Citrus Sinensis ID: 027484

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MAAAAVFSYRIFCPIRCSAASNNHDPNKQKLNNISYSGNSTRSTKVDLHSQTTGVASTFVASVAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEELL
cccccEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccEEEccccEEEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHccccEEEEEEEEEEEEEEccccccEEEEEEEEccccccEEEEEEEEEEccccEEEEEEEEEEEEEccccc
cccEEEEEEEEEEEEEEEcccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEccEEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccEEEEEEEEEEEEEccccccEEEEEEccccccccccEEEEEEEEcccccEEEEEcEEEEEcHHHHc
MAAAAVFSYRIfcpircsaasnnhdpnkqklnnisysgnstrstkvdlhsqttgVASTFVASVAAekegcrinevqirqniptkkqfvdpyrhgliieggvgyrQTVVVRSyevgpdktATLESILNLFQETALNHVWMsgllsngfgathgmMRNNLIWVVSRMQVeidhypiwgeVVEIDTwvgasgkngmrrdWLIRSQATGHIFARATRYIMYALEELL
MAAAAVFSYRIFCPIRcsaasnnhdpnkqKLNNISYSGNSTRSTKVDLHSQTTGVASTFVASVAaekegcrinevqirqniptkkqfvdpYRHGLIieggvgyrqTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEELL
MAAAAVFSYRIFCPIRCSAASNNHDPNKQKLNNISYSGNSTRSTKVDLHSQTTGVASTFVASVAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEELL
***AAVFSYRIFCPIRCS***********************************GVASTFVASVAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYAL****
********YRIFCPI**************************************GVASTFVASVAAEKEG*****************FVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEELL
MAAAAVFSYRIFCPIRCSAASNNHDPNKQKLNNISYSGNSTRSTKVDLHSQTTGVASTFVASVAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEELL
*AAAAVFSYRIFCPIRCSAA******************NSTRSTKVDLHSQTTGVASTFVASVAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEELL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAAVFSYRIFCPIRCSAASNNHDPNKQKLNNISYSGNSTRSTKVDLHSQTTGVASTFVASVAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEELL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
Q9SJE2 412 Palmitoyl-acyl carrier pr yes no 0.650 0.351 0.506 2e-40
Q9SQI3 413 Palmitoyl-acyl carrier pr N/A no 0.650 0.351 0.5 8e-40
Q39513 415 Palmitoyl-acyl carrier pr N/A no 0.686 0.368 0.462 2e-37
Q9SV64 367 Oleoyl-acyl carrier prote no no 0.573 0.348 0.480 3e-31
Q42561 362 Oleoyl-acyl carrier prote no no 0.582 0.359 0.465 7e-31
Q41635 382 Lauroyl-acyl carrier prot N/A no 0.623 0.363 0.423 5e-30
Q39473 382 Myristoyl-acyl carrier pr N/A no 0.560 0.327 0.451 7e-30
Q42712 369 Oleoyl-acyl carrier prote N/A no 0.582 0.352 0.442 3e-28
>sp|Q9SJE2|FATB_ARATH Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Arabidopsis thaliana GN=FATB PE=1 SV=1 Back     alignment and function desciption
 Score =  165 bits (418), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 106/150 (70%), Gaps = 5/150 (3%)

Query: 63  VAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATL 122
           +AAEK+   ++    R ++      VDP+  G I++ G+ +RQ   +RSYE+G D++A++
Sbjct: 104 LAAEKQWMMLDWKPRRSDM-----LVDPFGIGRIVQDGLVFRQNFSIRSYEIGADRSASI 158

Query: 123 ESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEID 182
           E+++N  QETALNHV  +GLL +GFG+T  M + NLIWVV+RMQV +D YP WG+VVE+D
Sbjct: 159 ETVMNHLQETALNHVKTAGLLGDGFGSTPEMFKKNLIWVVTRMQVVVDKYPTWGDVVEVD 218

Query: 183 TWVGASGKNGMRRDWLIRSQATGHIFARAT 212
           TWV  SGKNGMRRDWL+R   TG    RA+
Sbjct: 219 TWVSQSGKNGMRRDWLVRDCNTGETLTRAS 248
Plays an essential role in chain termination during de novo fatty acid synthesis. Possesses high thioesterase activity for palmitoyl-ACP versus other acyl-ACPs. Substrate preference is 16:0 > 18:1 > 18:0 > 16:1. Plays an essential role in the supply of saturated fatty acids necessary for plant growth and seed development. Contributes to 16:0 production particularly in flowers. May be involved in the synthesis of long chain fatty acid.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|Q9SQI3|FATB_GOSHI Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Gossypium hirsutum GN=FATB1 PE=1 SV=1 Back     alignment and function description
>sp|Q39513|FATB_CUPHO Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Cuphea hookeriana GN=FATB1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SV64|FATA2_ARATH Oleoyl-acyl carrier protein thioesterase 2, chloroplastic OS=Arabidopsis thaliana GN=FATA2 PE=2 SV=1 Back     alignment and function description
>sp|Q42561|FATA1_ARATH Oleoyl-acyl carrier protein thioesterase 1, chloroplastic OS=Arabidopsis thaliana GN=FATA PE=1 SV=1 Back     alignment and function description
>sp|Q41635|FATB_UMBCA Lauroyl-acyl carrier protein thioesterase, chloroplastic OS=Umbellularia californica GN=FATB1 PE=1 SV=1 Back     alignment and function description
>sp|Q39473|FATB_CINCA Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Cinnamomum camphora GN=FATB1 PE=2 SV=1 Back     alignment and function description
>sp|Q42712|FATA_CORSA Oleoyl-acyl carrier protein thioesterase, chloroplastic (Fragment) OS=Coriandrum sativum GN=FATA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
225424120 403 PREDICTED: myristoyl-acyl carrier protei 0.892 0.493 0.796 1e-87
224108387 411 predicted protein [Populus trichocarpa] 0.914 0.496 0.677 3e-83
255570713 397 palmitoyl-acyl carrier protein thioester 0.905 0.508 0.711 2e-82
297737746 1078 unnamed protein product [Vitis vinifera] 0.780 0.161 0.818 4e-78
449465918 428 PREDICTED: palmitoyl-acyl carrier protei 0.910 0.474 0.693 1e-76
434090942 405 acyl-ACP thioesterase [Jatropha curcas] 0.905 0.498 0.669 2e-76
356574254 396 PREDICTED: myristoyl-acyl carrier protei 0.905 0.510 0.701 2e-75
356534332 397 PREDICTED: myristoyl-acyl carrier protei 0.905 0.508 0.672 2e-73
224118740 385 predicted protein [Populus trichocarpa] 0.878 0.509 0.612 3e-66
224101787 355 predicted protein [Populus trichocarpa] 0.789 0.495 0.594 1e-63
>gi|225424120|ref|XP_002280147.1| PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 160/201 (79%), Positives = 171/201 (85%), Gaps = 2/201 (0%)

Query: 13  CPIRCSAASNNHDPNKQKLNNISYSGNSTRST-KVDLHSQTTGVASTFVASVAAEKEGCR 71
           C IRCS   + HDPNKQKLNNI   G ST  T KVDL SQT G A+T + SV++  E   
Sbjct: 10  CSIRCSNRDHPHDPNKQKLNNIKVHGTSTMPTAKVDLLSQTVG-AATALTSVSSIAENGH 68

Query: 72  INEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQE 131
           I + Q+RQNIPTKKQFVDPYR GLI+EGGVGY QTVV+RSYEVGPDKTATLESILNL QE
Sbjct: 69  ITKEQLRQNIPTKKQFVDPYRQGLIVEGGVGYSQTVVIRSYEVGPDKTATLESILNLLQE 128

Query: 132 TALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKN 191
           TALNHVWMSGLL NGFGATHGMMRNNLIWVVSRMQV++DHYPIWGEVVEIDTWVGASGKN
Sbjct: 129 TALNHVWMSGLLGNGFGATHGMMRNNLIWVVSRMQVQLDHYPIWGEVVEIDTWVGASGKN 188

Query: 192 GMRRDWLIRSQATGHIFARAT 212
           GMRRDWLIRS ATG IFARAT
Sbjct: 189 GMRRDWLIRSHATGQIFARAT 209

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224108387|ref|XP_002314829.1| predicted protein [Populus trichocarpa] gi|222863869|gb|EEF01000.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255570713|ref|XP_002526311.1| palmitoyl-acyl carrier protein thioesterase [Ricinus communis] gi|223534392|gb|EEF36100.1| palmitoyl-acyl carrier protein thioesterase [Ricinus communis] Back     alignment and taxonomy information
>gi|297737746|emb|CBI26947.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449465918|ref|XP_004150674.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis sativus] gi|449519404|ref|XP_004166725.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|434090942|gb|AGB56141.1| acyl-ACP thioesterase [Jatropha curcas] Back     alignment and taxonomy information
>gi|356574254|ref|XP_003555265.1| PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356534332|ref|XP_003535710.1| PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224118740|ref|XP_002317894.1| predicted protein [Populus trichocarpa] gi|222858567|gb|EEE96114.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224101787|ref|XP_002312421.1| predicted protein [Populus trichocarpa] gi|222852241|gb|EEE89788.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
TAIR|locus:2201786 412 FATB "AT1G08510" [Arabidopsis 0.650 0.351 0.506 1.9e-37
TAIR|locus:2123256 367 AT4G13050 "AT4G13050" [Arabido 0.573 0.348 0.480 6.2e-30
TAIR|locus:2090285 362 FaTA "AT3G25110" [Arabidopsis 0.573 0.353 0.472 1e-29
TAIR|locus:2201786 FATB "AT1G08510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 402 (146.6 bits), Expect = 1.9e-37, P = 1.9e-37
 Identities = 76/150 (50%), Positives = 106/150 (70%)

Query:    63 VAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATL 122
             +AAEK+   ++    R ++      VDP+  G I++ G+ +RQ   +RSYE+G D++A++
Sbjct:   104 LAAEKQWMMLDWKPRRSDM-----LVDPFGIGRIVQDGLVFRQNFSIRSYEIGADRSASI 158

Query:   123 ESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEID 182
             E+++N  QETALNHV  +GLL +GFG+T  M + NLIWVV+RMQV +D YP WG+VVE+D
Sbjct:   159 ETVMNHLQETALNHVKTAGLLGDGFGSTPEMFKKNLIWVVTRMQVVVDKYPTWGDVVEVD 218

Query:   183 TWVGASGKNGMRRDWLIRSQATGHIFARAT 212
             TWV  SGKNGMRRDWL+R   TG    RA+
Sbjct:   219 TWVSQSGKNGMRRDWLVRDCNTGETLTRAS 248
GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=ISS;IDA
GO:0006633 "fatty acid biosynthetic process" evidence=ISS;IMP
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016790 "thiolester hydrolase activity" evidence=IEA
GO:0016297 "acyl-[acyl-carrier-protein
GO:0009536 "plastid" evidence=TAS
TAIR|locus:2123256 AT4G13050 "AT4G13050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090285 FaTA "AT3G25110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030429001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (403 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
PLN02370 419 PLN02370, PLN02370, acyl-ACP thioesterase 1e-52
pfam01643 249 pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase 2e-44
cd00586110 cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase ( 2e-09
COG3884 250 COG3884, FatA, Acyl-ACP thioesterase [Lipid metabo 0.002
>gnl|CDD|215210 PLN02370, PLN02370, acyl-ACP thioesterase Back     alignment and domain information 
 Score =  174 bits (443), Expect = 1e-52
 Identities = 71/126 (56%), Positives = 96/126 (76%)

Query: 87  FVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNG 146
            +DP+  G I++ G+ +RQ   +RSYE+G D+TA++E+++N  QETALNHV  +GLL +G
Sbjct: 124 LIDPFGIGRIVQDGLVFRQNFSIRSYEIGADRTASIETLMNHLQETALNHVKTAGLLGDG 183

Query: 147 FGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGH 206
           FG+T  M + NLIWVV+RMQV +D YP WG+VV++DTWV ASGKNGMRRDWL+R   TG 
Sbjct: 184 FGSTPEMSKRNLIWVVTRMQVLVDRYPTWGDVVQVDTWVSASGKNGMRRDWLVRDCKTGE 243

Query: 207 IFARAT 212
              RA+
Sbjct: 244 TLTRAS 249

Length = 419
>gnl|CDD|216622 pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase Back     alignment and domain information
>gnl|CDD|238329 cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>gnl|CDD|226401 COG3884, FatA, Acyl-ACP thioesterase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
PLN02370 419 acyl-ACP thioesterase 100.0
PF01643 261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 99.97
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 99.91
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 99.89
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 99.88
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 99.81
COG0824137 FcbC Predicted thioesterase [General function pred 99.81
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.76
COG3884 250 FatA Acyl-ACP thioesterase [Lipid metabolism] 99.69
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 99.68
cd03440100 hot_dog The hotdog fold was initially identified i 99.06
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 99.01
PF01643261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 98.82
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 98.64
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 98.61
PLN02370419 acyl-ACP thioesterase 98.6
PF12590129 Acyl-thio_N: Acyl-ATP thioesterase; InterPro: IPR0 98.12
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 97.61
COG3884250 FatA Acyl-ACP thioesterase [Lipid metabolism] 97.37
PRK10694133 acyl-CoA esterase; Provisional 97.33
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 97.27
COG5496130 Predicted thioesterase [General function predictio 96.81
PRK11688154 hypothetical protein; Provisional 96.22
PRK10293136 acyl-CoA esterase; Provisional 96.17
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 95.76
KOG3328148 consensus HGG motif-containing thioesterase [Gener 94.77
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 94.64
PRK10254137 thioesterase; Provisional 94.13
COG4109432 Predicted transcriptional regulator containing CBS 93.88
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 93.85
TIGR01750140 fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd 93.57
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 93.43
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 93.4
PF14539132 DUF4442: Domain of unknown function (DUF4442); PDB 93.14
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 93.08
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 92.48
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 92.44
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 91.4
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 90.91
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belo 90.7
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 90.51
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 89.89
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 88.12
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr 87.99
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 87.82
PF13452132 MaoC_dehydrat_N: N-terminal half of MaoC dehydrata 87.51
PLN02647 437 acyl-CoA thioesterase 86.7
PRK08190 466 bifunctional enoyl-CoA hydratase/phosphate acetylt 85.76
PRK04424185 fatty acid biosynthesis transcriptional regulator; 84.16
PLN02322154 acyl-CoA thioesterase 83.83
PLN02864 310 enoyl-CoA hydratase 83.09
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 82.12
PF13622 255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 80.05
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information 
Probab=100.00  E-value=4.9e-43  Score=328.74  Aligned_cols=166  Identities=47%  Similarity=0.806  Sum_probs=157.6

Q ss_pred             ccccceeeeeehhhhhhcccccchhhhhhccCCCCccccccccccccccCCceEEEEEEeeecCcCCCCCcCHHHHHHHH
Q 027484           50 SQTTGVASTFVASVAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLF  129 (223)
Q Consensus        50 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~g~~y~~~~~Vr~~E~D~~G~v~~s~Ll~~l  129 (223)
                      ||.++++||||.  ||||||++++|++.|     |++++|||++|+|++||++|+++|+|+|||||++|++++.+|+|||
T Consensus        94 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~y~~~f~Ir~yEvD~~g~lsl~~L~n~l  166 (419)
T PLN02370         94 SMLLAAITTIFL--AAEKQWMMLDWKPRR-----SDMLIDPFGIGRIVQDGLVFRQNFSIRSYEIGADRTASIETLMNHL  166 (419)
T ss_pred             HHHHHHHHHHHH--hhhhhhhhhcccCCC-----CcccccccccCceeccCcEEEEEEEEeeEEECCCCCCCHHHHHHHH
Confidence            678889999998  999999999999999     8999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhccCCCCCCcchhhhhCCeEEEEEEeEEEEeecCCCCCEEEEEEEecccCCceEEEEEEEEECCCCcEEE
Q 027484          130 QETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFA  209 (223)
Q Consensus       130 QEaA~~H~~~lgl~g~G~g~~~~l~~~g~aWVL~r~~Iei~r~P~~gD~I~I~TWv~~~~k~~~~R~f~I~d~~~Gevla  209 (223)
                      ||+|.+|++++|+++.||+..++|.+.|++|||++++|+|+|+|+|||+|+|+||+.+++++++.|+|+|+|.++|++++
T Consensus       167 Qd~A~~Hs~~lGll~~Gfg~~~~m~~~gl~WVLtr~~I~~~R~P~~gD~V~V~Twv~~~~k~~~~Rdf~I~D~~~Ge~la  246 (419)
T PLN02370        167 QETALNHVKTAGLLGDGFGSTPEMSKRNLIWVVTRMQVLVDRYPTWGDVVQVDTWVSASGKNGMRRDWLVRDCKTGETLT  246 (419)
T ss_pred             HHHHHHHHHHhCccccccccHHHHHhCCceEEEEEEEEEeCcCCCCCCEEEEEEEEeeCCCCEEEEEEEEEECCCCeEEE
Confidence            99999999999888888865468999999999999999999999999999999999999999999999999844899999


Q ss_pred             EEEEEEEEEeccc
Q 027484          210 RATRYIMYALEEL  222 (223)
Q Consensus       210 ~A~S~WVlVD~e~  222 (223)
                      +|+|.||+||.+.
T Consensus       247 ~A~SvWV~mD~~T  259 (419)
T PLN02370        247 RASSVWVMMNKLT  259 (419)
T ss_pred             EEEEEEEEEECCC
Confidence            9999999999863

>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information
>PF12590 Acyl-thio_N: Acyl-ATP thioesterase; InterPro: IPR021113 This entry represents the N-terminal domain of acyl-ATP thioesterases from bacteria and eukaryotes Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10254 thioesterase; Provisional Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioestera; 2e-28
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural gen 2e-26
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Length = 262 Back     alignment and structure
 Score =  107 bits (267), Expect = 2e-28
 Identities = 26/129 (20%), Positives = 50/129 (38%), Gaps = 10/129 (7%)

Query: 94  GLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGM 153
             +      Y +   +  YE      ATL +++++    + +        S+  G T  M
Sbjct: 3   ATLGANASLYSEQHRITYYECDRTGRATLTTLIDIAVLASEDQ-------SDALGLTTEM 55

Query: 154 M-RNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARA- 211
           +  + + WVV++  ++I   P   EVV I     A       R++ IR    G   A   
Sbjct: 56  VQSHGVGWVVTQYAIDITRMPRQDEVVTIAVRGSAYNPYFAYREFWIRDA-DGQQLAYIT 114

Query: 212 TRYIMYALE 220
           + ++M +  
Sbjct: 115 SIWVMMSQT 123
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Length = 248 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
4gak_A 250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 99.96
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioestera; 99.92
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural gen 99.91
3r87_A135 Putative uncharacterized protein; unknown function 99.89
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 99.89
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 99.89
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 99.89
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 99.88
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 99.88
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 99.88
2gf6_A135 Conserved hypothetical protein; putative thioester 99.88
1z54_A132 Probable thioesterase; hypothetical protein, struc 99.88
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 99.87
3ck1_A150 Putative thioesterase; structural genomics, joint 99.87
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 99.87
2hlj_A157 Hypothetical protein; putative thioesterase, struc 99.86
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 99.86
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 99.86
1njk_A156 Hypothetical protein YBAW; structural genomics, th 99.86
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 99.85
2fuj_A137 Conserved hypothetical protein; structural genomic 99.85
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 99.85
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 99.84
2ali_A158 Hypothetical protein PA2801; structural genomics, 99.84
2cye_A133 TTHA1846, putative thioesterase; structural genomi 99.77
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 99.53
4gak_A250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 99.47
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 99.42
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 99.32
2ess_A248 Acyl-ACP thioesterase; NP_810988.1, structural gen 99.31
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 99.26
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 99.16
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 99.09
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 99.0
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 98.91
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 98.89
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 98.86
1zki_A133 Hypothetical protein PA5202; structural genomics, 98.84
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 98.83
2gvh_A 288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 98.58
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 98.57
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 98.47
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 98.46
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 98.45
2h4u_A145 Thioesterase superfamily member 2; structural geno 98.43
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 98.39
2cwz_A141 Thioesterase family protein; structural genomics, 98.36
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 98.35
2pim_A141 Phenylacetic acid degradation-related protein; thi 98.34
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 98.24
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 98.06
1o0i_A138 Hypothetical protein HI1161; structural genomics, 98.05
3e1e_A141 Thioesterase family protein; structural genomics, 98.04
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 98.03
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 98.0
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 97.99
1sh8_A154 Hypothetical protein PA5026; structural genomics, 97.97
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 97.96
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 97.95
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 97.93
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 97.9
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 97.89
2qwz_A159 Phenylacetic acid degradation-related protein; put 97.86
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 97.73
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 97.57
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 97.52
1sc0_A138 Hypothetical protein HI1161; structural genomics, 97.34
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 97.33
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 97.32
3hdu_A157 Putative thioesterase; structural genomics, joint 97.16
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 97.15
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 96.92
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 96.85
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 96.73
1yoc_A147 Hypothetical protein PA1835; structural genomics, 96.45
2q78_A153 Uncharacterized protein; structural genomics, join 96.05
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 95.9
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 94.5
1t82_A155 Hypothetical acetyltransferase; structural genomic 94.04
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 93.97
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 93.03
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 92.42
2b3n_A159 Hypothetical protein AF1124; structural genomics, 92.38
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 91.44
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 91.28
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 91.0
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 90.33
4h4g_A160 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 90.27
4ffu_A176 Oxidase; structural genomics, protein structure in 90.04
3k67_A159 Putative dehydratase AF1124; hypothetical protein 88.59
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 82.38
3cjy_A 259 Putative thioesterase; YP_496845.1, structural gen 82.02
3bbj_A 272 Putative thioesterase II; structural genomics, joi 81.6
4e3e_A 352 MAOC domain protein dehydratase; structural genomi 80.4
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
Probab=99.96  E-value=3e-29  Score=217.31  Aligned_cols=114  Identities=22%  Similarity=0.381  Sum_probs=108.9

Q ss_pred             eEEEEEEeeecCcCCCCCcCHHHHHHHHHHHHHHHHHhhccCCCCCCcchhhhhCCeEEEEEEeEEEEeecCCCCCEEEE
Q 027484          102 GYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEI  181 (223)
Q Consensus       102 ~y~~~~~Vr~~E~D~~G~v~~s~Ll~~lQEaA~~H~~~lgl~g~G~g~~~~l~~~g~aWVL~r~~Iei~r~P~~gD~I~I  181 (223)
                      +|+++|+||+||||++||++++.|++|||++|.+|++++     |+++ ++|.+.|++|||++++|+|.++|++||+|+|
T Consensus         7 i~t~~f~Vr~~e~D~~g~v~~~~~l~~~q~a~~~~~~~~-----G~~~-~~l~~~g~~wVv~~~~i~~~r~~~~~d~v~V   80 (250)
T 4gak_A            7 IQTDTFTLRGYECDAFGRMSIPALMNLMQESANRNAIDY-----GIGI-ADLAQKGVGWMLMRFCLRIHQYPRYGDTIQL   80 (250)
T ss_dssp             CEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHHH-----TCSH-HHHHTTTEEEEEEEEEEEESSCCBTTCEEEE
T ss_pred             eEEEEEEECHHHcCCCCcCCHHHHHHHHHHHHHHHHHHc-----CCCH-HHHHhcCceEEEEEEEEEEecCCCCCCEEEE
Confidence            679999999999999999999999999999999999985     6777 6899999999999999999999999999999


Q ss_pred             EEEecccCCceEEEEEEEEECCCCcEEEEEEEEEEEEeccc
Q 027484          182 DTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEEL  222 (223)
Q Consensus       182 ~TWv~~~~k~~~~R~f~I~d~~~Gevla~A~S~WVlVD~e~  222 (223)
                      +||+.+.+++++.|+|+|+| ++|+++++|.|.||+||.+.
T Consensus        81 ~T~~~~~~~~~~~r~~~i~d-~~g~~l~~a~s~wv~iD~~t  120 (250)
T 4gak_A           81 MTYPTTVDKYFIHRDFRVLA-TDGTLLADARSTWLVFSMEK  120 (250)
T ss_dssp             EEEEEEECSSEEEEEEEEEE-TTCCEEEEEEEEEEEEETTT
T ss_pred             EEEEEEcCCCEEEEEEEEEe-CCCCEEEEEEEEEEeecccc
Confidence            99999999999999999998 89999999999999999863
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 223
d2essa1149 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroi 2e-10
d2owna1147 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesteras 1e-08
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: Acyl-ACP thioesterase-like
domain: Acyl-ACP thioesterase
species: Bacteroides thetaiotaomicron [TaxId: 818]

 Score = 55.2 bits (132), Expect = 2e-10
 Identities = 23/118 (19%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 103 YRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVV 162
                V   + V  +   T+  + N     A  H       S+       +  +N  WV+
Sbjct: 8   GTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFH------ASDRGFGIATLNEDNYTWVL 61

Query: 163 SRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALE 220
           SR+ +E+D  P   E   + TWV    +    R++ +  +    I    + + M  L 
Sbjct: 62  SRLAIELDEMPYQYEKFSVQTWVENVYRLFTDRNFAVIDKDGKKIGYARSVWAMINLN 119
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 99.96
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 99.95
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 99.89
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 99.84
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 99.82
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 99.81
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 99.8
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 99.8
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 99.8
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 99.8
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 99.78
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 99.78
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 99.76
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 99.75
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 99.74
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 99.73
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 99.67
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 99.48
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 97.99
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 97.91
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 97.76
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 97.73
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 97.73
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 97.64
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 97.6
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 97.47
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 97.47
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 97.46
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 97.39
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 97.36
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 97.35
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 97.21
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 97.18
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 96.58
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 96.44
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 96.13
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 95.96
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 92.55
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 90.56
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 90.28
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional pe 90.26
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginos 90.14
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensi 85.85
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobu 84.0
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo 83.12
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: Acyl-ACP thioesterase-like
domain: Acyl-ACP thioesterase
species: Bacteroides thetaiotaomicron [TaxId: 818]

Probab=99.96  E-value=9.2e-29  Score=196.86  Aligned_cols=117  Identities=21%  Similarity=0.253  Sum_probs=111.6

Q ss_pred             cCCceEEEEEEeeecCcCCCCCcCHHHHHHHHHHHHHHHHHhhccCCCCCCcchhhhhCCeEEEEEEeEEEEeecCCCCC
Q 027484           98 EGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGE  177 (223)
Q Consensus        98 e~g~~y~~~~~Vr~~E~D~~G~v~~s~Ll~~lQEaA~~H~~~lgl~g~G~g~~~~l~~~g~aWVL~r~~Iei~r~P~~gD  177 (223)
                      ++.++|++++.|+++|||.+||+++..|++||||+|.+|++.+     |+|+ ++|.+.|++|||.+++|+|+++|++||
T Consensus         3 ~~~~i~t~~~~v~~~~~D~~G~~~~~~y~~~~~d~~~~~~~~~-----G~~~-~~l~~~g~~~vv~~~~i~y~~~~~~gd   76 (149)
T d2essa1           3 EENKIGTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFHASDR-----GFGI-ATLNEDNYTWVLSRLAIELDEMPYQYE   76 (149)
T ss_dssp             TGGGCEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHHT-----TCSH-HHHHHTTEEEEEEEEEEEESCCCBTTC
T ss_pred             ccCcEEEEEEEeCHHHCCCCCCcCHHHHHHHHHHHHHHHHHHc-----Ccch-hhHhccCceEEEEEEEEEEeeccccCc
Confidence            4668999999999999999999999999999999999999984     7787 689999999999999999999999999


Q ss_pred             EEEEEEEecccCCceEEEEEEEEECCCCcEEEEEEEEEEEEecc
Q 027484          178 VVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIMYALEE  221 (223)
Q Consensus       178 ~I~I~TWv~~~~k~~~~R~f~I~d~~~Gevla~A~S~WVlVD~e  221 (223)
                      +|+|+||+...++.++.|+|+|++ ++|+++++|.+.||++|.+
T Consensus        77 ~v~V~t~~~~~~~~~~~~~~~i~~-~~g~~ia~a~~~~v~id~~  119 (149)
T d2essa1          77 KFSVQTWVENVYRLFTDRNFAVID-KDGKKIGYARSVWAMINLN  119 (149)
T ss_dssp             EEEEEEEEEEECSSEEEEEEEEEC-TTSCEEEEEEEEEEEEETT
T ss_pred             eeeEEEEEeeeccceEEEEEEEEe-cCCcEEEEEEEEEEEEECC
Confidence            999999999999999999999997 8899999999999999986
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure