Citrus Sinensis ID: 027850


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MAICRSGLFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSFSKFSEESFMNNPRLEGPELMGFVRYDVGDCK
ccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccccccccccccccccEEcccccccccc
ccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccccEEEEEcEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccHHccccc
MAICRSGLFHLLVALVLSNtiatsnanVEGDALFALRRAvkdpqgvlqswdptlvdpctwfhvtcdadnrvtrldlgngklsgnlvpelgkLERLQYLELYMNNLAGQIPKELGQLKslisldlyhnnltgpippslsrlsnlkfLRLNgnkltgkipreltklgnlkildvsnndlcgtiptagsfskfseesfmnnprlegpelmgfvrydvgdck
MAICRSGLFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDlgngklsgnlvpelGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSFSKFSEESFMNnprlegpelmgfvrydvgdck
MAICRSGLFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSFSKFSEESFMNNPRLEGPELMGFVRYDVGDCK
**ICRSGLFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSF******************LMGFVRYD*****
***CRSGLFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSFSKFSEESFMNNPRLEGPELMGFVRYDVGDCK
MAICRSGLFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSFSKFSEESFMNNPRLEGPELMGFVRYDVGDCK
*AICRSGLFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSFSKFSEESFMNNPRLEGPELMGFVRYDV**CK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAICRSGLFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSFSKFSEESFMNNPRLEGPELMGFVRYDVGDCK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q94AG2 625 Somatic embryogenesis rec no no 0.903 0.315 0.590 1e-59
Q9XIC7 628 Somatic embryogenesis rec no no 0.830 0.288 0.602 9e-58
Q94F62 615 BRASSINOSTEROID INSENSITI no no 0.857 0.304 0.589 3e-57
Q9SKG5 620 Somatic embryogenesis rec no no 0.821 0.288 0.601 7e-55
Q8LPS5 601 Somatic embryogenesis rec no no 0.811 0.294 0.541 8e-50
Q8VYT3 648 Probable LRR receptor-lik no no 0.834 0.280 0.393 3e-31
Q8RY65 635 Protein NSP-INTERACTING K no no 0.724 0.248 0.446 9e-31
Q0WVM4 634 Probable LRR receptor-lik no no 0.788 0.271 0.389 2e-30
C0LGF4 591 LRR receptor-like serine/ no no 0.862 0.318 0.402 2e-29
Q9LFS4 638 Protein NSP-INTERACTING K no no 0.871 0.297 0.376 6e-29
>sp|Q94AG2|SERK1_ARATH Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2 Back     alignment and function desciption
 Score =  229 bits (583), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 147/198 (74%), Gaps = 1/198 (0%)

Query: 8   LFHLLVALVLSN-TIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCD 66
           +F LL  ++L N ++  ++AN+EGDAL  LR  + DP  VLQSWDPTLV+PCTWFHVTC+
Sbjct: 7   VFILLSLILLPNHSLWLASANLEGDALHTLRVTLVDPNNVLQSWDPTLVNPCTWFHVTCN 66

Query: 67  ADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYH 126
            +N V R+DLGN +LSG+LVPELG L+ LQYLELY NN+ G IP  LG L +L+SLDLY 
Sbjct: 67  NENSVIRVDLGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGNLTNLVSLDLYL 126

Query: 127 NNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGS 186
           N+ +GPIP SL +LS L+FLRLN N LTG IP  LT +  L++LD+SNN L G++P  GS
Sbjct: 127 NSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTNITTLQVLDLSNNRLSGSVPDNGS 186

Query: 187 FSKFSEESFMNNPRLEGP 204
           FS F+  SF NN  L GP
Sbjct: 187 FSLFTPISFANNLDLCGP 204




Dual specificity kinase acting on both serine/threonine-and tyrosine-containing substrates. Phosphorylates BRI1 on 'Ser-887' and CDC48 on at least one threonine residue and on 'Ser-41'. Confers embryogenic competence. Acts redundantly with SERK2 as a control point for sporophytic development controlling male gametophyte production. Involved in the brassinolide signaling pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9XIC7|SERK2_ARATH Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1 Back     alignment and function description
>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SKG5|SERK4_ARATH Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2 Back     alignment and function description
>sp|Q8LPS5|SERK5_ARATH Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2 Back     alignment and function description
>sp|Q8VYT3|Y4052_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g30520 OS=Arabidopsis thaliana GN=At4g30520 PE=2 SV=1 Back     alignment and function description
>sp|Q8RY65|NIK2_ARATH Protein NSP-INTERACTING KINASE 2 OS=Arabidopsis thaliana GN=NIK2 PE=1 SV=1 Back     alignment and function description
>sp|Q0WVM4|Y2239_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g23950 OS=Arabidopsis thaliana GN=At2g23950 PE=2 SV=1 Back     alignment and function description
>sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LFS4|NIK1_ARATH Protein NSP-INTERACTING KINASE 1 OS=Arabidopsis thaliana GN=NIK1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
225425162219 PREDICTED: somatic embryogenesis recepto 0.963 0.958 0.816 5e-95
255543144216 serine-threonine protein kinase, plant-t 0.889 0.898 0.855 8e-93
224057810217 predicted protein [Populus trichocarpa] 0.990 0.995 0.783 9e-93
358249132217 uncharacterized protein LOC100778819 pre 0.977 0.981 0.761 1e-89
224072512216 predicted protein [Populus trichocarpa] 0.876 0.884 0.832 2e-87
449445584251 PREDICTED: somatic embryogenesis recepto 0.871 0.756 0.826 4e-87
449528539224 PREDICTED: somatic embryogenesis recepto 0.871 0.848 0.826 4e-87
357501353220 Somatic embryogenesis receptor kinase [M 0.954 0.945 0.746 9e-85
224286330211 unknown [Picea sitchensis] 0.967 1.0 0.720 9e-82
147769494216 hypothetical protein VITISV_035126 [Viti 0.880 0.888 0.7 2e-78
>gi|225425162|ref|XP_002263688.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Vitis vinifera] gi|296088725|emb|CBI38175.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  352 bits (904), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 174/213 (81%), Positives = 192/213 (90%), Gaps = 3/213 (1%)

Query: 9   FHLLVALVLSNTIAT--SNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCD 66
           +H L+AL L    +T  +NAN+EGDAL+ALRRAV+DP+ VLQSWDPTLVDPCTWFHVTCD
Sbjct: 7   YHHLLALFLLTWASTVPTNANMEGDALYALRRAVEDPEHVLQSWDPTLVDPCTWFHVTCD 66

Query: 67  ADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYH 126
           +DNRVTRLDLGN KLSGNLVPELGKLERLQYLELYMNNL G IP +LG LK+L+SLDL+H
Sbjct: 67  SDNRVTRLDLGNAKLSGNLVPELGKLERLQYLELYMNNLVGPIPVQLGGLKNLVSLDLFH 126

Query: 127 NNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGS 186
           NNLTG IPPSLS+LSNL+FLRLN N+L+G IPRELTKLG+LKILDVSNNDLCGTIPT GS
Sbjct: 127 NNLTGSIPPSLSKLSNLRFLRLNSNRLSGTIPRELTKLGSLKILDVSNNDLCGTIPTTGS 186

Query: 187 FSKFSEESFMNNPRLEGPELMGFVRYDV-GDCK 218
           FSKFSEESFMNNPRLEGPELMGFVRYD  G CK
Sbjct: 187 FSKFSEESFMNNPRLEGPELMGFVRYDTRGGCK 219




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255543144|ref|XP_002512635.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223548596|gb|EEF50087.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224057810|ref|XP_002299335.1| predicted protein [Populus trichocarpa] gi|222846593|gb|EEE84140.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358249132|ref|NP_001239998.1| uncharacterized protein LOC100778819 precursor [Glycine max] gi|255637326|gb|ACU18993.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224072512|ref|XP_002303765.1| predicted protein [Populus trichocarpa] gi|222841197|gb|EEE78744.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449445584|ref|XP_004140552.1| PREDICTED: somatic embryogenesis receptor kinase 1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449528539|ref|XP_004171261.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357501353|ref|XP_003620965.1| Somatic embryogenesis receptor kinase [Medicago truncatula] gi|355495980|gb|AES77183.1| Somatic embryogenesis receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224286330|gb|ACN40873.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|147769494|emb|CAN61408.1| hypothetical protein VITISV_035126 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2178968218 AT5G21090 [Arabidopsis thalian 0.954 0.954 0.652 5.5e-70
TAIR|locus:2013021 625 SERK1 "somatic embryogenesis r 0.903 0.315 0.590 2.5e-58
TAIR|locus:2026097 628 SERK2 "somatic embryogenesis r 0.908 0.315 0.575 4e-58
TAIR|locus:2040461 620 SERK4 "somatic embryogenesis r 0.912 0.320 0.568 4.8e-55
TAIR|locus:2040471 601 SERK5 "somatic embryogenesis r 0.793 0.287 0.561 2.3e-48
TAIR|locus:2101064248 AT3G43740 [Arabidopsis thalian 0.788 0.693 0.502 8e-37
TAIR|locus:2036636 632 NIK3 "NSP-interacting kinase 3 0.761 0.262 0.437 2.9e-32
TAIR|locus:2118811 648 SARK "SENESCENCE-ASSOCIATED RE 0.802 0.270 0.405 8.8e-32
TAIR|locus:2061466 634 AT2G23950 [Arabidopsis thalian 0.788 0.271 0.389 1.3e-30
TAIR|locus:2058759 589 FEI2 "FEI 2" [Arabidopsis thal 0.944 0.349 0.4 3.4e-30
TAIR|locus:2178968 AT5G21090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 709 (254.6 bits), Expect = 5.5e-70, P = 5.5e-70
 Identities = 137/210 (65%), Positives = 163/210 (77%)

Query:     8 LFHLLVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDA 67
             LF   + L L+  I    AN EGDAL+ALRR++ DP  VLQSWDPTLV+PCTWFHVTC+ 
Sbjct:    10 LFAASLTLTLA-LIHLVEANSEGDALYALRRSLTDPDHVLQSWDPTLVNPCTWFHVTCNQ 68

Query:    68 DNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHN 127
             DNRVTR+DLGN  LSG+L PELGKLE LQYLELY NN+ G IP ELG LK+LISLDLY+N
Sbjct:    69 DNRVTRVDLGNSNLSGHLAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNN 128

Query:   128 NLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTAGSF 187
             NLTG +P SL +L +L FLRLN N+LTG IPR LT + +LK++DVS+NDLCGTIPT G F
Sbjct:   129 NLTGIVPTSLGKLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDVSSNDLCGTIPTNGPF 188

Query:   188 SKFSEESFMNNPRLEGPELMGFVRYDVGDC 217
             +    ++F NNPRLEGPEL+G   YD  +C
Sbjct:   189 AHIPLQNFENNPRLEGPELLGLASYDT-NC 217




GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
TAIR|locus:2013021 SERK1 "somatic embryogenesis receptor-like kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026097 SERK2 "somatic embryogenesis receptor-like kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040461 SERK4 "somatic embryogenesis receptor-like kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040471 SERK5 "somatic embryogenesis receptor-like kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101064 AT3G43740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036636 NIK3 "NSP-interacting kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118811 SARK "SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061466 AT2G23950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058759 FEI2 "FEI 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-21
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-11
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  111 bits (278), Expect = 4e-28
 Identities = 54/109 (49%), Positives = 73/109 (66%)

Query: 74  LDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNNLTGPI 133
           L L + +L G +  ELG+++ L+++ L  NNL+G+IP E+G L SL  LDL +NNLTGPI
Sbjct: 193 LTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI 252

Query: 134 PPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIP 182
           P SL  L NL++L L  NKL+G IP  +  L  L  LD+S+N L G IP
Sbjct: 253 PSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIP 301


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN03150623 hypothetical protein; Provisional 99.77
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03150623 hypothetical protein; Provisional 99.5
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.45
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.38
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.35
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.31
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.31
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.3
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.27
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.12
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.1
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.06
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.03
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.02
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.02
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.01
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.0
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.93
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.88
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.88
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.76
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.73
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.73
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.69
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.62
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.54
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.51
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.4
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.37
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.33
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.18
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.08
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.04
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.95
PRK15386 426 type III secretion protein GogB; Provisional 97.76
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.67
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.63
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.25
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.24
PRK15386 426 type III secretion protein GogB; Provisional 97.23
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.02
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.85
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.75
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.65
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.38
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.21
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.95
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.68
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.57
KOG0473 326 consensus Leucine-rich repeat protein [Function un 95.29
KOG0473 326 consensus Leucine-rich repeat protein [Function un 94.69
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.92
smart0037026 LRR Leucine-rich repeats, outliers. 90.92
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.32
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.19
KOG1947 482 consensus Leucine rich repeat proteins, some prote 86.86
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.82
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 81.86
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 81.74
KOG1947 482 consensus Leucine rich repeat proteins, some prote 81.02
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.65
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.93  E-value=8.5e-25  Score=200.53  Aligned_cols=170  Identities=32%  Similarity=0.606  Sum_probs=131.6

Q ss_pred             CchHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCcceeEeCCCCCEEEEEcCCCCCccccCcccCCCCCCCEEEccCCcC
Q 027850           26 ANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNL  105 (218)
Q Consensus        26 ~~~~~~~l~~~~~~~~~~~~~l~~w~~~~~~~c~~~~v~c~~~~~l~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~n~l  105 (218)
                      .+.|+.++++++..+.++...+.+|+.. .++|.|.||+|+..++|+.|++++|.+.+..+..+..+++|+.|++++|.+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~-~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~  105 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSS-ADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQL  105 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCC-CCCCcCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCcc
Confidence            4478899999999998777778999754 579999999998778999999999999999999999999999999999999


Q ss_pred             CCCCCcccc-cCCCCCEEEccCCcCCCCCcccCCCCCCCCEEEccCCcCCCCCChhccCCCCCCEEEeeCCcccccCCCC
Q 027850          106 AGQIPKELG-QLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPTA  184 (218)
Q Consensus       106 ~~~~p~~~~-~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~~~~  184 (218)
                      .+.+|..+. .+++|++|++++|.+++.+|.  ..+++|++|++++|.+++.+|..+..+++|++|++++|.+.+.+|..
T Consensus       106 ~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~  183 (968)
T PLN00113        106 SGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS  183 (968)
T ss_pred             CCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChh
Confidence            888886654 788888888888877765553  34566666666666666666666666666666666666666555544


Q ss_pred             -CCCCCCCcccccCC
Q 027850          185 -GSFSKFSEESFMNN  198 (218)
Q Consensus       185 -~~l~~L~~L~l~~N  198 (218)
                       +.+++|++|++++|
T Consensus       184 ~~~l~~L~~L~L~~n  198 (968)
T PLN00113        184 LTNLTSLEFLTLASN  198 (968)
T ss_pred             hhhCcCCCeeeccCC
Confidence             55666666666665



>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-19
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 8e-19
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-10
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 5e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 53/151 (35%), Positives = 70/151 (46%), Gaps = 7/151 (4%) Query: 69 NRVTRLDLGNGKLSGNLVPELGKLERLQYLELYMNNLAGQIPKELGQLKSLISLDLYHNN 128 N + L L N +G + P L L L L N L+G IP LG L L L L+ N Sbjct: 391 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 450 Query: 129 LTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIPT-AGSF 187 L G IP L + L+ L L+ N LTG+IP L+ NL + +SNN L G IP G Sbjct: 451 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 510 Query: 188 SKFSEESFMNNPRLEGPELMGFVRYDVGDCK 218 + NN G + ++GDC+ Sbjct: 511 ENLAILKLSNN------SFSGNIPAELGDCR 535
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-43
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-35
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-35
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-30
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-17
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 8e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 6e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-16
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 6e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-10
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-10
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 4e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  149 bits (378), Expect = 3e-44
 Identities = 60/186 (32%), Positives = 86/186 (46%), Gaps = 33/186 (17%)

Query: 29  EGDALFALRRAVKDPQGVLQSWDPTL-VDPCTWFHVTCDAD---NRVTRLDLGNGKLSG- 83
           +  AL  +++ + +P   L SW PT      TW  V CD D    RV  LDL    L   
Sbjct: 7   DKQALLQIKKDLGNP-TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKP 65

Query: 84  --------NLV------------------PELGKLERLQYLELYMNNLAGQIPKELGQLK 117
                   NL                   P + KL +L YL +   N++G IP  L Q+K
Sbjct: 66  YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIK 125

Query: 118 SLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNL-KILDVSNND 176
           +L++LD  +N L+G +PPS+S L NL  +  +GN+++G IP        L   + +S N 
Sbjct: 126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNR 185

Query: 177 LCGTIP 182
           L G IP
Sbjct: 186 LTGKIP 191


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-09
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2 227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-06
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-06
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 5e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 71.7 bits (174), Expect = 2e-15
 Identities = 54/162 (33%), Positives = 77/162 (47%), Gaps = 10/162 (6%)

Query: 29  EGDALFALRRAVKDPQGVLQSWDPTLVDPC--TWFHVTCDADN---RVTRLDLGNGKLSG 83
           +  AL  +++ + +P   L SW PT  D C  TW  V CD D    RV  LDL    L  
Sbjct: 7   DKQALLQIKKDLGNP-TTLSSWLPT-TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPK 64

Query: 84  N--LVPELGKLERLQYLELYMN-NLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRL 140
              +   L  L  L +L +    NL G IP  + +L  L  L + H N++G IP  LS++
Sbjct: 65  PYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQI 124

Query: 141 SNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNNDLCGTIP 182
             L  L  + N L+G +P  ++ L NL  +    N + G IP
Sbjct: 125 KTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP 166


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.71
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.7
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.67
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.58
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.58
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.5
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.43
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.26
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.19
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.14
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.07
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.93
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.72
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.67
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.69
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.31
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.98
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.7e-37  Score=177.73  Aligned_cols=157  Identities=35%  Similarity=0.606  Sum_probs=115.6

Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC--CCCEEEECCC---CCEEEEECCCCCCCC--CCCCCCCCCCCCCE
Q ss_conf             9802799999999955899999889999999998--7431573999---978999839999731--16845679999988
Q 027850           25 NANVEGDALFALRRAVKDPQGVLQSWDPTLVDPC--TWFHVTCDAD---NRVTRLDLGNGKLSG--NLVPELGKLERLQY   97 (218)
Q Consensus        25 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~~c--~~~gv~c~~~---~~l~~L~Ls~~~l~~--~~~~~~~~l~~L~~   97 (218)
                      +.++|++||.+||+++.++. .+.+|... .++|  .|.||+|+..   .+|+.|+++++.+.+  .+|..+..++.|++
T Consensus         3 c~~~e~~aLl~~k~~~~~~~-~l~sW~~~-~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~   80 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT-TLSSWLPT-TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG-GGTTCCTT-SCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CCHHHHHHHHHHHHHCCCCC-CCCCCCCC-CCCCCCCCCCEEEECCCCCEEEEEEECCCCCCCCCCCCCHHHHCCCCCCC
T ss_conf             89899999999999779998-67788999-99988948896974899947988998989988888879847846753352


Q ss_pred             EECCC-CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCHHCCCCCCCCEEEEECCC
Q ss_conf             97337-85787788000268889889733885789996137899999989811884888898110289999999814781
Q 027850           98 LELYM-NNLAGQIPKELGQLKSLISLDLYHNNLTGPIPPSLSRLSNLKFLRLNGNKLTGKIPRELTKLGNLKILDVSNND  176 (218)
Q Consensus        98 L~L~~-n~l~~~~p~~~~~l~~L~~L~ls~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~Ls~N~  176 (218)
                      |++++ |.+.+.+|..+..+++|++|++++|++.+..+..+..+..|+.++++.|.+.+.+|..+..++.++.+++++|.
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~  160 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNR  160 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHCCCCCCCEEECCCCC
T ss_conf             02026543330024311454200110203564344332222201110011112245555685122067400000023553


Q ss_pred             CCCCCCC
Q ss_conf             4413899
Q 027850          177 LCGTIPT  183 (218)
Q Consensus       177 l~~~~~~  183 (218)
                      +.+.+|.
T Consensus       161 l~~~ip~  167 (313)
T d1ogqa_         161 ISGAIPD  167 (313)
T ss_dssp             CEEECCG
T ss_pred             CCCCCCC
T ss_conf             3562031



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure