Citrus Sinensis ID: 027740

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MVEGLKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCPVVADVTHSLQQPAGKKLDGGGVASGGLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVDGPTQWPLRNLEELLEELVAIAKVSKGKQRMNIDLTPFRD

cHHHHHHHHHHHHHccccEEccccccccHHHHHHHHHHHccccHHHHccHHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHcccccEEEEcccccccccccccccccHHHHHHccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccc

cHHHHHHHHHHHHHHccEEEEEcccHHHHHHHHccccEEEEcHHHcccHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHcccccEEEEEccEEcccccEEccccHHHHHccHcccEEEEEEcccEccccccccccccccEEcHHHHHHHHHHHHHHcccEEEEEEEccHHHccccccccEEHHHHHHHHHHHHHHHHHHcccccccEccccccc

MVEGLKILEKVkiaydipivtdvhetvqceevgkvadiiQIPAFLCRQTDLLVAAAKTGkiinikkgqfCASSVMVNSAEkvrlagnpnvmvcergtmfgyndlivdprnlewmreancpvvadvthslqqpagkkldgggvasgglreLIPCIARTAiavgvdgvfmevhddplnapvdgptqwplRNLEELLEELVAIAKVSkgkqrmnidltpfrd

MVEGLKILEkvkiaydipivtDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCPVVADVTHSLQQPAGKKLDGGGVASGGLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVDGPTQWPLRNLEELLEELVAIakvskgkqrmnidltpfrd

****LKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCPVVADVTHSLQQPAGKKLDGGGVASGGLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVDGPTQWPLRNLEELLEELVAIAKV****************

MVEGLKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCPVVADVTHSLQQP*************GLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVDGPTQWPLRNLEELLEELVAIAKVSKGKQRMNIDLTPF**

MVEGLKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCPVVADVTHSLQQPAGK********SGGLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVDGPTQWPLRNLEELLEELVAIAKVSKGKQRMNIDLTPF**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		219	2.2.26 [Sep-21-2011]
Q9AV97		290	2-dehydro-3-deoxyphosphoo	yes	no	1.0	0.755	0.899	1e-112
O50044		290	2-dehydro-3-deoxyphosphoo	N/A	no	1.0	0.755	0.913	1e-112
Q6NQL4		291	2-dehydro-3-deoxyphosphoo	no	no	1.0	0.752	0.890	1e-111
Q8RE91		278	2-dehydro-3-deoxyphosphoo	yes	no	0.908	0.715	0.524	6e-57
B8GQ74		280	2-dehydro-3-deoxyphosphoo	yes	no	0.913	0.714	0.531	1e-55
Q1H010		279	2-dehydro-3-deoxyphosphoo	yes	no	0.913	0.716	0.531	4e-55
B5EPM6		281	2-dehydro-3-deoxyphosphoo	yes	no	0.922	0.718	0.516	9e-55
B7J6R3		281	2-dehydro-3-deoxyphosphoo	yes	no	0.922	0.718	0.516	9e-55
Q604M5		283	2-dehydro-3-deoxyphosphoo	yes	no	0.922	0.713	0.502	1e-54
Q3A372		277	2-dehydro-3-deoxyphosphoo	yes	no	0.908	0.718	0.504	1e-54

>sp\|Q9AV97\|KDSA1_ARATH 2-dehydro-3-deoxyphosphooctonate aldolase 1 OS=Arabidopsis thaliana GN=KDSA1 PE=1 SV=2	Back alignment and function desciption

 Score =  404 bits (1039), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/219 (89%), Positives = 212/219 (96%)

Query: 1   MVEGLKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGK 60
           M EGLKILEKVK+AYD+PIVTDVHE+ QCE VGKVADIIQIPAFLCRQTDLLVAAA+TGK
Sbjct: 72  MAEGLKILEKVKVAYDLPIVTDVHESSQCEAVGKVADIIQIPAFLCRQTDLLVAAAQTGK 131

Query: 61  IINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCP 120
           IINIKKGQFCA SVM NSAEK+RLAGNPNVMVCERGTMFGYNDLIVDPRN EWMREANCP
Sbjct: 132 IINIKKGQFCAPSVMENSAEKIRLAGNPNVMVCERGTMFGYNDLIVDPRNFEWMREANCP 191

Query: 121 VVADVTHSLQQPAGKKLDGGGVASGGLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVD 180
           VVAD+THSLQQPAGKKLDGGGVASGGLRELIPCIARTA+AVGVDG+FMEVHDDPL+APVD
Sbjct: 192 VVADITHSLQQPAGKKLDGGGVASGGLRELIPCIARTAVAVGVDGIFMEVHDDPLSAPVD 251

Query: 181 GPTQWPLRNLEELLEELVAIAKVSKGKQRMNIDLTPFRD 219
           GPTQWPLR+LEELLEEL+AIA+V+KGKQR+ IDLTP+RD
Sbjct: 252 GPTQWPLRHLEELLEELIAIARVTKGKQRLQIDLTPYRD 290

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 5EC: 5

>sp\|O50044\|KDSA_PEA 2-dehydro-3-deoxyphosphooctonate aldolase OS=Pisum sativum GN=KDSA PE=2 SV=1	Back alignment and function description

>sp\|Q6NQL4\|KDSA2_ARATH 2-dehydro-3-deoxyphosphooctonate aldolase 2 OS=Arabidopsis thaliana GN=KDSA2 PE=2 SV=1	Back alignment and function description

>sp\|Q8RE91\|KDSA_FUSNN 2-dehydro-3-deoxyphosphooctonate aldolase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=kdsA PE=3 SV=2	Back alignment and function description

>sp\|B8GQ74\|KDSA_THISH 2-dehydro-3-deoxyphosphooctonate aldolase OS=Thioalkalivibrio sp. (strain HL-EbGR7) GN=kdsA PE=3 SV=1	Back alignment and function description

>sp\|Q1H010\|KDSA_METFK 2-dehydro-3-deoxyphosphooctonate aldolase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=kdsA PE=3 SV=1	Back alignment and function description

>sp\|B5EPM6\|KDSA_ACIF5 2-dehydro-3-deoxyphosphooctonate aldolase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=kdsA PE=3 SV=1	Back alignment and function description

>sp\|B7J6R3\|KDSA_ACIF2 2-dehydro-3-deoxyphosphooctonate aldolase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) GN=kdsA PE=3 SV=1	Back alignment and function description

>sp\|Q604M5\|KDSA_METCA 2-dehydro-3-deoxyphosphooctonate aldolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=kdsA PE=3 SV=2	Back alignment and function description

>sp\|Q3A372\|KDSA_PELCD 2-dehydro-3-deoxyphosphooctonate aldolase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=kdsA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		219
356568567		293	PREDICTED: 2-dehydro-3-deoxyphosphoocton	1.0	0.747	0.922	1e-117
363808254		291	uncharacterized protein LOC100810842 [Gl	1.0	0.752	0.917	1e-117
388510750		290	unknown [Lotus japonicus]	1.0	0.755	0.917	1e-116
449464932		289	PREDICTED: 2-dehydro-3-deoxyphosphoocton	1.0	0.757	0.899	1e-115
224062802		290	predicted protein [Populus trichocarpa]	1.0	0.755	0.931	1e-112
224085268		290	predicted protein [Populus trichocarpa]	1.0	0.755	0.926	1e-111
21360537		290	AT5g09730/F17I14_80 [Arabidopsis thalian	1.0	0.755	0.899	1e-111
15219400		290	2-dehydro-3-deoxyphosphooctonate aldolas	1.0	0.755	0.899	1e-111
6647535		290	RecName: Full=2-dehydro-3-deoxyphosphooc	1.0	0.755	0.913	1e-110
297839815		290	predicted protein [Arabidopsis lyrata su	1.0	0.755	0.899	1e-110

>gi\|356568567\|ref\|XP_003552482.1\| PREDICTED: 2-dehydro-3-deoxyphosphooctonate aldolase-like [Glycine max]	Back alignment and taxonomy information

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 212/219 (96%)

Query: 1   MVEGLKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGK 60
           M EGLKILEKVKIAYDIPIVTDVHET+QCE VG+VADIIQIPAFLCRQTDLLVAAAKTGK
Sbjct: 75  MAEGLKILEKVKIAYDIPIVTDVHETIQCEAVGRVADIIQIPAFLCRQTDLLVAAAKTGK 134

Query: 61  IINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCP 120
           IINIKKGQFCA SVM NSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCP
Sbjct: 135 IINIKKGQFCAPSVMTNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCP 194

Query: 121 VVADVTHSLQQPAGKKLDGGGVASGGLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVD 180
           +VAD+THSLQQPAGK LDGGGVASGGLRELIPCIARTA+AVGVDG+FMEVHDDPLNAPVD
Sbjct: 195 IVADITHSLQQPAGKMLDGGGVASGGLRELIPCIARTAVAVGVDGIFMEVHDDPLNAPVD 254

Query: 181 GPTQWPLRNLEELLEELVAIAKVSKGKQRMNIDLTPFRD 219
           GPTQWPLR+ +ELLEELVAIA+VSKGKQR NIDLTPFR+
Sbjct: 255 GPTQWPLRHFKELLEELVAIARVSKGKQRFNIDLTPFRE 293

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|363808254\|ref\|NP_001242237.1\| uncharacterized protein LOC100810842 [Glycine max] gi\|255640137\|gb\|ACU20359.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|388510750\|gb\|AFK43441.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|449464932\|ref\|XP_004150183.1\| PREDICTED: 2-dehydro-3-deoxyphosphooctonate aldolase-like [Cucumis sativus] gi\|449529772\|ref\|XP_004171872.1\| PREDICTED: 2-dehydro-3-deoxyphosphooctonate aldolase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224062802\|ref\|XP_002300891.1\| predicted protein [Populus trichocarpa] gi\|118484126\|gb\|ABK93946.1\| unknown [Populus trichocarpa] gi\|222842617\|gb\|EEE80164.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224085268\|ref\|XP_002307529.1\| predicted protein [Populus trichocarpa] gi\|222856978\|gb\|EEE94525.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|21360537\|gb\|AAM47465.1\| AT5g09730/F17I14_80 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|15219400|ref|NP_178068.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Arabidopsis thaliana] gi|30699423|ref|NP_849906.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Arabidopsis thaliana] gi|42572171|ref|NP_974176.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Arabidopsis thaliana] gi|79321478|ref|NP_001031300.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Arabidopsis thaliana] gi|20532134|sp|Q9AV97.2|KDSA_ARATH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName: Full=3-deoxy-D-manno-octulosonic acid 8-phosphate synthase; AltName: Full=KDO-8-phosphate synthase; Short=AtkdsA; Short=KDO 8-P synthase; Short=KDOPS; AltName: Full=Phospho-2-dehydro-3-deoxyoctonate aldolase gi|4835760|gb|AAD30227.1|AC007202_9 Strong similarity to gb|Y14272 3-deoxy-D-manno-2-octulosonate-8-phosphate synthase from Pisum sativum. ESTs gb|AA067485 and gb|AI100551 come from this gene [Arabidopsis thaliana] gi|13937187|gb|AAK50087.1|AF372947_1 At1g79500/T8K14_8 [Arabidopsis thaliana] gi|222423484|dbj|BAH19712.1| AT1G79500 [Arabidopsis thaliana] gi|332198130|gb|AEE36251.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Arabidopsis thaliana] gi|332198131|gb|AEE36252.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Arabidopsis thaliana] gi|332198132|gb|AEE36253.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Arabidopsis thaliana] gi|332198133|gb|AEE36254.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi|6647535|sp|O50044.1|KDSA_PEA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName: Full=3-deoxy-D-manno-octulosonic acid 8-phosphate synthase; AltName: Full=KDO-8-phosphate synthase; Short=KDO 8-P synthase; Short=KDOPS; AltName: Full=Phospho-2-dehydro-3-deoxyoctonate aldolase gi|2695861|emb|CAA74644.1| 3-deoxy-D-manno-2-octulosonate-8-phosphate synthase [Pisum sativum] gi|2695863|emb|CAA74645.1| 3-deoxy-D-manno-2-octulosonate-8-phosphate synthase [Pisum sativum]

Back alignment and taxonomy information

>gi\|297839815\|ref\|XP_002887789.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297333630\|gb\|EFH64048.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		219
TAIR\|locus:2206375		336	AtkdsA1 [Arabidopsis thaliana	0.917	0.598	0.875	6.1e-94
TIGR_CMR\|SPO_0947		277	SPO_0947 "3-deoxy-8-phosphooct	0.794	0.628	0.513	1e-45
TIGR_CMR\|CBU_1675		280	CBU_1675 "2-dehydro-3-deoxypho	0.821	0.642	0.513	2.7e-45
TIGR_CMR\|SO_3827		282	SO_3827 "2-dehydro-3-deoxyphos	0.831	0.645	0.497	1.5e-44
TIGR_CMR\|GSU_1894		272	GSU_1894 "2-dehydro-3-deoxypho	0.808	0.650	0.494	5e-44
TIGR_CMR\|CPS_3547		280	CPS_3547 "3-deoxy-8-phosphooct	0.904	0.707	0.441	1.1e-41
UNIPROTKB\|P0A715		284	kdsA "3-deoxy-D-manno-octuloso	0.931	0.718	0.426	1.4e-39
TIGR_CMR\|CJE_0433		271	CJE_0433 "3-deoxy-8-phosphooct	0.794	0.642	0.502	5.5e-38
UNIPROTKB\|Q9KQ29		283	kdsA "2-dehydro-3-deoxyphospho	0.821	0.636	0.443	1.9e-37
TIGR_CMR\|VC_2175		283	VC_2175 "2-dehydro-3-deoxyphos	0.821	0.636	0.443	1.9e-37

TAIR\|locus:2206375 AtkdsA1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 935 (334.2 bits), Expect = 6.1e-94, P = 6.1e-94
 Identities = 176/201 (87%), Positives = 187/201 (93%)

Query:     1 MVEGLKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGK 60
             M EGLKILEKVK+AYD+PIVTDVHE+ QCE VGKVADIIQIPAFLCRQTDLLVAAA+TGK
Sbjct:    38 MAEGLKILEKVKVAYDLPIVTDVHESSQCEAVGKVADIIQIPAFLCRQTDLLVAAAQTGK 97

Query:    61 IINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCP 120
             IINIKKGQFCA SVM NSAEK+RLAGNPNVMVCERGTMFGYNDLIVDPRN EWMREANCP
Sbjct:    98 IINIKKGQFCAPSVMENSAEKIRLAGNPNVMVCERGTMFGYNDLIVDPRNFEWMREANCP 157

Query:   121 VVADVTHSLQQPAGKKLDGGGVASGGLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVD 180
             VVAD+THSLQQPAGKKLDGGGVASGGLRELIPCIARTA+AVGVDG+FMEVHDDPL+APVD
Sbjct:   158 VVADITHSLQQPAGKKLDGGGVASGGLRELIPCIARTAVAVGVDGIFMEVHDDPLSAPVD 217

Query:   181 GPTQWPLRNXXXXXXXXVAIA 201
             GPTQWPLR+        +AIA
Sbjct:   218 GPTQWPLRHLEELLEELIAIA 238

GO:0005737 "cytoplasm" evidence=ISM;IEA;ISS

GO:0008152 "metabolic process" evidence=ISS

GO:0008676 "3-deoxy-8-phosphooctulonate synthase activity" evidence=ISS;IDA

GO:0010306 "rhamnogalacturonan II biosynthetic process" evidence=TAS

GO:0009860 "pollen tube growth" evidence=IGI

GO:0019294 "keto-3-deoxy-D-manno-octulosonic acid biosynthetic process" evidence=IDA

GO:0048868 "pollen tube development" evidence=IGI

GO:0005829 "cytosol" evidence=IDA

TIGR_CMR\|SPO_0947 SPO_0947 "3-deoxy-8-phosphooctulonate synthase" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_1675 CBU_1675 "2-dehydro-3-deoxyphosphooctonate aldolase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_3827 SO_3827 "2-dehydro-3-deoxyphosphooctonate aldolase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_1894 GSU_1894 "2-dehydro-3-deoxyphosphooctonate aldolase" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_3547 CPS_3547 "3-deoxy-8-phosphooctulonate synthase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

UNIPROTKB\|P0A715 kdsA "3-deoxy-D-manno-octulosonate 8-phosphate synthase" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|CJE_0433 CJE_0433 "3-deoxy-8-phosphooctulonate synthase" [Campylobacter jejuni RM1221 (taxid:195099)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KQ29 kdsA "2-dehydro-3-deoxyphosphooctonate aldolase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_2175 VC_2175 "2-dehydro-3-deoxyphosphooctonate aldolase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q3A372	KDSA_PELCD	2, ., 5, ., 1, ., 5, 5	0.5049	0.9086	0.7184	yes	no
Q89KV0	KDSA_BRAJA	2, ., 5, ., 1, ., 5, 5	0.5145	0.9132	0.7092	yes	no
O50044	KDSA_PEA	2, ., 5, ., 1, ., 5, 5	0.9132	1.0	0.7551	N/A	no
C3PMA0	KDSA_RICAE	2, ., 5, ., 1, ., 5, 5	0.5219	0.9132	0.7299	yes	no
Q8RE91	KDSA_FUSNN	2, ., 5, ., 1, ., 5, 5	0.5245	0.9086	0.7158	yes	no
Q5ZWA3	KDSA_LEGPH	2, ., 5, ., 1, ., 5, 5	0.5123	0.9041	0.7226	yes	no
B5EPM6	KDSA_ACIF5	2, ., 5, ., 1, ., 5, 5	0.5169	0.9223	0.7188	yes	no
Q9AV97	KDSA1_ARATH	2, ., 5, ., 1, ., 5, 5	0.8995	1.0	0.7551	yes	no
Q5X5Y5	KDSA_LEGPA	2, ., 5, ., 1, ., 5, 5	0.5123	0.9041	0.7226	yes	no
Q5WXA7	KDSA_LEGPL	2, ., 5, ., 1, ., 5, 5	0.5172	0.9041	0.7226	yes	no
A8GM05	KDSA_RICAH	2, ., 5, ., 1, ., 5, 5	0.5219	0.9132	0.7299	yes	no
Q1H010	KDSA_METFK	2, ., 5, ., 1, ., 5, 5	0.5314	0.9132	0.7168	yes	no
Q1IKD0	KDSA_KORVE	2, ., 5, ., 1, ., 5, 5	0.5404	0.8904	0.7014	yes	no
Q92JH7	KDSA_RICCN	2, ., 5, ., 1, ., 5, 5	0.5219	0.9132	0.7299	yes	no
B7J6R3	KDSA_ACIF2	2, ., 5, ., 1, ., 5, 5	0.5169	0.9223	0.7188	yes	no
Q9ZE84	KDSA_RICPR	2, ., 5, ., 1, ., 5, 5	0.5270	0.9041	0.72	yes	no
Q5N119	KDSA_SYNP6	2, ., 5, ., 1, ., 5, 5	0.5050	0.8812	0.6795	yes	no
A5IB80	KDSA_LEGPC	2, ., 5, ., 1, ., 5, 5	0.5123	0.9041	0.7226	yes	no
Q0BTX5	KDSA_GRABC	2, ., 5, ., 1, ., 5, 5	0.5126	0.8767	0.6808	yes	no
Q31KV0	KDSA_SYNE7	2, ., 5, ., 1, ., 5, 5	0.5050	0.8812	0.6795	yes	no
Q6G026	KDSA_BARQU	2, ., 5, ., 1, ., 5, 5	0.5123	0.9041	0.7122	yes	no
B8GQ74	KDSA_THISH	2, ., 5, ., 1, ., 5, 5	0.5317	0.9132	0.7142	yes	no
Q604M5	KDSA_METCA	2, ., 5, ., 1, ., 5, 5	0.5024	0.9223	0.7137	yes	no
A8EXC8	KDSA_RICCK	2, ., 5, ., 1, ., 5, 5	0.5170	0.9132	0.7299	yes	no
Q3SL44	KDSA_THIDA	2, ., 5, ., 1, ., 5, 5	0.5073	0.9132	0.7142	yes	no
B8HXG7	KDSA_CYAP4	2, ., 5, ., 1, ., 5, 5	0.5050	0.8812	0.7069	yes	no
C6E0M6	KDSA_GEOSM	2, ., 5, ., 1, ., 5, 5	0.505	0.8904	0.7142	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.5.1.55	0.991
3rd Layer	2.5.1	0.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_LG_II0575	SubName- Full=Putative uncharacterized protein; (291 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	DHQS6	SubName- Full=Putative uncharacterized protein; (375 aa)	•			•	•	0.942
	eugene3.01070060	CMP-KDO synthetase (288 aa)	•	•	•		•	0.931
	fgenesh4_pg.C_LG_XI000980	CMP-KDO synthetase (293 aa)	•	•	•		•	0.929
	estExt_Genewise1_v1.C_LG_V1283	hypothetical protein (341 aa)	•	•		•	•	0.897
	estExt_fgenesh4_pg.C_LG_II0344	SubName- Full=Putative uncharacterized protein; (341 aa)	•	•		•	•	0.895
	gw1.X.6418.1	hypothetical protein (277 aa)	•	•			•	0.849
	estExt_fgenesh4_pg.C_LG_VI0968	hypothetical protein (365 aa)	•	•			•	0.833
	gw1.XII.1858.1	anthranilate phosphoribosyltransferase (EC-2.4.2.18) (334 aa)	•				•	0.830
	eugene3.00160899	hypothetical protein (446 aa)	•	•			•	0.818
	gw1.IV.2364.1	hypothetical protein (234 aa)	•	•			•	0.787

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		219
PLN03033		290	PLN03033, PLN03033, 2-dehydro-3-deoxyphosphooctona	1e-168
TIGR01362		258	TIGR01362, KDO8P_synth, 3-deoxy-8-phosphooctulonat	1e-123
PRK05198		264	PRK05198, PRK05198, 2-dehydro-3-deoxyphosphooctona	1e-117
COG2877		279	COG2877, KdsA, 3-deoxy-D-manno-octulosonic acid (K	1e-102
pfam00793		271	pfam00793, DAHP_synth_1, DAHP synthetase I family	1e-75
PRK12457		281	PRK12457, PRK12457, 2-dehydro-3-deoxyphosphooctona	7e-74
PRK13398		266	PRK13398, PRK13398, 3-deoxy-7-phosphoheptulonate s	9e-32
TIGR01361		260	TIGR01361, DAHP_synth_Bsub, phospho-2-dehydro-3-de	8e-31
COG2876		286	COG2876, AroA, 3-deoxy-D-arabino-heptulosonate 7-p	4e-30
PRK08673		335	PRK08673, PRK08673, 3-deoxy-7-phosphoheptulonate s	3e-29
PRK12595		360	PRK12595, PRK12595, bifunctional 3-deoxy-7-phospho	2e-25
PRK13396		352	PRK13396, PRK13396, 3-deoxy-7-phosphoheptulonate s	2e-18
PRK13397		250	PRK13397, PRK13397, 3-deoxy-7-phosphoheptulonate s	1e-17

>gnl\|CDD\|178601 PLN03033, PLN03033, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

 Score =  464 bits (1195), Expect = e-168
 Identities = 200/219 (91%), Positives = 212/219 (96%)

Query: 1   MVEGLKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGK 60
           M EGLKILEKVK+AYD+PIVTDVHE+ QCE VGKVADIIQIPAFLCRQTDLLVAAAKTGK
Sbjct: 72  MAEGLKILEKVKVAYDLPIVTDVHESSQCEAVGKVADIIQIPAFLCRQTDLLVAAAKTGK 131

Query: 61  IINIKKGQFCASSVMVNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCP 120
           IINIKKGQFCA SVM NSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCP
Sbjct: 132 IINIKKGQFCAPSVMRNSAEKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCP 191

Query: 121 VVADVTHSLQQPAGKKLDGGGVASGGLRELIPCIARTAIAVGVDGVFMEVHDDPLNAPVD 180
           VVAD+THSLQQPAGKKLDGGGVASGGLRELIPCIARTA+AVGVDG+FMEVHDDPL+APVD
Sbjct: 192 VVADITHSLQQPAGKKLDGGGVASGGLRELIPCIARTAVAVGVDGIFMEVHDDPLSAPVD 251

Query: 181 GPTQWPLRNLEELLEELVAIAKVSKGKQRMNIDLTPFRD 219
           GPTQWPLR+LEELLEEL+AIA+V+KGKQR  IDLTP+RD
Sbjct: 252 GPTQWPLRHLEELLEELIAIARVTKGKQRFQIDLTPYRD 290

Length = 290

>gnl\|CDD\|130429 TIGR01362, KDO8P_synth, 3-deoxy-8-phosphooctulonate synthase	Back alignment and domain information

>gnl\|CDD\|235363 PRK05198, PRK05198, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>gnl\|CDD\|225432 COG2877, KdsA, 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|216123 pfam00793, DAHP_synth_1, DAHP synthetase I family	Back alignment and domain information

>gnl\|CDD\|237105 PRK12457, PRK12457, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>gnl\|CDD\|184028 PRK13398, PRK13398, 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|233375 TIGR01361, DAHP_synth_Bsub, phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>gnl\|CDD\|225431 COG2876, AroA, 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|181535 PRK08673, PRK08673, 3-deoxy-7-phosphoheptulonate synthase; Reviewed	Back alignment and domain information

>gnl\|CDD\|183614 PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed	Back alignment and domain information

>gnl\|CDD\|237376 PRK13396, PRK13396, 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|172030 PRK13397, PRK13397, 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		219
PLN03033		290	2-dehydro-3-deoxyphosphooctonate aldolase; Provisi	100.0
TIGR01362		258	KDO8P_synth 3-deoxy-8-phosphooctulonate synthase.	100.0
PRK05198		264	2-dehydro-3-deoxyphosphooctonate aldolase; Provisi	100.0
PRK12457		281	2-dehydro-3-deoxyphosphooctonate aldolase; Provisi	100.0
PRK08673		335	3-deoxy-7-phosphoheptulonate synthase; Reviewed	100.0
TIGR01361		260	DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate	100.0
PRK13396		352	3-deoxy-7-phosphoheptulonate synthase; Provisional	100.0
PRK13398		266	3-deoxy-7-phosphoheptulonate synthase; Provisional	100.0
PRK13397		250	3-deoxy-7-phosphoheptulonate synthase; Provisional	100.0
PRK12595		360	bifunctional 3-deoxy-7-phosphoheptulonate synthase	100.0
TIGR03569		329	NeuB_NnaB N-acetylneuraminate synthase. This famil	100.0
TIGR03586		327	PseI pseudaminic acid synthase.	100.0
PF03102		241	NeuB: NeuB family; InterPro: IPR013132 NeuB is the	100.0
COG2876		286	AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (	100.0
COG2877		279	KdsA 3-deoxy-D-manno-octulosonic acid (KDO) 8-phos	100.0
COG2089		347	SpsE Sialic acid synthase [Cell envelope biogenesi	100.0
PF00793		270	DAHP_synth_1: DAHP synthetase I family; InterPro:	100.0
PRK09261		349	phospho-2-dehydro-3-deoxyheptonate aldolase; Valid	99.96
TIGR00034		344	aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase	99.94
PRK12755		353	phospho-2-dehydro-3-deoxyheptonate aldolase; Provi	99.94
PRK12822		356	phospho-2-dehydro-3-deoxyheptonate aldolase; Provi	99.86
PRK12756		348	phospho-2-dehydro-3-deoxyheptonate aldolase; Provi	99.8
COG0722		351	AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (	99.51
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	97.61
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	97.09
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.06
PRK14024		241	phosphoribosyl isomerase A; Provisional	97.03
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	97.02
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	96.93
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	96.88
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.87
PRK11320		292	prpB 2-methylisocitrate lyase; Provisional	96.81
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	96.73
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	96.71
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	96.59
PRK11613		282	folP dihydropteroate synthase; Provisional	96.54
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	96.5
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	96.49
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	96.45
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	96.39
PRK00043		212	thiE thiamine-phosphate pyrophosphorylase; Reviewe	96.38
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	96.3
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	96.24
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	96.23
TIGR02317		285	prpB methylisocitrate lyase. Members of this famil	96.22
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	96.21
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	96.2
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	96.13
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	96.12
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	96.12
COG0673		342	MviM Predicted dehydrogenases and related proteins	96.11
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	96.02
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	95.94
cd02911		233	arch_FMN Archeal FMN-binding domain. This family o	95.91
cd00564		196	TMP_TenI Thiamine monophosphate synthase (TMP synt	95.87
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	95.86
TIGR02319		294	CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos	95.84
PF01207		309	Dus: Dihydrouridine synthase (Dus); InterPro: IPR0	95.74
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	95.72
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.55
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	95.54
KOG2335		358	consensus tRNA-dihydrouridine synthase [Translatio	95.4
cd07944		266	DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-	95.37
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	95.32
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	95.32
COG0352		211	ThiE Thiamine monophosphate synthase [Coenzyme met	95.27
cd04736		361	MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin	95.22
COG0042		323	tRNA-dihydrouridine synthase [Translation, ribosom	95.2
TIGR02708		367	L_lactate_ox L-lactate oxidase. Members of this pr	95.19
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	95.18
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	95.17
TIGR02321		290	Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f	95.15
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	95.14
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	95.03
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	94.97
TIGR00742		318	yjbN tRNA dihydrouridine synthase A. Members of th	94.9
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	94.81
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	94.77
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	94.76
KOG2741		351	consensus Dimeric dihydrodiol dehydrogenase [Carbo	94.76
PRK14041		467	oxaloacetate decarboxylase; Provisional	94.7
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	94.68
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FM	94.65
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	94.63
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	94.58
cd00958		235	DhnA Class I fructose-1,6-bisphosphate (FBP) aldol	94.57
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	94.52
cd04737		351	LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d	94.48
PRK09427		454	bifunctional indole-3-glycerol phosphate synthase/	94.39
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin	94.26
PRK14042		596	pyruvate carboxylase subunit B; Provisional	94.25
PRK09875		292	putative hydrolase; Provisional	94.21
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	94.21
PRK04165		450	acetyl-CoA decarbonylase/synthase complex subunit	94.19
cd06557		254	KPHMT-like Ketopantoate hydroxymethyltransferase (	94.18
TIGR00284		499	dihydropteroate synthase-related protein. This pro	94.17
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	94.17
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	94.09
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	94.02
PRK02615		347	thiamine-phosphate pyrophosphorylase; Provisional	93.97
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	93.9
PRK00311		264	panB 3-methyl-2-oxobutanoate hydroxymethyltransfer	93.82
PRK06512		221	thiamine-phosphate pyrophosphorylase; Provisional	93.77
PRK07535		261	methyltetrahydrofolate:corrinoid/iron-sulfur prote	93.74
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	93.72
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	93.72
PRK04302		223	triosephosphate isomerase; Provisional	93.66
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	93.58
PRK09282		592	pyruvate carboxylase subunit B; Validated	93.47
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	93.45
TIGR01768		223	GGGP-family geranylgeranylglyceryl phosphate synth	93.39
PF13714		238	PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB	93.31
PRK00915		513	2-isopropylmalate synthase; Validated	93.31
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	93.3
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	93.24
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	93.14
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	93.13
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	93.07
TIGR00734		221	hisAF_rel hisA/hisF family protein. This alignment	93.0
PRK08999		312	hypothetical protein; Provisional	92.97
COG0134		254	TrpC Indole-3-glycerol phosphate synthase [Amino a	92.94
PLN03228		503	methylthioalkylmalate synthase; Provisional	92.92
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	92.77
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	92.76
TIGR01108		582	oadA oxaloacetate decarboxylase alpha subunit. Thi	92.73
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	92.7
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	92.69
PRK12331		448	oxaloacetate decarboxylase; Provisional	92.64
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	92.54
PRK14040		593	oxaloacetate decarboxylase; Provisional	92.54
PF02581		180	TMP-TENI: Thiamine monophosphate synthase/TENI; In	92.43
cd06556		240	ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup	92.37
PRK09875		292	putative hydrolase; Provisional	92.31
cd00423		258	Pterin_binding Pterin binding enzymes. This family	92.31
cd00405		203	PRAI Phosphoribosylanthranilate isomerase (PRAI) c	92.06
TIGR00693		196	thiE thiamine-phosphate pyrophosphorylase. This mo	92.05
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	91.98
PF00113		295	Enolase_C: Enolase, C-terminal TIM barrel domain;	91.9
PRK12581		468	oxaloacetate decarboxylase; Provisional	91.89
PRK06801		286	hypothetical protein; Provisional	91.85
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	91.8
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	91.69
COG0399		374	WecE Predicted pyridoxal phosphate-dependent enzym	91.63
COG5016		472	Pyruvate/oxaloacetate carboxyltransferase [Energy	91.49
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	91.48
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	91.45
PLN02274		505	inosine-5'-monophosphate dehydrogenase	91.45
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	91.44
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	91.36
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	91.25
PLN02826		409	dihydroorotate dehydrogenase	91.23
TIGR01496		257	DHPS dihydropteroate synthase. This model represen	91.22
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	91.18
cd02812		219	PcrB_like PcrB_like proteins. One member of this f	91.15
PLN02321		632	2-isopropylmalate synthase	91.11
PRK13399		347	fructose-1,6-bisphosphate aldolase; Provisional	91.11
PLN02493		367	probable peroxisomal (S)-2-hydroxy-acid oxidase	91.09
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	90.97
PLN02746		347	hydroxymethylglutaryl-CoA lyase	90.78
KOG0538		363	consensus Glycolate oxidase [Energy production and	90.77
TIGR01521		347	FruBisAldo_II_B fructose-bisphosphate aldolase, cl	90.75
PRK07028		430	bifunctional hexulose-6-phosphate synthase/ribonuc	90.71
PRK11815		333	tRNA-dihydrouridine synthase A; Provisional	90.71
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	90.68
PTZ00081		439	enolase; Provisional	90.65
TIGR02090		363	LEU1_arch isopropylmalate/citramalate/homocitrate	90.6
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	90.58
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	90.56
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	90.56
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	90.54
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FM	90.51
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	90.42
PRK08227		264	autoinducer 2 aldolase; Validated	90.33
PRK12290		437	thiE thiamine-phosphate pyrophosphorylase; Reviewe	90.27
PRK08185		283	hypothetical protein; Provisional	90.21
cd00739		257	DHPS DHPS subgroup of Pterin binding enzymes. DHPS	90.15
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	90.15
PRK05692		287	hydroxymethylglutaryl-CoA lyase; Provisional	90.14
COG1830		265	FbaB DhnA-type fructose-1,6-bisphosphate aldolase	90.1
cd04737		351	LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d	89.93
PRK10206		344	putative oxidoreductase; Provisional	89.79
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	89.79
PRK09196		347	fructose-1,6-bisphosphate aldolase; Reviewed	89.76
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	89.64
PLN02591		250	tryptophan synthase	89.53
TIGR00973		494	leuA_bact 2-isopropylmalate synthase, bacterial ty	89.34
TIGR02660		365	nifV_homocitr homocitrate synthase NifV. This fami	89.29
PRK09517		755	multifunctional thiamine-phosphate pyrophosphoryla	89.29
cd07941		273	DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3	89.24
PLN00191		457	enolase	89.2
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	89.18
PRK12858		340	tagatose 1,6-diphosphate aldolase; Reviewed	89.16
TIGR02708		367	L_lactate_ox L-lactate oxidase. Members of this pr	89.08
PLN02424		332	ketopantoate hydroxymethyltransferase	89.02
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin	89.01
TIGR01060		425	eno phosphopyruvate hydratase. Alternate name: eno	88.97
PLN02979		366	glycolate oxidase	88.9
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	88.85
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	88.82
cd04728		248	ThiG Thiazole synthase (ThiG) is the tetrameric en	88.74
cd07948		262	DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s	88.7
PRK00077		425	eno enolase; Provisional	88.67
PRK07226		267	fructose-bisphosphate aldolase; Provisional	88.66
COG0134		254	TrpC Indole-3-glycerol phosphate synthase [Amino a	88.62
PLN02460		338	indole-3-glycerol-phosphate synthase	88.61
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	88.58
PRK06806		281	fructose-bisphosphate aldolase; Provisional	88.57
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	88.49
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	88.48
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	88.45
TIGR02090		363	LEU1_arch isopropylmalate/citramalate/homocitrate	88.39
cd03313		408	enolase Enolase: Enolases are homodimeric enzymes	88.3
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	88.28
PF03060		330	NMO: Nitronate monooxygenase; InterPro: IPR004136	88.15
COG2513		289	PrpB PEP phosphonomutase and related enzymes [Carb	88.14
PRK12330		499	oxaloacetate decarboxylase; Provisional	88.11
PF02879		104	PGM_PMM_II: Phosphoglucomutase/phosphomannomutase,	88.07
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	88.05
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	87.98
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	87.91
TIGR00284		499	dihydropteroate synthase-related protein. This pro	87.87
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	87.76
PRK11579		346	putative oxidoreductase; Provisional	87.74
cd02811		326	IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di	87.72
PRK00208		250	thiG thiazole synthase; Reviewed	87.61
cd07948		262	DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s	87.48
PRK07315		293	fructose-bisphosphate aldolase; Provisional	87.46
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	87.44
TIGR00381		389	cdhD CO dehydrogenase/acetyl-CoA synthase, delta s	87.26
PF01053		386	Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent	86.75
TIGR01761		343	thiaz-red thiazolinyl imide reductase. This reduct	86.57
COG0148		423	Eno Enolase [Carbohydrate transport and metabolism	86.57
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	86.56
PRK13802		695	bifunctional indole-3-glycerol phosphate synthase/	86.3
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	86.28
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	85.93
cd07945		280	DRE_TIM_CMS Leptospira interrogans citramalate syn	85.83
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	85.77
PLN02535		364	glycolate oxidase	85.77
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	85.76
PRK04169		232	geranylgeranylglyceryl phosphate synthase-like pro	85.35
COG0191		286	Fba Fructose/tagatose bisphosphate aldolase [Carbo	85.31
PRK12999		1146	pyruvate carboxylase; Reviewed	85.31
PRK11197		381	lldD L-lactate dehydrogenase; Provisional	85.26
TIGR01949		258	AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep	85.2
PRK06852		304	aldolase; Validated	85.09
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	85.07
COG2022		262	ThiG Uncharacterized enzyme of thiazole biosynthes	84.98
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	84.97
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	84.86
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	84.79
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	84.62
KOG0538		363	consensus Glycolate oxidase [Energy production and	84.49
TIGR02660		365	nifV_homocitr homocitrate synthase NifV. This fami	84.46
PRK02227		238	hypothetical protein; Provisional	84.3
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	84.01
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	83.84
TIGR01858		282	tag_bisphos_ald class II aldolase, tagatose bispho	83.78
PRK07998		283	gatY putative fructose-1,6-bisphosphate aldolase;	83.57
PRK00915		513	2-isopropylmalate synthase; Validated	83.46
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide tran	83.34
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	83.32
PRK15063		428	isocitrate lyase; Provisional	83.26
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	83.14
PRK12344		524	putative alpha-isopropylmalate/homocitrate synthas	83.1
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	83.02
COG1456		467	CdhE CO dehydrogenase/acetyl-CoA synthase gamma su	82.99
PF01070		356	FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR	82.92
PRK09195		284	gatY tagatose-bisphosphate aldolase; Reviewed	82.62
PF05690		247	ThiG: Thiazole biosynthesis protein ThiG; InterPro	82.61
PLN02623		581	pyruvate kinase	82.34
cd07941		273	DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3	82.33
KOG4201		289	consensus Anthranilate synthase component II [Amin	82.29
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	82.23
TIGR00977		526	LeuA_rel 2-isopropylmalate synthase/homocitrate sy	82.22
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	82.19
PRK12344		524	putative alpha-isopropylmalate/homocitrate synthas	82.08
cd07938		274	DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase,	82.05
KOG0053		409	consensus Cystathionine beta-lyases/cystathionine	82.01
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	81.92
PF04481		242	DUF561: Protein of unknown function (DUF561); Inte	81.85
TIGR00222		263	panB 3-methyl-2-oxobutanoate hydroxymethyltransfer	81.8
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	81.8
PRK07695		201	transcriptional regulator TenI; Provisional	81.76
TIGR01496		257	DHPS dihydropteroate synthase. This model represen	81.59
TIGR03470		318	HpnH hopanoid biosynthesis associated radical SAM	81.57
CHL00162		267	thiG thiamin biosynthesis protein G; Validated	81.5
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	81.46
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	81.31
TIGR01358		443	DAHP_synth_II 3-deoxy-7-phosphoheptulonate synthas	81.26
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	81.04
cd07944		266	DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-	81.01
PRK09389		488	(R)-citramalate synthase; Provisional	80.9
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	80.88
PRK13802		695	bifunctional indole-3-glycerol phosphate synthase/	80.81
cd00429		211	RPE Ribulose-5-phosphate 3-epimerase (RPE). This e	80.73
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	80.68
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	80.6
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	80.46
PLN02898		502	HMP-P kinase/thiamin-monophosphate pyrophosphoryla	80.46
PLN02291		474	phospho-2-dehydro-3-deoxyheptonate aldolase	80.33

>PLN03033 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

Probab=100.00  E-value=4e-64  Score=443.04  Aligned_cols=219  Identities=91%  Similarity=1.427  Sum_probs=216.1

Q ss_pred             ChhHHHHHHHHHHhcCCCeEeeeCCcccHHHHhhhccccccCCCCCCCHHHHHHHHhcCCeEEEeCCCCCCHHHHHHHHH
Q 027740            1 MVEGLKILEKVKIAYDIPIVTDVHETVQCEEVGKVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCASSVMVNSAE   80 (219)
Q Consensus         1 ~~~gl~~L~~~~~~~Gi~~~tt~~d~~~~~~l~~~vd~~kI~S~~~~n~~LL~~~a~~gkPVilstG~~~t~~ei~~A~e   80 (219)
                      |++||+||+++++++|++++|+++++++++.+++++|++|||+|+|+|++||+++|++||||+||+|++++++||..|+|
T Consensus        72 ~eeGL~iL~~vk~~~glpvvTeV~~~~q~~~vae~~DilQIgAr~~rqtdLL~a~~~tgkpV~lKkGq~~t~~e~~~aae  151 (290)
T PLN03033         72 MAEGLKILEKVKVAYDLPIVTDVHESSQCEAVGKVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCAPSVMRNSAE  151 (290)
T ss_pred             HHHHHHHHHHHHHHHCCceEEeeCCHHHHHHHHhhCcEEeeCcHHHHHHHHHHHHHccCCeEEeCCCCCCCHHHHHHHHH
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCCcEEEEeecCCCCCCCCCccchhHHHHHhcCCCEEEcCCCCCCCCCCCccCCCCccCCCCcccHHHHHHHHHH
Q 027740           81 KVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCPVVADVTHSLQQPAGKKLDGGGVASGGLRELIPCIARTAIA  160 (219)
Q Consensus        81 ~i~~~Gn~~i~L~~cgs~~~~~~~~~nl~~i~~lk~~~~pV~~ds~Hs~~~~~~~~~~~~~~~~~G~~~~~~~~~~aAva  160 (219)
                      +|.+.||++|+|||||++|+|.+..+|+++++.||++|+||++|+||++|+|++.+++++|+.++|+|++++.+++||+|
T Consensus       152 ki~~~GN~~viLcERG~tFgy~~lv~D~r~ip~mk~~~lPVI~DpSHsvQ~pg~~~~~~~g~~s~G~Re~V~~larAAvA  231 (290)
T PLN03033        152 KVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREANCPVVADITHSLQQPAGKKLDGGGVASGGLRELIPCIARTAVA  231 (290)
T ss_pred             HHHHcCCCcEEEEeCCCCcCCCCcccchhhhHHHHhcCCCEEEeCCccccCCCcccccccCCCCCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcEEEEeeecCCCCCCCCCCCCCChHHHHHHHHHHHHHHHHhCCCccccccCCCCCC
Q 027740          161 VGVDGVFMEVHDDPLNAPVDGPTQWPLRNLEELLEELVAIAKVSKGKQRMNIDLTPFRD  219 (219)
Q Consensus       161 lGA~GlvIEkH~t~d~a~~D~~~sl~p~el~~lv~~ir~i~~~lg~~~~~~~~~~~~~~  219 (219)
                      +||||+|||+|++|++||+|++++++|++|++|+++++++++++++++|..||+||.||
T Consensus       232 ~GaDGlfiEvHpdP~~AlsDg~q~l~~~~l~~ll~~l~~i~~~~~~~~~~~~~~~~~~~  290 (290)
T PLN03033        232 VGVDGIFMEVHDDPLSAPVDGPTQWPLRHLEELLEELIAIARVTKGKQRFQIDLTPYRD  290 (290)
T ss_pred             hCCCEEEEEecCCccccCCCcccCcCHHHHHHHHHHHHHHHHHHhccccCccCcccCCC
Confidence            99999999999999999999999999999999999999999999999999999999997

>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase	Back alignment and domain information

>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed	Back alignment and domain information

>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed	Back alignment and domain information

>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase	Back alignment and domain information

>TIGR03586 PseI pseudaminic acid synthase	Back alignment and domain information

>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac)	Back alignment and domain information

>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]	Back alignment and domain information

>COG2877 KdsA 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF00793 DAHP_synth_1: DAHP synthetase I family; InterPro: IPR006218 Members of the 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthetase family catalyse the first step in aromatic amino acid biosynthesis from chorismate	Back alignment and domain information

>PRK09261 phospho-2-dehydro-3-deoxyheptonate aldolase; Validated	Back alignment and domain information

>TIGR00034 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>PRK12755 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional	Back alignment and domain information

>PRK12822 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional	Back alignment and domain information

>PRK12756 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional	Back alignment and domain information

>COG0722 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>PRK11320 prpB 2-methylisocitrate lyase; Provisional	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>PRK11613 folP dihydropteroate synthase; Provisional	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>TIGR02317 prpB methylisocitrate lyase	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>cd02911 arch_FMN Archeal FMN-binding domain	Back alignment and domain information

>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase	Back alignment and domain information

>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism]	Back alignment and domain information

>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02708 L_lactate_ox L-lactate oxidase	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>TIGR00742 yjbN tRNA dihydrouridine synthase A	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK14041 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional	Back alignment and domain information

>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>PRK14042 pyruvate carboxylase subunit B; Provisional	Back alignment and domain information

>PRK09875 putative hydrolase; Provisional	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional	Back alignment and domain information

>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway	Back alignment and domain information

>TIGR00284 dihydropteroate synthase-related protein	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed	Back alignment and domain information

>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>PRK04302 triosephosphate isomerase; Provisional	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>PRK09282 pyruvate carboxylase subunit B; Validated	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein	Back alignment and domain information

>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B	Back alignment and domain information

>PRK00915 2-isopropylmalate synthase; Validated	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>TIGR00734 hisAF_rel hisA/hisF family protein	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN03228 methylthioalkylmalate synthase; Provisional	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>PRK12331 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>PRK14040 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2	Back alignment and domain information

>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds	Back alignment and domain information

>PRK09875 putative hydrolase; Provisional	Back alignment and domain information

>cd00423 Pterin_binding Pterin binding enzymes	Back alignment and domain information

>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP)	Back alignment and domain information

>TIGR00693 thiE thiamine-phosphate pyrophosphorylase	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>PF00113 Enolase_C: Enolase, C-terminal TIM barrel domain; InterPro: IPR020810 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate [, ]	Back alignment and domain information

>PRK12581 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK06801 hypothetical protein; Provisional	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PLN02826 dihydroorotate dehydrogenase	Back alignment and domain information

>TIGR01496 DHPS dihydropteroate synthase	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>cd02812 PcrB_like PcrB_like proteins	Back alignment and domain information

>PLN02321 2-isopropylmalate synthase	Back alignment and domain information

>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional	Back alignment and domain information

>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>PLN02746 hydroxymethylglutaryl-CoA lyase	Back alignment and domain information

>KOG0538 consensus Glycolate oxidase [Energy production and conversion]	Back alignment and domain information

>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype	Back alignment and domain information

>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated	Back alignment and domain information

>PRK11815 tRNA-dihydrouridine synthase A; Provisional	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>PTZ00081 enolase; Provisional	Back alignment and domain information

>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>PRK08227 autoinducer 2 aldolase; Validated	Back alignment and domain information

>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>PRK08185 hypothetical protein; Provisional	Back alignment and domain information

>cd00739 DHPS DHPS subgroup of Pterin binding enzymes	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional	Back alignment and domain information

>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>PRK10206 putative oxidoreductase; Provisional	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type	Back alignment and domain information

>TIGR02660 nifV_homocitr homocitrate synthase NifV	Back alignment and domain information

>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PLN00191 enolase	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR02708 L_lactate_ox L-lactate oxidase	Back alignment and domain information

>PLN02424 ketopantoate hydroxymethyltransferase	Back alignment and domain information

>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>TIGR01060 eno phosphopyruvate hydratase	Back alignment and domain information

>PLN02979 glycolate oxidase	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism	Back alignment and domain information

>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>PRK00077 eno enolase; Provisional	Back alignment and domain information

>PRK07226 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02460 indole-3-glycerol-phosphate synthase	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PRK06806 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases	Back alignment and domain information

>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1	Back alignment and domain information

>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK12330 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PF02879 PGM_PMM_II: Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II; InterPro: IPR005845 The alpha-D-phosphohexomutase superfamily is composed of four related enzymes, each of which catalyses a phosphoryl transfer on their sugar substrates: phosphoglucomutase (PGM), phosphoglucomutase/phosphomannomutase (PGM/PMM), phosphoglucosamine mutase (PNGM), and phosphoacetylglucosamine mutase (PAGM) []

Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>TIGR00284 dihydropteroate synthase-related protein	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>PRK11579 putative oxidoreductase; Provisional	Back alignment and domain information

>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain	Back alignment and domain information

>PRK00208 thiG thiazole synthase; Reviewed	Back alignment and domain information

>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>PRK07315 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>TIGR00381 cdhD CO dehydrogenase/acetyl-CoA synthase, delta subunit	Back alignment and domain information

>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal)	Back alignment and domain information

>TIGR01761 thiaz-red thiazolinyl imide reductase	Back alignment and domain information

>COG0148 Eno Enolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>PLN02535 glycolate oxidase	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed	Back alignment and domain information

>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK12999 pyruvate carboxylase; Reviewed	Back alignment and domain information

>PRK11197 lldD L-lactate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>PRK06852 aldolase; Validated	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>KOG0538 consensus Glycolate oxidase [Energy production and conversion]	Back alignment and domain information

>TIGR02660 nifV_homocitr homocitrate synthase NifV	Back alignment and domain information

>PRK02227 hypothetical protein; Provisional	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family	Back alignment and domain information

>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK00915 2-isopropylmalate synthase; Validated	Back alignment and domain information

>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>PRK15063 isocitrate lyase; Provisional	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>COG1456 CdhE CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) [Energy production and conversion]	Back alignment and domain information

>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related	Back alignment and domain information

>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences	Back alignment and domain information

>PLN02623 pyruvate kinase	Back alignment and domain information

>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism]	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional	Back alignment and domain information

>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae	Back alignment and domain information

>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK07695 transcriptional regulator TenI; Provisional	Back alignment and domain information

>TIGR01496 DHPS dihydropteroate synthase	Back alignment and domain information

>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH	Back alignment and domain information

>CHL00162 thiG thiamin biosynthesis protein G; Validated	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>TIGR01358 DAHP_synth_II 3-deoxy-7-phosphoheptulonate synthase, class II	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK09389 (R)-citramalate synthase; Provisional	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional	Back alignment and domain information

>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE)	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase	Back alignment and domain information

>PLN02291 phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		219
2nxi_A		263	Structural And Mechanistic Changes Along An Enginee		2e-48
2ef9_A		267	Structural And Mechanistic Changes Along An Enginee		3e-48
2nxg_A		263	Structural And Mechanistic Changes Along An Enginee		3e-48
2nx3_A		267	Structural And Mechanistic Changes Along An Enginee		3e-48
2nwr_A		267	Crystal Structure Of C11n Mutant Of Kdo8p Synthase		4e-48
1fwn_A		267	Aquifex Aeolicus Kdo8p Synthase In Complex With Pep		5e-48
1t8x_A		267	R106g Kdo8ps With Pep And A5p Length = 267		6e-47
1lrn_A		267	Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Com		1e-46
3qq0_A		279	Crystal Structure Of A Deletion Mutant (N59) Of 3-D		6e-46
3qpz_A		280	Crystal Structure Of The N59a Mutant Of The 3-Deoxy		6e-46
2qkf_A		280	Crystal Structure Of 3-Deoxy-D-Manno-Octulosonate 8		6e-46
3qpy_A		280	Crystal Structure Of A Mutant (K57a) Of 3-Deoxy-D-M		6e-46
3qq1_A		279	Crystal Structure Of A Double Mutant [a58p, Del(N59		7e-46
3ste_A		280	Crystal Structure Of A Mutant (Q202a) Of 3-Deoxy-D-		4e-45
3fyp_A		280	Crystal Structure Of The Quadruple Mutant (n23c/c24		2e-44
3fyo_A		280	Crystal Structure Of The Triple Mutant (N23cD247EP2		2e-44
3tml_A		288	Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctona		3e-44
3t4c_A		288	Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctona		1e-43
1o60_A		292	Crystal Structure Of Kdo-8-Phosphate Synthase Lengt		2e-43
3sz8_A		285	Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctona		2e-43
1d9e_A		284	Structure Of E. Coli Kdo8p Synthase Length = 284		5e-43
3stf_A		280	Crystal Structure Of A Mutant (S211a) Of 3-Deoxy-D-		2e-42
1g7u_A		284	Crystal Structures Of Kdo8p Synthase In Its Binary		8e-42
3stc_A		269	Crystal Structure Of Loop 7 Truncated Mutant Of 3-D		2e-41
3stg_A		268	Crystal Structure Of A58p, Del(N59), And Loop 7 Tru		2e-41
3e9a_A		286	Crystal Structure Of 2-dehydro-3-deoxyphosphooctona		8e-40
3fs2_A		298	Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctona		2e-39
3nvt_A		385	1.95 Angstrom Crystal Structure Of A Bifunctional 3		4e-15
1zco_A		262	Crystal Structure Of Pyrococcus Furiosus 3-Deoxy-D-		2e-14
4grs_A		333	Crystal Structure Of A Chimeric Dah7ps Length = 333		3e-14
3pg8_A		272	Truncated Form Of 3-Deoxy-D-Arabino-Heptulosonate 7		1e-13
1rzm_A		338	Crystal Structure Of 3-Deoxy-D-Arabino-Heptulosonat		2e-13
1vr6_A		350	Crystal Structure Of Phospho-2-dehydro-3-deoxyhepto		2e-13
1vs1_A		276	Crystal Structure Of 3-Deoxy-D-Arabino-Heptulosonat		6e-09

>pdb|2NXI|A Chain A, Structural And Mechanistic Changes Along An Engineered Path From Metallo To Non-Metallo Kdo8p Synthase. Length = 263