420 325 predicted protein [Populus trichocarpa] 0.991 0.683 0.905 1e-107
224125568 325 predicted protein [Populus trichocarpa] 0.991 0.683 0.914 1e-107
224130736 325 predicted protein [Populus trichocarpa] 0.991 0.683 0.887 1e-106
255542380 325 cysteine synthase, putative [Ricinus com 0.991 0.683 0.909 1e-105
356573072 325 PREDICTED: cysteine synthase-like [Glyci 0.991 0.683 0.891 1e-104
307136057 325 cysteine synthase [Cucumis melo subsp. m 0.991 0.683 0.891 1e-104
2493895 325 RecName: Full=Cysteine synthase; Short=C 0.991 0.683 0.896 1e-104
225451235 325 PREDICTED: cysteine synthase isoform 2 [ 0.991 0.683 0.896 1e-104
351726020 325 cysteine synthase [Glycine max] gi|12650 0.991 0.683 0.882 1e-104
255647610 325 unknown [Glycine max] 0.991 0.683 0.882 1e-104
>gi|224144420|ref|XP_002336146.1| predicted protein [Populus trichocarpa] gi|222874214|gb|EEF11345.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/222 (90%), Positives = 212/222 (95%)

Query: 1   MVEEKSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADA 60
           M EEK  IAKDVTELIGKTPLVYLN +VDGCVARIAAKLEMMEPCSSVKDRIGYSMI DA
Sbjct: 1   MAEEKGSIAKDVTELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMIKDA 60

Query: 61  EEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELV 120
           EEKGLI+PGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAEL+
Sbjct: 61  EEKGLIKPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELI 120

Query: 121 LTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALV 180
           LTDPARGMKGAVQKAEEI  KTPN+Y+LQQFENPANPKIHYETTGPE+WKG+GGK+DA V
Sbjct: 121 LTDPARGMKGAVQKAEEILAKTPNAYLLQQFENPANPKIHYETTGPEMWKGSGGKVDAFV 180

Query: 181 SGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPG 222
           SGIGTGGT+TGA KYLKE NP+IK+YGVEPVESAVLSGGKPG
Sbjct: 181 SGIGTGGTITGAAKYLKEQNPDIKIYGVEPVESAVLSGGKPG 222

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125568|ref|XP_002319618.1| predicted protein [Populus trichocarpa] gi|118482627|gb|ABK93233.1| unknown [Populus trichocarpa] gi|222857994|gb|EEE95541.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224130736|ref|XP_002328363.1| predicted protein [Populus trichocarpa] gi|222838078|gb|EEE76443.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542380|ref|XP_002512253.1| cysteine synthase, putative [Ricinus communis] gi|223548214|gb|EEF49705.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356573072|ref|XP_003554689.1| PREDICTED: cysteine synthase-like [Glycine max] Back     alignment and taxonomy information
>gi|307136057|gb|ADN33908.1| cysteine synthase [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|2493895|sp|Q43317.1|CYSK_CITLA RecName: Full=Cysteine synthase; Short=CSase; AltName: Full=Beta-PA/CSase; AltName: Full=Beta-pyrazolylalanine synthase; AltName: Full=L-mimosine synthase; AltName: Full=O-acetylserine (thiol)-lyase; Short=OAS-TL; AltName: Full=O-acetylserine sulfhydrylase gi|540497|dbj|BAA05965.1| cysteine synthase [Citrullus lanatus subsp. vulgaris] Back     alignment and taxonomy information
>gi|225451235|ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Vitis vinifera] gi|225451237|ref|XP_002275940.1| PREDICTED: cysteine synthase isoform 1 [Vitis vinifera] gi|359487829|ref|XP_003633658.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|147819267|emb|CAN75607.1| hypothetical protein VITISV_033255 [Vitis vinifera] gi|298204909|emb|CBI34216.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351726020|ref|NP_001238392.1| cysteine synthase [Glycine max] gi|126508778|gb|ABO15564.1| cysteine synthase [Glycine max] Back     alignment and taxonomy information
>gi|255647610|gb|ACU24268.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
TAIR|locus:2130419 322 OASA1 "O-acetylserine (thiol) 0.968 0.673 0.792 2.5e-90
TAIR|locus:2043964 392 OASB "O-acetylserine (thiol) l 0.959 0.548 0.720 9.4e-82
TAIR|locus:2080417 433 OASC "O-acetylserine (thiol) l 0.959 0.496 0.693 5.4e-79
TAIR|locus:2114804324 CYSD1 "cysteine synthase D1" [ 0.991 0.685 0.630 2.7e-75
TAIR|locus:2143814323 CYSD2 "cysteine synthase D2" [ 0.986 0.684 0.642 1.9e-74
TAIR|locus:2143754323 DES1 "L-cysteine desulfhydrase 0.986 0.684 0.628 8.6e-72
TAIR|locus:2096454404 CS26 "cysteine synthase 26" [A 1.0 0.554 0.595 2.7e-68
UNIPROTKB|Q1KLZ2 376 CAS1 "L-3-cyanoalanine synthas 0.959 0.571 0.567 1.3e-66
UNIPROTKB|Q1KLZ1 375 CAS2 "L-3-cyanoalanine synthas 0.959 0.573 0.567 4.5e-66
UNIPROTKB|Q76MX2 351 PCAS-1 "Bifunctional L-3-cyano 0.959 0.612 0.572 9.4e-66
TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 901 (322.2 bits), Expect = 2.5e-90, P = 2.5e-90
 Identities = 172/217 (79%), Positives = 188/217 (86%)

Query:     6 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGL 65
             S IAKDVTELIG TPLVYLN + +GCV R+AAKLEMMEPCSSVKDRIG+SMI+DAE+KGL
Sbjct:     3 SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGL 62

Query:    66 IRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPA 125
             I+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAFG ELVLTDPA
Sbjct:    63 IKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPA 122

Query:   126 RGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSXXXX 185
             +GMKGA+ KAEEI  KTPN Y+LQQFENPANPKIHYETTGPEIWKGTGGKID  VS    
Sbjct:   123 KGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGT 182

Query:   186 XXXXXXXXKYLKEHNPEIKLYGVEPVESAVLSGGKPG 222
                     KYLKE N  +KLYGVEPVESA+LSGGKPG
Sbjct:   183 GGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPG 219
GO:0003824 "catalytic activity" evidence=IEA
GO:0004124 "cysteine synthase activity" evidence=IEA;IGI;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006535 "cysteine biosynthetic process from serine" evidence=IEA;TAS
GO:0008152 "metabolic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0005829 "cytosol" evidence=ISS;IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA;IMP;IDA
GO:0007568 "aging" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0019344 "cysteine biosynthetic process" evidence=RCA;IMP
GO:0048046 "apoplast" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006816 "calcium ion transport" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143754 DES1 "L-cysteine desulfhydrase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096454 CS26 "cysteine synthase 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ1 CAS2 "L-3-cyanoalanine synthase 2, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0A535CYSK_MYCBO2, ., 5, ., 1, ., 4, 70.56740.95530.6903yesno
P0A534CYSK_MYCTU2, ., 5, ., 1, ., 4, 70.56740.95530.6903yesno
P63871CYSK_STAAN2, ., 5, ., 1, ., 4, 70.53050.93750.6774yesno
P63872CYSK_STAAW2, ., 5, ., 1, ., 4, 70.53050.93750.6774yesno
P37887CYSK_BACSU2, ., 5, ., 1, ., 4, 70.59250.95080.6915yesno
P63870CYSK_STAAM2, ., 5, ., 1, ., 4, 70.53050.93750.6774yesno
P47998CYSK1_ARATH2, ., 5, ., 1, ., 4, 70.84330.96870.6739yesno
Q8KA48CYSK_BUCAP2, ., 5, ., 1, ., 4, 70.53050.91960.6397yesno
P38076CYSK_WHEAT2, ., 5, ., 1, ., 4, 70.84180.95980.6615N/Ano
Q6GJF8CYSK_STAAR2, ., 5, ., 1, ., 4, 70.53050.93750.6774yesno
Q6GBX5CYSK_STAAS2, ., 5, ., 1, ., 4, 70.53050.93750.6774yesno
O81154CYSK_SOLTU2, ., 5, ., 1, ., 4, 70.83330.99100.6830N/Ano
Q5HIG2CYSK_STAAC2, ., 5, ., 1, ., 4, 70.53050.93750.6774yesno
P0A1E3CYSK_SALTY2, ., 5, ., 1, ., 4, 70.55340.92850.6439yesno
Q8CMT6CYSK_STAES2, ., 5, ., 1, ., 4, 70.53770.93300.6741yesno
O32978CYSK_MYCLE2, ., 5, ., 1, ., 4, 70.56270.95530.6903yesno
Q7DDL5CYSK_NEIMB2, ., 5, ., 1, ., 4, 70.55550.95530.6903yesno
Q43317CYSK_CITLA2, ., 5, ., 1, ., 5, 20.89630.99100.6830N/Ano
Q00834CYSK_SPIOL2, ., 5, ., 1, ., 4, 70.86930.99100.6830N/Ano
P80608CYSK_MAIZE2, ., 5, ., 1, ., 4, 70.81980.99100.6830N/Ano
O23733CYSK1_BRAJU2, ., 5, ., 1, ., 4, 70.83870.96870.6739N/Ano
Q5HRP1CYSK_STAEQ2, ., 5, ., 1, ., 4, 70.53770.93300.6741yesno
Q9XEA6CYSK1_ORYSJ2, ., 5, ., 1, ., 4, 70.85110.95980.6697yesno
O23735CYSK2_BRAJU2, ., 5, ., 1, ., 4, 70.83720.95980.6635N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.470.991
3rd Layer2.5.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.1757000202
O-acetylserine (thiol) lyase (EC-2.5.1.47) (326 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pm.C_LG_XV0472
serine O-acetyltransferase (EC-2.3.1.30) (293 aa)
• •  •• 0.942
estExt_fgenesh4_pg.C_410108
serine O-acetyltransferase (EC-2.3.1.30) (294 aa)
• •  •• 0.942
estExt_fgenesh4_pm.C_LG_I1139
serine O-acetyltransferase (EC-2.3.1.30) (334 aa)
• •  •• 0.939
estExt_fgenesh4_pg.C_LG_V0392
hypothetical protein (395 aa)
  •  •• 0.923
gw1.IX.3567.1
sulfite reductase (EC-1.8.7.1) (576 aa)
     •• 0.917
gw1.I.1513.1
sulfite reductase (EC-1.8.7.1) (634 aa)
     •• 0.914
estExt_Genewise1_v1.C_LG_I4741
phosphateglycerate kinase (EC-2.5.1.47) (424 aa)
  •  •••0.907
gw1.XIV.1323.1
cysteine synthase/L-3-cyanoalanine synthase (EC-4.4.1.9) (342 aa)
  •  • •0.902
grail3.0039007102
RecName- Full=Cysteine synthase; EC=2.5.1.47; (375 aa)
  •  • •0.902
gw1.10449.1.1
annotation not avaliable (181 aa)
  •  • •0.901

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
PLN02565 322 PLN02565, PLN02565, cysteine synthase 1e-151
TIGR01136299 TIGR01136, cysKM, cysteine synthase 1e-119
TIGR01139298 TIGR01139, cysK, cysteine synthase A 1e-117
PLN00011323 PLN00011, PLN00011, cysteine synthase 1e-116
cd01561291 cd01561, CBS_like, CBS_like: This subgroup include 1e-113
PLN03013429 PLN03013, PLN03013, cysteine synthase 1e-112
PLN02556 368 PLN02556, PLN02556, cysteine synthase/L-3-cyanoala 1e-108
COG0031300 COG0031, CysK, Cysteine synthase [Amino acid trans 1e-106
PRK10717 330 PRK10717, PRK10717, cysteine synthase A; Provision 2e-86
PRK11761296 PRK11761, cysM, cysteine synthase B; Provisional 4e-81
TIGR01137 454 TIGR01137, cysta_beta, cystathionine beta-synthase 1e-71
TIGR01138290 TIGR01138, cysM, cysteine synthase B 5e-71
cd00640244 cd00640, Trp-synth-beta_II, Tryptophan synthase be 2e-65
TIGR03945304 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio 2e-55
pfam00291295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 3e-49
PLN02356 423 PLN02356, PLN02356, phosphateglycerate kinase 2e-32
COG1171 347 COG1171, IlvA, Threonine dehydratase [Amino acid t 5e-17
cd01562304 cd01562, Thr-dehyd, Threonine dehydratase: The fir 5e-15
TIGR01124 499 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, b 4e-12
TIGR01127 380 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, m 4e-11
PRK12483 521 PRK12483, PRK12483, threonine dehydratase; Reviewe 5e-11
PLN02550 591 PLN02550, PLN02550, threonine dehydratase 3e-09
cd01563 324 cd01563, Thr-synth_1, Threonine synthase is a pyri 5e-08
PRK06608 338 PRK06608, PRK06608, threonine dehydratase; Provisi 1e-07
TIGR02079 409 TIGR02079, THD1, threonine dehydratase 9e-07
PRK09224 504 PRK09224, PRK09224, threonine dehydratase; Reviewe 1e-06
PRK06815317 PRK06815, PRK06815, hypothetical protein; Provisio 2e-06
PRK06382 406 PRK06382, PRK06382, threonine dehydratase; Provisi 2e-06
PRK08526 403 PRK08526, PRK08526, threonine dehydratase; Provisi 2e-06
PRK06381 319 PRK06381, PRK06381, threonine synthase; Validated 2e-06
PRK06721 352 PRK06721, PRK06721, threonine synthase; Reviewed 2e-05
PRK08329347 PRK08329, PRK08329, threonine synthase; Validated 2e-05
PRK08638 333 PRK08638, PRK08638, threonine dehydratase; Validat 6e-05
PRK06450338 PRK06450, PRK06450, threonine synthase; Validated 7e-05
PRK08639 420 PRK08639, PRK08639, threonine dehydratase; Validat 8e-05
COG0498 411 COG0498, ThrC, Threonine synthase [Amino acid tran 8e-05
PRK06110322 PRK06110, PRK06110, hypothetical protein; Provisio 2e-04
TIGR03528 396 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammoni 0.001
PRK08246310 PRK08246, PRK08246, threonine dehydratase; Provisi 0.002
PRK06352 351 PRK06352, PRK06352, threonine synthase; Validated 0.002
TIGR01747 376 TIGR01747, diampropi_NH3ly, diaminopropionate ammo 0.003
>gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase Back     alignment and domain information 
 Score =  422 bits (1086), Expect = e-151
 Identities = 202/219 (92%), Positives = 212/219 (96%)

Query: 4   EKSVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEK 63
           EKS IAKDVTELIGKTPLVYLN +VDGCVARIAAKLEMMEPCSSVKDRIGYSMI DAEEK
Sbjct: 1   EKSSIAKDVTELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEK 60

Query: 64  GLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTD 123
           GLI+PGESVLIEPTSGNTGIGLAFMAAAKGY+LIITMPASMSLERR++LLAFGAELVLTD
Sbjct: 61  GLIKPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAELVLTD 120

Query: 124 PARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGI 183
           PA+GMKGAVQKAEEI  KTPNSY+LQQFENPANPKIHYETTGPEIWKGTGGK+DA VSGI
Sbjct: 121 PAKGMKGAVQKAEEILAKTPNSYILQQFENPANPKIHYETTGPEIWKGTGGKVDAFVSGI 180

Query: 184 GTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPG 222
           GTGGT+TGAGKYLKE NP+IKLYGVEPVESAVLSGGKPG
Sbjct: 181 GTGGTITGAGKYLKEQNPDIKLYGVEPVESAVLSGGKPG 219

Length = 322
>gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase Back     alignment and domain information
>gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A Back     alignment and domain information
>gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase Back     alignment and domain information
>gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase Back     alignment and domain information
>gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase Back     alignment and domain information
>gnl|CDD|224092 COG1171, IlvA, Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107205 cd01562, Thr-dehyd, Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>gnl|CDD|130194 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>gnl|CDD|130197 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, medium form Back     alignment and domain information
>gnl|CDD|237111 PRK12483, PRK12483, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|178165 PLN02550, PLN02550, threonine dehydratase Back     alignment and domain information
>gnl|CDD|107206 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>gnl|CDD|235842 PRK06608, PRK06608, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|233712 TIGR02079, THD1, threonine dehydratase Back     alignment and domain information
>gnl|CDD|236417 PRK09224, PRK09224, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|180709 PRK06815, PRK06815, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180550 PRK06382, PRK06382, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|181457 PRK08526, PRK08526, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|235789 PRK06381, PRK06381, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|136018 PRK06721, PRK06721, threonine synthase; Reviewed Back     alignment and domain information
>gnl|CDD|236244 PRK08329, PRK08329, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|236317 PRK08638, PRK08638, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|180565 PRK06450, PRK06450, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|236318 PRK08639, PRK08639, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|223572 COG0498, ThrC, Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235699 PRK06110, PRK06110, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|234245 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammonia-lyase Back     alignment and domain information
>gnl|CDD|181319 PRK08246, PRK08246, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|180539 PRK06352, PRK06352, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|130808 TIGR01747, diampropi_NH3ly, diaminopropionate ammonia-lyase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 224
COG0031300 CysK Cysteine synthase [Amino acid transport and m 100.0
PLN02565 322 cysteine synthase 100.0
PLN03013429 cysteine synthase 100.0
PLN02556 368 cysteine synthase/L-3-cyanoalanine synthase 100.0
PRK11761296 cysM cysteine synthase B; Provisional 100.0
PLN00011323 cysteine synthase 100.0
TIGR01136299 cysKM cysteine synthases. This model discriminates 100.0
COG1171 347 IlvA Threonine dehydratase [Amino acid transport a 100.0
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 100.0
TIGR01139298 cysK cysteine synthase A. This model distinguishes 100.0
PRK08526 403 threonine dehydratase; Provisional 100.0
PRK10717 330 cysteine synthase A; Provisional 100.0
PRK07476 322 eutB threonine dehydratase; Provisional 100.0
PRK08638 333 threonine dehydratase; Validated 100.0
PRK08198 404 threonine dehydratase; Provisional 100.0
KOG1252 362 consensus Cystathionine beta-synthase and related 100.0
PLN02970 328 serine racemase 100.0
PRK12483 521 threonine dehydratase; Reviewed 100.0
PRK06382 406 threonine dehydratase; Provisional 100.0
cd01561291 CBS_like CBS_like: This subgroup includes Cystathi 100.0
TIGR02991 317 ectoine_eutB ectoine utilization protein EutB. Mem 100.0
PRK06110 322 hypothetical protein; Provisional 100.0
PLN02356 423 phosphateglycerate kinase 100.0
PRK07048321 serine/threonine dehydratase; Validated 100.0
PRK08639 420 threonine dehydratase; Validated 100.0
PLN02550 591 threonine dehydratase 100.0
TIGR02079 409 THD1 threonine dehydratase. This model represents 100.0
PRK06608 338 threonine dehydratase; Provisional 100.0
cd06447 404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 100.0
PRK07334 403 threonine dehydratase; Provisional 100.0
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 100.0
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 100.0
TIGR01127 380 ilvA_1Cterm threonine dehydratase, medium form. A 100.0
PRK06815317 hypothetical protein; Provisional 100.0
cd01562304 Thr-dehyd Threonine dehydratase: The first step in 100.0
PRK06352 351 threonine synthase; Validated 100.0
PRK08813 349 threonine dehydratase; Provisional 100.0
PRK09224 504 threonine dehydratase; Reviewed 100.0
PRK02991 441 D-serine dehydratase; Provisional 100.0
cd06448 316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 100.0
PRK08246310 threonine dehydratase; Provisional 100.0
KOG1250 457 consensus Threonine/serine dehydratases [Amino aci 100.0
TIGR02035 431 D_Ser_am_lyase D-serine ammonia-lyase. This family 100.0
PRK06381319 threonine synthase; Validated 100.0
PRK07409 353 threonine synthase; Validated 100.0
PRK08197 394 threonine synthase; Validated 100.0
PRK07591 421 threonine synthase; Validated 100.0
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phos 100.0
PRK06721 352 threonine synthase; Reviewed 100.0
PRK06260 397 threonine synthase; Validated 100.0
PRK05638 442 threonine synthase; Validated 100.0
PRK06450338 threonine synthase; Validated 100.0
PLN02569 484 threonine synthase 100.0
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfa 100.0
PRK08206 399 diaminopropionate ammonia-lyase; Provisional 100.0
PRK08329347 threonine synthase; Validated 100.0
KOG1251 323 consensus Serine racemase [Signal transduction mec 100.0
TIGR01747 376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 100.0
TIGR00260328 thrC threonine synthase. Involved in threonine bio 100.0
TIGR03528 396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 100.0
PRK13028 402 tryptophan synthase subunit beta; Provisional 100.0
TIGR01415 419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 100.0
PRK04346 397 tryptophan synthase subunit beta; Validated 100.0
PLN02618 410 tryptophan synthase, beta chain 100.0
TIGR01275311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 100.0
TIGR00263 385 trpB tryptophan synthase, beta subunit. Tryptophan 100.0
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 100.0
cd06446 365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 100.0
PRK03910331 D-cysteine desulfhydrase; Validated 100.0
PRK12391 427 tryptophan synthase subunit beta; Reviewed 100.0
PF00291306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 100.0
KOG1481 391 consensus Cysteine synthase [Amino acid transport 100.0
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 100.0
PRK14045329 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
TIGR01274337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 100.0
TIGR03844 398 cysteate_syn cysteate synthase. Members of this fa 100.0
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 100.0
COG0498 411 ThrC Threonine synthase [Amino acid transport and 100.0
COG0133 396 TrpB Tryptophan synthase beta chain [Amino acid tr 99.97
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 99.96
COG1350 432 Predicted alternative tryptophan synthase beta-sub 99.94
PRK09225 462 threonine synthase; Validated 99.93
cd01560 460 Thr-synth_2 Threonine synthase catalyzes the final 99.93
KOG1395 477 consensus Tryptophan synthase beta chain [Amino ac 99.93
COG3048 443 DsdA D-serine dehydratase [Amino acid transport an 99.87
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 92.47
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 92.3
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 91.16
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 90.74
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 90.2
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 90.02
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 89.49
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 89.2
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 88.99
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 88.19
TIGR01064473 pyruv_kin pyruvate kinase. This enzyme is a homote 88.1
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 86.8
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 86.74
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 86.67
PRK03659601 glutathione-regulated potassium-efflux system prot 86.3
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 86.29
PRK03562621 glutathione-regulated potassium-efflux system prot 86.27
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 86.18
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 85.91
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 85.75
PRK09880343 L-idonate 5-dehydrogenase; Provisional 85.67
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 85.64
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 85.57
PF00764 388 Arginosuc_synth: Arginosuccinate synthase; InterPr 85.55
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 85.42
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 85.38
PRK15408336 autoinducer 2-binding protein lsrB; Provisional 85.03
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 84.82
PRK10669558 putative cation:proton antiport protein; Provision 84.71
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 84.44
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 84.41
COG2130340 Putative NADP-dependent oxidoreductases [General f 83.81
PRK08703239 short chain dehydrogenase; Provisional 83.64
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 83.01
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 82.86
PRK12743256 oxidoreductase; Provisional 82.48
TIGR00696177 wecB_tagA_cpsF bacterial polymer biosynthesis prot 82.29
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 82.21
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 81.69
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 80.86
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 80.86
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 80.72
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 80.66
PRK05993 277 short chain dehydrogenase; Provisional 80.26
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 80.11
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-56  Score=373.30  Aligned_cols=213  Identities=57%  Similarity=0.949  Sum_probs=201.1

Q ss_pred             HhhhcccCCCceeecccccCcCCceEEEEeCCCCCCCChhhHHHHHHHHHHHHcCCCCCCCcEEEeeCCChHHHHHHHHH
Q 027405           10 KDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMA   89 (224)
Q Consensus        10 ~~~~~~~~~TPl~~~~~l~~~~~~~l~~K~E~~~ptGS~K~R~a~~~l~~a~~~g~~~~g~~~vv~~ssGN~~~alA~~a   89 (224)
                      +.+.+.+++|||+++.+++...+++||+|+|++||+||.|||.+.+|+.+|+++|.++|| .+||++||||+|++||+.|
T Consensus         3 ~~~~~~iG~TPlvrL~~~~~~~~~~i~~KlE~~NP~gSvKDR~A~~mI~~Ae~~G~l~pG-~tIVE~TSGNTGI~LA~va   81 (300)
T COG0031           3 ESILDLIGNTPLVRLNRLSPGTGVEIYAKLESFNPGGSVKDRIALYMIEDAEKRGLLKPG-GTIVEATSGNTGIALAMVA   81 (300)
T ss_pred             cchHHHhCCCCcEeecccCCCCCceEEEEhhhcCCCCchhHHHHHHHHHHHHHcCCCCCC-CEEEEcCCChHHHHHHHHH
Confidence            456788999999999999888789999999999999999999999999999999999999 5899999999999999999


Q ss_pred             HHcCCeEEEEEcCCCCHHHHHHHHhCCCEEEEeCCCCC-hHHHHHHHHHHHHhCCC-eEEeCCCCCCcchHhHHHhHHHH
Q 027405           90 AAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARG-MKGAVQKAEEIRDKTPN-SYVLQQFENPANPKIHYETTGPE  167 (224)
Q Consensus        90 ~~~g~~~~ivvp~~~~~~~~~~~~~~Ga~V~~~~~~~~-~~~~~~~a~~~~~~~~~-~~~~~~~~~~~~~~~g~~t~a~E  167 (224)
                      +.+|+++++|||++++.+|+++|+.|||+|+.++...+ +..+.+++++++++.++ .+|++||+||.||.+||.|+|.|
T Consensus        82 a~~Gy~~iivmP~~~S~er~~~l~a~GAevi~t~~~~g~~~~a~~~a~el~~~~p~~~~~~~Qf~NpaN~~aH~~tT~~E  161 (300)
T COG0031          82 AAKGYRLIIVMPETMSQERRKLLRALGAEVILTPGAPGNMKGAIERAKELAAEIPGYAVWLNQFENPANPEAHYETTGPE  161 (300)
T ss_pred             HHcCCcEEEEeCCCCCHHHHHHHHHcCCEEEEcCCCCCchHHHHHHHHHHHHhCCCceEchhhcCCCccHHHHHhhhHHH
Confidence            99999999999999999999999999999999998444 88899999999998877 77888999999999999999999


Q ss_pred             HHHhhCCCCCEEEEccCchhHHHHHHHHHHhcCCCcEEEEEeCCCCccccCCCCCCC
Q 027405          168 IWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGGL  224 (224)
Q Consensus       168 i~~q~~~~~d~iv~pvG~Gg~~~Gi~~~~k~~~~~~~vigve~~~~~~~~~~~~~~~  224 (224)
                      |++|+++.+|++|+++|||||++|++++||+.+|++|+|+|||++|+.+.+|. +||
T Consensus       162 I~~~~~g~~d~fVagvGTGGTitGvar~Lk~~~p~i~iv~vdP~~S~~~~~G~-g~~  217 (300)
T COG0031         162 IWQQTDGKVDAFVAGVGTGGTITGVARYLKERNPNVRIVAVDPEGSVLLSGGE-GPH  217 (300)
T ss_pred             HHHHhCCCCCEEEEeCCcchhHHHHHHHHHhhCCCcEEEEECCCCCcccCCCC-CCc
Confidence            99999888999999999999999999999999999999999999999988776 665

>PLN02565 cysteine synthase Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK15408 autoinducer 2-binding protein lsrB; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
2isq_A 320 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-99
1z7w_A 322 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-99
1z7y_A 322 Crystal Structure Of The Arabidopsis Thaliana O-Ace 4e-99
4aec_A 430 Crystal Structure Of The Arabidopsis Thaliana O-Ace 1e-88
3vbe_A 344 Crystal Structure Of Beta-Cyanoalanine Synthase In 1e-75
3vc3_A 344 Crystal Structure Of Beta-Cyanoalanine Synthase K95 5e-75
2q3d_A313 2.2 A Resolution Crystal Structure Of O-acetylserin 6e-62
2q3b_A313 1.8 A Resolution Crystal Structure Of O-Acetylserin 3e-61
3rr2_A314 Structure Of A Cysteine Synthase (O-Acetylserine Su 2e-58
4i1y_A314 The Structure Of Cysteine Synthase From Mycobacteri 6e-58
2egu_A308 Crystal Structure Of O-Acetylserine Sulfhydrase Fro 6e-56
1ve1_A304 Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh 7e-54
1oas_A 322 O-Acetylserine Sulfhydrylase From Salmonella Typhim 5e-53
1d6s_A 322 Crystal Structure Of The K41a Mutant Of O-Acetylser 2e-52
4air_A 354 Leishmania Major Cysteine Synthase Length = 354 2e-50
3t4p_A 334 Crystal Structure Of O-Acetyl Serine Sulfhydrylase 2e-49
2bht_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase B 9e-43
2bhs_A303 Crystal Structure Of Cysteine Synthase B Length = 3 1e-42
2jc3_A303 Structure Of O-acetylserine Sulfhydrylase B From Sa 3e-42
2v03_A303 High Resolution Structure And Catalysis Of An O- Ac 4e-42
1y7l_A316 O-Acetylserine Sulfhydrylase Complex Length = 316 8e-42
3fca_A291 Genetic Incorporation Of A Metal-Ion Chelating Amin 2e-41
1o58_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase ( 2e-41
3pc2_A 527 Full Length Structure Of Cystathionine Beta-Synthas 7e-39
1m54_A 363 Cystathionine-Beta Synthase: Reduced Vicinal Thiols 2e-37
1jbq_A 435 Structure Of Human Cystathionine Beta-Synthase: A U 3e-37
3bm5_A 338 Crystal Structure Of O-Acetyl-Serine Sulfhydrylase 3e-36
2pqm_A 343 Crystal Structure Of Cysteine Synthase (Oass) From 4e-36
3dwg_A325 Crystal Structure Of A Sulfur Carrier Protein Compl 2e-33
3dwi_A323 Crystal Structure Of Mycobacterium Tuberculosis Cys 1e-32
3dki_A326 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac 1e-32
1wkv_A389 Crystal Structure Of O-Phosphoserine Sulfhydrylase 5e-06
3vsc_A389 Crystal Structure Of The K127a Mutant Of O-Phosphos 2e-05
>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 Back     alignment and structure 
Iteration: 1

 Score =  358 bits (920), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 188/217 (86%)
Query: 6   SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGL 65
           S IAKDVTELIG TPLVYLN + +GCV R+AAKLEMMEPCSSVKDRIG+SMI+DAE+KGL
Sbjct: 1   SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGL 60
Query: 66  IRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPA 125
           I+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAFG ELVLTDPA
Sbjct: 61  IKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPA 120
Query: 126 RGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSXXXX 185
           +GMKGA+ KAEEI  KTPN Y+LQQFENPANPKIHYETTGPEIWKGTGGKID  VS    
Sbjct: 121 KGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGT 180
Query: 186 XXXXXXXXKYLKEHNPEIKLYGVEPVESAVLSGGKPG 222
                   KYLKE N  +KLYGVEPVESA+LSGGKPG
Sbjct: 181 GGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPG 217
>pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 Back     alignment and structure
>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 Back     alignment and structure
>pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 Back     alignment and structure
>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 Back     alignment and structure
>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 Back     alignment and structure
>pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 Back     alignment and structure
>pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 Back     alignment and structure
>pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 Back     alignment and structure
>pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 Back     alignment and structure
>pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 Back     alignment and structure
>pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 Back     alignment and structure
>pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Back     alignment and structure
>pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 Back     alignment and structure
>pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 Back     alignment and structure
>pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 Back     alignment and structure
>pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 Back     alignment and structure
>pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 Back     alignment and structure
>pdb|1Y7L|A Chain A, O-Acetylserine Sulfhydrylase Complex Length = 316 Back     alignment and structure
>pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 Back     alignment and structure
>pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 Back     alignment and structure
>pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 Back     alignment and structure
>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 Back     alignment and structure
>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 Back     alignment and structure
>pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 Back     alignment and structure
>pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 Back     alignment and structure
>pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 Back     alignment and structure
>pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 Back     alignment and structure
>pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 Back     alignment and structure
>pdb|1WKV|A Chain A, Crystal Structure Of O-Phosphoserine Sulfhydrylase Length = 389 Back     alignment and structure
>pdb|3VSC|A Chain A, Crystal Structure Of The K127a Mutant Of O-Phosphoserine Sulfhydrylase Complexed With External Schiff Base Of Pyridoxal 5'-Phosphate With O- Phospho-L-Serine Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
1z7w_A 322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 1e-156
4aec_A 430 Cysteine synthase, mitochondrial; lyase, cysteine 1e-155
3tbh_A 334 O-acetyl serine sulfhydrylase; cysteine synthase, 1e-154
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 1e-154
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 1e-148
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 1e-145
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 1e-144
2pqm_A 343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 1e-144
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 1e-138
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 1e-137
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 1e-127
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 1e-119
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-118
1jbq_A 435 B, cystathionine beta-synthase, serine sulfhydrase 1e-117
2d1f_A 360 Threonine synthase; amino acid synthesis, pyridoxa 2e-14
1e5x_A 486 Threonine synthase; threonine biosynthesis, PLP en 5e-14
1p5j_A 372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 9e-14
2zsj_A 352 Threonine synthase; PLP dependent enzyme, lyase; H 2e-13
4d9i_A 398 Diaminopropionate ammonia-lyase; fold type II PLP- 1e-12
3aey_A 351 Threonine synthase; PLP, pyridoxal phosphate, lyas 1e-12
3ss7_X 442 D-serine dehydratase; type II fold, ALFA,beta-elim 5e-12
2rkb_A 318 Serine dehydratase-like; PLP bound enzyme, enzyme 9e-12
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 3e-11
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 7e-11
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 1e-10
3iau_A 366 Threonine deaminase; pyridoxal phosphate, amino-ac 2e-10
3l6b_A 346 Serine racemase; pyridoxal phosphate, PLP, isomera 4e-10
2gn0_A 342 Threonine dehydratase catabolic; TDCB, biodegradat 5e-10
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 Back     alignment and structure
 Score =  434 bits (1119), Expect = e-156
 Identities = 182/215 (84%), Positives = 199/215 (92%)

Query: 8   IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIR 67
           IAKDVTELIG TPLVYLN + +GCV R+AAKLEMMEPCSSVKDRIG+SMI+DAE+KGLI+
Sbjct: 5   IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 64

Query: 68  PGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARG 127
           PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAFG ELVLTDPA+G
Sbjct: 65  PGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKG 124

Query: 128 MKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGTGG 187
           MKGA+ KAEEI  KTPN Y+LQQFENPANPKIHYETTGPEIWKGTGGKID  VSGIGTGG
Sbjct: 125 MKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGG 184

Query: 188 TVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPG 222
           T+TGAGKYLKE N  +KLYGVEPVESA+LSGGKPG
Sbjct: 185 TITGAGKYLKEQNANVKLYGVEPVESAILSGGKPG 219
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Length = 360 Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Length = 486 Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Length = 372 Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Length = 352 Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Length = 398 Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Length = 351 Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Length = 442 Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Length = 318 Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Length = 311 Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Length = 323 Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Length = 514 Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Length = 366 Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* Length = 346 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
3vc3_A 344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 100.0
4aec_A 430 Cysteine synthase, mitochondrial; lyase, cysteine 100.0
3tbh_A 334 O-acetyl serine sulfhydrylase; cysteine synthase, 100.0
1z7w_A 322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 100.0
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 100.0
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 100.0
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 100.0
2pqm_A 343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 100.0
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 100.0
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 100.0
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 100.0
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 100.0
3l6b_A 346 Serine racemase; pyridoxal phosphate, PLP, isomera 100.0
1jbq_A 435 B, cystathionine beta-synthase, serine sulfhydrase 100.0
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 100.0
4h27_A 364 L-serine dehydratase/L-threonine deaminase; PLP de 100.0
2gn0_A 342 Threonine dehydratase catabolic; TDCB, biodegradat 100.0
1p5j_A 372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 100.0
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 100.0
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 100.0
2rkb_A 318 Serine dehydratase-like; PLP bound enzyme, enzyme 100.0
2d1f_A 360 Threonine synthase; amino acid synthesis, pyridoxa 100.0
3aey_A 351 Threonine synthase; PLP, pyridoxal phosphate, lyas 100.0
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 100.0
2zsj_A 352 Threonine synthase; PLP dependent enzyme, lyase; H 100.0
3ss7_X 442 D-serine dehydratase; type II fold, ALFA,beta-elim 100.0
3iau_A 366 Threonine deaminase; pyridoxal phosphate, amino-ac 100.0
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 100.0
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 100.0
4d9i_A 398 Diaminopropionate ammonia-lyase; fold type II PLP- 100.0
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 100.0
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 100.0
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 100.0
1x1q_A 418 Tryptophan synthase beta chain; structural genomic 100.0
1e5x_A 486 Threonine synthase; threonine biosynthesis, PLP en 100.0
1v8z_A 388 Tryptophan synthase beta chain 1; beta+alpha, rike 100.0
1qop_B 396 Tryptophan synthase beta chain; lyase, carbon-oxyg 100.0
2o2e_A 422 Tryptophan synthase beta chain; amino-acid biosynt 100.0
1vb3_A 428 Threonine synthase; PLP-dependent enzyme, lyase; H 100.0
4f4f_A 468 Threonine synthase; structural genomics, niaid, na 100.0
1kl7_A 514 Threonine synthase; threonine synthesis, pyridoxal 100.0
3v7n_A 487 Threonine synthase; ssgcid, structural genomics, s 100.0
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.85
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 93.7
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 93.64
1vp8_A201 Hypothetical protein AF0103; putative pyruvate kin 93.3
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 93.3
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 93.25
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.08
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 92.75
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 92.61
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 92.51
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 92.45
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 92.26
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 92.02
4eye_A342 Probable oxidoreductase; structural genomics, niai 91.93
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 91.81
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 91.76
3gms_A340 Putative NADPH:quinone reductase; structural genom 91.7
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 91.34
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 91.0
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 90.91
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 90.85
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 90.68
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 90.67
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 90.63
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 90.58
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 90.56
3krt_A456 Crotonyl COA reductase; structural genomics, prote 90.56
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 90.48
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 90.46
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 90.27
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 90.14
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 90.02
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 89.91
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 89.89
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 89.74
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 89.65
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 89.65
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 89.61
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 89.59
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 89.51
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 89.17
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 88.95
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 88.9
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 88.61
3fbg_A346 Putative arginate lyase; structural genomics, unkn 88.53
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 88.42
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.42
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 88.35
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 88.18
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 88.04
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 87.76
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 87.72
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 87.45
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 87.42
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 87.16
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 87.01
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 86.93
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 86.42
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 86.42
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 86.37
1t57_A206 Conserved protein MTH1675; structural genomics, FM 86.34
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 86.3
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 86.21
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 85.93
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 85.85
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 85.78
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 85.65
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 85.56
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 85.44
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 85.39
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 85.01
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 84.98
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 84.97
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 84.83
3k4h_A292 Putative transcriptional regulator; structural gen 84.54
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 84.47
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 84.37
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 84.32
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 84.24
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 83.6
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 83.39
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 83.32
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 82.89
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 82.55
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 82.44
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 82.37
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 82.14
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 82.11
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 82.1
3edm_A259 Short chain dehydrogenase; structural genomics, ox 81.74
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 81.71
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 81.67
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 81.65
3gem_A260 Short chain dehydrogenase; structural genomics, AP 81.61
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 81.48
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 81.36
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 81.31
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 81.27
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 81.24
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 81.16
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 81.14
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 81.11
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 81.07
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 80.66
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 80.65
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 80.62
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 80.61
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 80.52
3qk7_A294 Transcriptional regulators; structural genomics, N 80.52
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 80.12
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 80.1
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 80.07
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 80.06
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 80.03
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-56  Score=390.11  Aligned_cols=218  Identities=61%  Similarity=1.061  Sum_probs=203.9

Q ss_pred             hhhHhhhcccCCCceeecccccCcCCceEEEEeCCCCCCCChhhHHHHHHHHHHHHcCCCCCCCcEEEeeCCChHHHHHH
Q 027405            7 VIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLA   86 (224)
Q Consensus         7 ~~~~~~~~~~~~TPl~~~~~l~~~~~~~l~~K~E~~~ptGS~K~R~a~~~l~~a~~~g~~~~g~~~vv~~ssGN~~~alA   86 (224)
                      .+.+.|.+.|++|||+++++|++..|++||+|+|++|||||||+|++.++|.+|.++|.+.++.++||++|+||||+|+|
T Consensus        24 ~i~~~i~~lIG~TPLv~~~~Ls~~~G~~IylK~E~lnptGSfK~RgA~~~i~~a~~~g~l~~g~~~Vv~aSsGN~g~alA  103 (344)
T 3vc3_A           24 NIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIADRPAYAMITDAEEKNLITPGKTTLIEPTSGNMGISMA  103 (344)
T ss_dssp             SCBSSGGGGSCCCCEEECCSTTTTCCSEEEEEEGGGSTTSBTTHHHHHHHHHHHHHTTCCCTTTCEEEEECSSHHHHHHH
T ss_pred             hhhccHhhhcCCCceEECcccchhhCCEEEEEecCCCCCCCcHHHHHHHHHHHHHHcCCCCCCCCEEEEeCCcHHHHHHH
Confidence            46778999999999999999999999999999999999999999999999999999999999888999999999999999


Q ss_pred             HHHHHcCCeEEEEEcCCCCHHHHHHHHhCCCEEEEeCCCCChHHHHHHHHHHHHhCCCeEEeCCCCCCcchHhHHHhHHH
Q 027405           87 FMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGP  166 (224)
Q Consensus        87 ~~a~~~g~~~~ivvp~~~~~~~~~~~~~~Ga~V~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~g~~t~a~  166 (224)
                      ++|+.+|++|+||||++++..|+++++.|||+|+.++...++.++...+.++..+.++.+|++||+||.+++.||.|++.
T Consensus       104 ~~aa~~G~~~~IvmP~~~~~~k~~~~~~~GA~Vv~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~np~~~~a~~~t~g~  183 (344)
T 3vc3_A          104 FMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGP  183 (344)
T ss_dssp             HHHHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHSTTEECCCTTTCHHHHHHHHHTHHH
T ss_pred             HHHHHcCCcEEEEECCCChHHHHHHHHHcCCEEEEECCCCcchHHHHHHHHHHhhccCceeccccccchhHHHHHHHHHH
Confidence            99999999999999999999999999999999999986555566666666666666789999999999998999999999


Q ss_pred             HHHHhhCCCCCEEEEccCchhHHHHHHHHHHhcCCCcEEEEEeCCCCccccCCCCCCC
Q 027405          167 EIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGGL  224 (224)
Q Consensus       167 Ei~~q~~~~~d~iv~pvG~Gg~~~Gi~~~~k~~~~~~~vigve~~~~~~~~~~~~~~~  224 (224)
                      ||++|+++.+|+||+|+|+||+++|++.++|+.+|++|||+|||.+++++.++.+++|
T Consensus       184 EI~eq~~~~~d~vv~~vGgGG~~~Gi~~~~k~~~p~v~vigVep~~s~~l~~~~~~~~  241 (344)
T 3vc3_A          184 EIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLNGGKPGPH  241 (344)
T ss_dssp             HHHHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCGGGTCCCCCC
T ss_pred             HHHHHhCCCceEEEEecCCccchHHHhhhhHhhCCCceEEEEcCCCChhhcCCCCCCe
Confidence            9999998899999999999999999999999999999999999999999999988775
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1vp8_A Hypothetical protein AF0103; putative pyruvate kinase, structural genomics, joint center structural genomics, JCSG; HET: MSE FMN; 1.30A {Archaeoglobus fulgidus} SCOP: c.49.1.2 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>1t57_A Conserved protein MTH1675; structural genomics, FMN; HET: FMN; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.49.1.2 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 224
d1z7wa1 320 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C 4e-60
d1y7la1310 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C 2e-48
d1o58a_293 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 5e-48
d1jbqa_ 355 c.79.1.1 (A:) Cystathionine beta-synthase {Human ( 1e-47
d1ve1a1302 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C 2e-46
d1fcja_302 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 8e-44
d2bhsa1292 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C 2e-39
d1wkva1382 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C 4e-32
d1tdja1 331 c.79.1.1 (A:5-335) Threonine deaminase {Escherichi 9e-31
d1v71a1318 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S 2e-25
d1tyza_338 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 4e-23
d1ve5a1310 c.79.1.1 (A:2-311) Threonine deaminase {Thermus th 7e-21
d1e5xa_ 477 c.79.1.1 (A:) Threonine synthase {Mouse-ear cress 6e-20
d1j0aa_325 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-19
d1f2da_341 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 3e-19
d1v8za1 386 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun 1e-18
d1p5ja_ 319 c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa 6e-17
d1v7ca_ 351 c.79.1.1 (A:) Threonine synthase {Thermus thermoph 4e-15
d1qopb_ 390 c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S 6e-15
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  189 bits (480), Expect = 4e-60
 Identities = 183/217 (84%), Positives = 200/217 (92%)

Query: 6   SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGL 65
           S IAKDVTELIG TPLVYLN + +GCV R+AAKLEMMEPCSSVKDRIG+SMI+DAE+KGL
Sbjct: 1   SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGL 60

Query: 66  IRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPA 125
           I+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAFG ELVLTDPA
Sbjct: 61  IKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPA 120

Query: 126 RGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIGT 185
           +GMKGA+ KAEEI  KTPN Y+LQQFENPANPKIHYETTGPEIWKGTGGKID  VSGIGT
Sbjct: 121 KGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGT 180

Query: 186 GGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPG 222
           GGT+TGAGKYLKE N  +KLYGVEPVESA+LSGGKPG
Sbjct: 181 GGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPG 217
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
d1z7wa1 320 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ve1a1302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1jbqa_ 355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 100.0
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1p5ja_ 319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1tdja1 331 Threonine deaminase {Escherichia coli [TaxId: 562] 100.0
d1ve5a1310 Threonine deaminase {Thermus thermophilus [TaxId: 100.0
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1v7ca_ 351 Threonine synthase {Thermus thermophilus [TaxId: 2 100.0
d1e5xa_ 477 Threonine synthase {Mouse-ear cress (Arabidopsis t 100.0
d1v8za1 386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1qopb_ 390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1j0aa_325 1-aminocyclopropane-1-carboxylate deaminase {Archa 100.0
d1tyza_338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 100.0
d1f2da_341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 99.97
d1vb3a1 428 Threonine synthase {Escherichia coli [TaxId: 562]} 99.8
d1kl7a_ 511 Threonine synthase {Baker's yeast (Saccharomyces c 99.31
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.45
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.34
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.23
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.2
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.95
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.83
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.82
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.72
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.51
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.41
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.3
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.24
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 95.21
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.06
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.88
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.85
d1vp8a_190 Hypothetical protein AF0103 {Archaeoglobus fulgidu 94.23
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 93.97
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.71
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.61
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 93.44
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 92.99
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.96
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.95
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 92.76
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 92.4
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 92.23
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 91.37
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 91.33
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 90.94
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.7
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 90.46
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 89.96
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 89.47
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 89.32
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.02
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 88.91
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 88.91
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.82
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 88.69
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 88.66
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 88.57
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 88.17
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 87.99
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 87.98
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 87.9
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 87.88
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 87.55
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 86.51
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.49
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 86.2
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 86.15
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 85.98
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 85.83
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 85.74
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 85.72
d1t57a_186 Hypothetical protein MTH1675 {Methanobacterium the 85.62
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 85.58
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 85.51
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 85.42
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 84.76
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 84.15
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 84.13
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 83.92
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 83.5
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 82.68
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 81.96
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 81.43
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 80.48
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=2.5e-53  Score=364.35  Aligned_cols=218  Identities=83%  Similarity=1.312  Sum_probs=197.9

Q ss_pred             hhhHhhhcccCCCceeecccccCcCCceEEEEeCCCCCCCChhhHHHHHHHHHHHHcCCCCCCCcEEEeeCCChHHHHHH
Q 027405            7 VIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLA   86 (224)
Q Consensus         7 ~~~~~~~~~~~~TPl~~~~~l~~~~~~~l~~K~E~~~ptGS~K~R~a~~~l~~a~~~g~~~~g~~~vv~~ssGN~~~alA   86 (224)
                      ++.+.+.+.+++|||+++++|++..+.+||+|+|++|||||||||++.++|.+|+++|.+.++...+|++|+||||.|+|
T Consensus         2 ~i~~~i~~~iG~TPLv~~~~l~~~~g~~i~~K~E~~nptGSfKdRgA~~~i~~a~~~g~~~~~~~~vv~aSsGN~g~a~A   81 (320)
T d1z7wa1           2 RIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLA   81 (320)
T ss_dssp             CCCSSGGGGSSCCCEEECCGGGTTCSSEEEEEEGGGSTTSBTHHHHHHHHHHHHHHTTSCCTTTCEEEEECSSHHHHHHH
T ss_pred             chhhhhhhhcCCCCeEECCCcccccCCEEEEEeCCCCCccCcHHHHHHHHHHHHHHcCCCCCCCceEEeeCCchHHHHHH
Confidence            35567889999999999999999889999999999999999999999999999999998877778899999999999999


Q ss_pred             HHHHHcCCeEEEEEcCCCCHHHHHHHHhCCCEEEEeCCCCChHHHHHHHHHHHHhCCCeEEeCCCCCCcchHhHHHhHHH
Q 027405           87 FMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEIRDKTPNSYVLQQFENPANPKIHYETTGP  166 (224)
Q Consensus        87 ~~a~~~g~~~~ivvp~~~~~~~~~~~~~~Ga~V~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~g~~t~a~  166 (224)
                      ++|+.+|++|++|||+++++.|+++++.+||+|+.++...+..+....+.+...+.++++|+++++|+.|+..|+.|++.
T Consensus        82 ~~a~~~g~~~~iv~p~~~~~~k~~~i~~~Ga~vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~g~~t~~~  161 (320)
T d1z7wa1          82 FTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGP  161 (320)
T ss_dssp             HHHHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHCTTEEECCTTTCTHHHHHHHHTHHH
T ss_pred             HHHHhhccceEEeehhhhhhhhhhhhhccCcceEEeeccccccccchhHHHHHHhCCCceecccccccchHHHhhhhHHH
Confidence            99999999999999999999999999999999999986433334444444445555689999999999998999999999


Q ss_pred             HHHHhhCCCCCEEEEccCchhHHHHHHHHHHhcCCCcEEEEEeCCCCccccCCCCCCC
Q 027405          167 EIWKGTGGKIDALVSGIGTGGTVTGAGKYLKEHNPEIKLYGVEPVESAVLSGGKPGGL  224 (224)
Q Consensus       167 Ei~~q~~~~~d~iv~pvG~Gg~~~Gi~~~~k~~~~~~~vigve~~~~~~~~~~~~~~~  224 (224)
                      ||.+|+.+.+|+||+|+|+||+++|++.+|+..+|++++|+|||.+++.+.++.++++
T Consensus       162 EI~~q~~~~~D~vv~~vGgGg~~~Gi~~~~k~~~~~~~~igve~~~s~~~~~~~~~~~  219 (320)
T d1z7wa1         162 EIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPH  219 (320)
T ss_dssp             HHHHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCGGGTCCCCCC
T ss_pred             HHHHhccCCCCEEEeCCCCCcccchhhhhhhhhhcceeeecccccCCccccCCCCCCc
Confidence            9999997789999999999999999999999999999999999999999988876654
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vp8a_ c.49.1.2 (A:) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t57a_ c.49.1.2 (A:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure