Citrus Sinensis ID: 027929

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MNHQNPEPDRPVLPTRVPLMTNGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRYPDDSRSQHDSRDDAELHPVPEEDDSEYHDFSD
ccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHccccEEEEccccccccccccccccccccHHHHHHccccccEEEEcccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEccccHEEcccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHccccEEEEcccccccccHHHHHHEEEccccHHHEccccccEEEEEccccccccccccccccccccccccccccccccc
mnhqnpepdrpvlptrvplmtngAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSvlygadwgfinntenrnddeggwggiqldstetdltaTNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRrssvgrlgsvsdycvhhcvcpvvvlrypddsrsqhdsrddaelhpvpeeddseyhdfsd
mnhqnpepdrpvlpTRVPLMTNGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVlygadwgfinntenrnddeggWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRYPDDSrsqhdsrddaelhpvpeeddseyhdfsd
MNHQNPEPDRPVLPTRVPLMTNGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLsamimggrgigigavrrssvgrlgsvsDYcvhhcvcpvvvLRYPddsrsqhdsrddAELHPVPEEDDSEYHDFSD
*******************MTNGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENR***EGGWGGIQLDS***DLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRY********************************
***************************IAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVV***********************************
*********RPVLPTRVPLMTNGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRYPD******************************
***********************AQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRYPD******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHQNPEPDRPVLPTRVPLMTNGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRYPDDSRSQHDSRDDAELHPVPEEDDSEYHDFSD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query217 2.2.26 [Sep-21-2011]
P87132601 Uncharacterized protein C yes no 0.603 0.217 0.289 0.0007
Q8LGG8175 Universal stress protein no no 0.258 0.32 0.344 0.0008
>sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 Back     alignment and function desciption
 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 77/159 (48%), Gaps = 28/159 (17%)

Query: 30  IAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWG 89
           + +DLS ES +A  WAV   LR GD ++++ V +       D       ++R + E    
Sbjct: 435 LTLDLSSESLHAAEWAVGILLRNGDTLIIVDVIE------CDDPSARAVKDRMESE---- 484

Query: 90  GIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHI-VKDHDMKERLCLE-VERLGLSAMIM 147
             QL++ E        K I + L +  L+ +++I V  H+  + L +E ++ +  S ++M
Sbjct: 485 --QLETLEKI-----TKYILKLLSKTVLEVEVNIEVIHHEKAKHLIIEMIDYIEPSLVVM 537

Query: 148 GGRGIGIGAVRRSSVG--RLGSVSDYCVHHCVCPVVVLR 184
           G RG       RS +    LGS S+Y V+    PV+V R
Sbjct: 538 GSRG-------RSHLKGVLLGSFSNYLVNKSSVPVMVAR 569

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
326498675257 predicted protein [Hordeum vulgare subsp 0.870 0.735 0.640 7e-63
6554203 875 T23J18.3 [Arabidopsis thaliana] 0.940 0.233 0.568 5e-62
357122482257 PREDICTED: uncharacterized protein C167. 0.870 0.735 0.625 1e-61
297849518273 predicted protein [Arabidopsis lyrata su 0.949 0.754 0.573 2e-59
30682187242 adenine nucleotide alpha hydrolases-like 0.912 0.818 0.557 3e-59
357453589226 hypothetical protein MTR_2g089350 [Medic 0.926 0.889 0.578 3e-59
224114117241 predicted protein [Populus trichocarpa] 0.944 0.850 0.558 3e-58
343172026226 adenine nucleotide alpha hydrolases-like 0.866 0.831 0.597 1e-56
255567471237 conserved hypothetical protein [Ricinus 0.811 0.742 0.607 3e-56
255563431248 conserved hypothetical protein [Ricinus 0.935 0.818 0.647 4e-56
>gi|326498675|dbj|BAK02323.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326533716|dbj|BAK05389.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 153/203 (75%), Gaps = 14/203 (6%)

Query: 24  AQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRND 83
           A R+IAIAVDLSDESAYAV WAV NYLRPGDAV+LLHVR T+VLYGADWG +  T   +D
Sbjct: 55  AHRRIAIAVDLSDESAYAVSWAVANYLRPGDAVILLHVRSTNVLYGADWGSVTPTSPEDD 114

Query: 84  DEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLS 143
            E     ++ D     LTA+ A ++A+PLEEA + YKIHIVKDHDMKERLCLEVERLGLS
Sbjct: 115 AEVAARKMEEDFDA--LTASKADDLAKPLEEAKIPYKIHIVKDHDMKERLCLEVERLGLS 172

Query: 144 AMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRYPDD-------SRSQHDSR 196
           A+IMG +  G GA RR+S GRLGSVSDYCVHHC+CPVVV+R PDD       S +  ++ 
Sbjct: 173 AVIMGSK--GFGAARRASKGRLGSVSDYCVHHCICPVVVVRTPDDAVAEGGESATAMEAA 230

Query: 197 DDAE--LHPVPEEDDSEYHDFSD 217
             AE  LHPVPEE D+EYHD ++
Sbjct: 231 VGAEDVLHPVPEE-DAEYHDAAE 252

Source: Hordeum vulgare subsp. vulgare

Species: Hordeum vulgare

Genus: Hordeum

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|6554203|gb|AAF16649.1|AC011661_27 T23J18.3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357122482|ref|XP_003562944.1| PREDICTED: uncharacterized protein C167.05-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|297849518|ref|XP_002892640.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297338482|gb|EFH68899.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30682187|ref|NP_563888.2| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|30682191|ref|NP_849638.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|238478437|ref|NP_001154325.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|334182468|ref|NP_001184963.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|227204137|dbj|BAH56920.1| AT1G11360 [Arabidopsis thaliana] gi|332190601|gb|AEE28722.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|332190602|gb|AEE28723.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|332190603|gb|AEE28724.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|332190604|gb|AEE28725.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357453589|ref|XP_003597072.1| hypothetical protein MTR_2g089350 [Medicago truncatula] gi|355486120|gb|AES67323.1| hypothetical protein MTR_2g089350 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224114117|ref|XP_002316672.1| predicted protein [Populus trichocarpa] gi|222859737|gb|EEE97284.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|343172026|gb|AEL98717.1| adenine nucleotide alpha hydrolases-like protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|255567471|ref|XP_002524715.1| conserved hypothetical protein [Ricinus communis] gi|223536076|gb|EEF37734.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255563431|ref|XP_002522718.1| conserved hypothetical protein [Ricinus communis] gi|223538068|gb|EEF39680.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.940 0.842 0.436 3.5e-36
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.617 0.553 0.542 1.5e-33
TAIR|locus:2131719260 PHOS34 "AT4G27320" [Arabidopsi 0.576 0.480 0.570 6e-32
TAIR|locus:2094751 804 AT3G21210 [Arabidopsis thalian 0.529 0.143 0.431 4.5e-23
TAIR|locus:2097755201 AT3G03270 [Arabidopsis thalian 0.511 0.552 0.304 0.00084
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 390 (142.3 bits), Expect = 3.5e-36, P = 3.5e-36
 Identities = 99/227 (43%), Positives = 121/227 (53%)

Query:     7 EPDRPVLPTRVPLMTNGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSV 66
             +P  P  P   P  T GAQRKI IAVDLSDESAYAV+WAV+NYLR GDAVVLLHV+ TSV
Sbjct:    21 QPSSPRFPISTP--TAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGDAVVLLHVQPTSV 78

Query:    67 LYGADWGFINNTE--NRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIV 124
             LYGADWG ++ +   + N++E      +L+     +T   A ++A+PL EA + +KIHIV
Sbjct:    79 LYGADWGAMDLSPQWDPNNEESQR---KLEDDFDIVTNKKASDVAQPLVEADIPFKIHIV 135

Query:   125 KDHDMKERLCLEVERLGLXXXXXXXXXXXXXXXXXXXXXXXXXXXDYXXXXXXXXXXXLR 184
             KDHDMKERLCLEVERLGL                           DY           +R
Sbjct:   136 KDHDMKERLCLEVERLGLSTLIMGSRGFGATKRSSKGRLGSVS--DYSVHHCACPVVVVR 193

Query:   185 YPXXXXXXXXXXXXA---------ELHPVPEE-----DDSEYHDFSD 217
             +P            +         +LH VPE      D  EYHD SD
Sbjct:   194 FPDDKDGEDEKSGDSGGENLMDSDKLHTVPEVAEEEGDKDEYHDASD 240
GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0002238 "response to molecule of fungal origin" evidence=RCA
GO:0016925 "protein sumoylation" evidence=RCA
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094751 AT3G21210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097755 AT3G03270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
BRADI1G25170.1
annotation not avaliable (257 aa)
(Brachypodium distachyon)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 3e-20
pfam00582139 pfam00582, Usp, Universal stress protein family 7e-19
COG0589154 COG0589, UspA, Universal stress protein UspA and r 9e-10
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 3e-08
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score = 82.4 bits (204), Expect = 3e-20
 Identities = 47/158 (29%), Positives = 70/158 (44%), Gaps = 31/158 (19%)

Query: 27  KIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEG 86
           +I +AVD S+ES  A+RWA     R G  +VLLHV        A+   +   E R     
Sbjct: 1   RILVAVDGSEESERALRWAARLARRLGAELVLLHVVDPPPSSAAELAELLEEEARAL--- 57

Query: 87  GWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMI 146
                              + + E L EAG++ +  ++ + D  E +    E LG   ++
Sbjct: 58  ------------------LEALREALAEAGVKVETVVL-EGDPAEAILEAAEELGADLIV 98

Query: 147 MGGRGIGIGAVRRSSVGR--LGSVSDYCVHHCVCPVVV 182
           MG RG       RS + R  LGSV++  + H  CPV+V
Sbjct: 99  MGSRG-------RSGLRRLLLGSVAERVLRHAPCPVLV 129

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 217
PRK15456142 universal stress protein UspG; Provisional 99.93
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.93
PRK15005144 universal stress protein F; Provisional 99.92
PRK09982142 universal stress protein UspD; Provisional 99.9
PRK15118144 universal stress global response regulator UspA; P 99.9
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.89
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.89
PRK10116142 universal stress protein UspC; Provisional 99.88
PRK11175 305 universal stress protein UspE; Provisional 99.88
cd01987124 USP_OKCHK USP domain is located between the N-term 99.85
PRK11175305 universal stress protein UspE; Provisional 99.8
cd00293130 USP_Like Usp: Universal stress protein family. The 99.79
COG0589154 UspA Universal stress protein UspA and related nuc 99.78
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.53
PRK10490 895 sensor protein KdpD; Provisional 99.32
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.19
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.47
PLN03159 832 cation/H(+) antiporter 15; Provisional 97.64
PLN03159832 cation/H(+) antiporter 15; Provisional 97.42
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 96.81
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 96.43
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 95.74
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 94.69
PRK12342254 hypothetical protein; Provisional 94.07
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 93.95
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 93.85
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 93.83
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 93.68
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 93.45
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 93.21
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 92.97
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 92.69
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 92.66
PRK03359256 putative electron transfer flavoprotein FixA; Revi 92.64
PRK06029185 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Prov 92.49
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 92.35
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 92.19
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 92.12
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 91.81
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 91.02
PLN02496209 probable phosphopantothenoylcysteine decarboxylase 90.52
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 90.43
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 89.18
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 88.95
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 88.35
PLN00200 404 argininosuccinate synthase; Provisional 88.2
COG2086260 FixA Electron transfer flavoprotein, beta subunit 88.18
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 88.17
PRK05253301 sulfate adenylyltransferase subunit 2; Provisional 87.11
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 85.14
COG0552340 FtsY Signal recognition particle GTPase [Intracell 84.34
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 84.29
TIGR00342371 thiazole biosynthesis/tRNA modification protein Th 83.66
PRK13820 394 argininosuccinate synthase; Provisional 83.3
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine n 82.95
PLN02948577 phosphoribosylaminoimidazole carboxylase 82.66
PRK10674 472 deoxyribodipyrimidine photolyase; Provisional 82.23
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 81.94
PF03746242 LamB_YcsF: LamB/YcsF family; InterPro: IPR005501 T 80.53
PF02887117 PK_C: Pyruvate kinase, alpha/beta domain; InterPro 80.08
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.93  E-value=5.2e-25  Score=165.68  Aligned_cols=140  Identities=20%  Similarity=0.237  Sum_probs=105.7

Q ss_pred             CCcEEEEEecCCh--hHHHHHHHHHHHhCCCCCeEEEEEEEeCCcccCcccccccCCCCCCCcCCCccccccchHHHHHH
Q 027929           24 AQRKIAIAVDLSD--ESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLT  101 (217)
Q Consensus        24 ~~~~IlVavD~s~--~s~~al~~A~~la~~~~~~l~lvhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  101 (217)
                      ||++||||+|+|+  .+.+|++||..+|+.. ++|+++||++......  +.   ....    .    .....+...+..
T Consensus         1 m~~~ILv~vD~S~~~~s~~al~~A~~la~~~-~~l~llhv~~~~~~~~--~~---~~~~----~----~~~~~~~~~~~~   66 (142)
T PRK15456          1 MYKTIIMPVDVFEMELSDKAVRHAEFLAQDD-GVIHLLHVLPGSASLS--LH---RFAA----D----VRRFEEHLQHEA   66 (142)
T ss_pred             CCccEEEeccCCchhHHHHHHHHHHHHHhcC-CeEEEEEEecCccccc--cc---cccc----c----hhhHHHHHHHHH
Confidence            5899999999994  8999999999999874 6999999987542110  00   0000    0    011223333334


Q ss_pred             HHHHHHHhhhhhhcCceEEEEEeecCChHHHHHHHHHHcCCCEEEEecCCCCCCcccccCCccccchhHHHhcCCCccEE
Q 027929          102 ATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVV  181 (217)
Q Consensus       102 ~~~~~~~~~~~~~~~v~v~~~v~~g~~~~~~I~~~a~~~~~dlIVlG~~~~~~~~~~~~~~~~~gS~s~~ll~~a~~PVl  181 (217)
                      ++.+.++.+.+...+.+++..+..| ++.+.|++++++.++||||||+++  ++ +.+.   ++||++++|+++++||||
T Consensus        67 ~~~l~~~~~~~~~~~~~v~~~v~~G-~~~~~I~~~a~~~~~DLIVmG~~g--~~-~~~~---llGS~a~~v~~~a~~pVL  139 (142)
T PRK15456         67 EERLQTMVSHFTIDPSRIKQHVRFG-SVRDEVNELAEELGADVVVIGSRN--PS-ISTH---LLGSNASSVIRHANLPVL  139 (142)
T ss_pred             HHHHHHHHHHhCCCCcceEEEEcCC-ChHHHHHHHHhhcCCCEEEEcCCC--CC-ccce---ecCccHHHHHHcCCCCEE
Confidence            4444445544444577889999998 799999999999999999999999  76 7788   999999999999999999


Q ss_pred             EEe
Q 027929          182 VLR  184 (217)
Q Consensus       182 vv~  184 (217)
                      |||
T Consensus       140 vV~  142 (142)
T PRK15456        140 VVR  142 (142)
T ss_pred             EeC
Confidence            996

>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>PLN02496 probable phosphopantothenoylcysteine decarboxylase Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK10674 deoxyribodipyrimidine photolyase; Provisional Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>PF03746 LamB_YcsF: LamB/YcsF family; InterPro: IPR005501 This entry represents the uncharacterised protein family UPF0271, including LamB Back     alignment and domain information
>PF02887 PK_C: Pyruvate kinase, alpha/beta domain; InterPro: IPR015795 Pyruvate kinase (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 1e-27
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 7e-22
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 3e-16
3loq_A294 Universal stress protein; structural genomics, PSI 2e-14
3loq_A294 Universal stress protein; structural genomics, PSI 6e-11
3tnj_A150 Universal stress protein (USP); structural genomic 5e-14
2z08_A137 Universal stress protein family; uncharacterized c 5e-14
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 2e-13
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 5e-13
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 7e-13
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 7e-12
3fg9_A156 Protein of universal stress protein USPA family; A 2e-11
3s3t_A146 Nucleotide-binding protein, universal stress PROT 4e-11
3dlo_A155 Universal stress protein; unknown function, struct 1e-10
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 1e-09
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 6e-07
3fdx_A143 Putative filament protein / universal stress PROT; 1e-09
3olq_A 319 Universal stress protein E; structural genomics, P 2e-08
3olq_A319 Universal stress protein E; structural genomics, P 5e-05
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 5e-08
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 5e-05
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 9e-06
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  102 bits (256), Expect = 1e-27
 Identities = 37/187 (19%), Positives = 73/187 (39%), Gaps = 32/187 (17%)

Query: 26  RKIAIAVDLSDESAY---------AVRWAVENYLRPGDA---VVLLHVRQTSVLYGADWG 73
            K+ +AV+ S    Y         A  W +E  +R   +   ++LLHV+           
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVD-------- 57

Query: 74  FINNTENRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIH---IVKDHDMK 130
                +  +D +  +   +              ++ E       +  +     +K  D K
Sbjct: 58  ----EDGFDDVDSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPK 113

Query: 131 ERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRYPDDSR 190
           + +C EV+R+    +++G RG+G    ++     +G+VS +CV H  CPV+ ++   D  
Sbjct: 114 DVICQEVKRVRPDFLVVGSRGLG--RFQK---VFVGTVSAFCVKHAECPVMTIKRNADET 168

Query: 191 SQHDSRD 197
               + D
Sbjct: 169 PSDPADD 175
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.94
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.93
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.93
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.93
3tnj_A150 Universal stress protein (USP); structural genomic 99.93
3fg9_A156 Protein of universal stress protein USPA family; A 99.92
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.92
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.92
3dlo_A155 Universal stress protein; unknown function, struct 99.92
2z08_A137 Universal stress protein family; uncharacterized c 99.92
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.91
3fdx_A143 Putative filament protein / universal stress PROT; 99.9
3olq_A 319 Universal stress protein E; structural genomics, P 99.88
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.87
3loq_A294 Universal stress protein; structural genomics, PSI 99.86
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.85
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.85
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.85
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.85
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.85
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.84
3loq_A294 Universal stress protein; structural genomics, PSI 99.84
3olq_A319 Universal stress protein E; structural genomics, P 99.82
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.73
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 95.31
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 94.95
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 94.77
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 94.4
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 94.39
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 94.27
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 94.23
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 94.09
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 93.84
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 93.79
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 93.65
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 93.63
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 93.54
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 93.5
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 93.37
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 93.35
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 93.17
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 92.04
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 91.46
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 91.17
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 90.57
1p3y_1194 MRSD protein; flavoprotein, FMN, rossmann fold, HF 88.91
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 88.75
2j4d_A 525 Cryptochrome 3, cryptochrome DASH; DNA-binding pro 88.39
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 86.58
1efv_B255 Electron transfer flavoprotein; electron transport 86.43
1u3d_A 509 Cryptochrome 1 apoprotein; photolyase, AMPPNP, sig 86.3
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 85.98
3tvs_A 538 Cryptochrome-1; circadian clock light entrainment, 85.84
1o97_C264 Electron transferring flavoprotein beta-subunit; F 85.65
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 84.66
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel 83.6
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 82.86
1dnp_A 471 DNA photolyase; DNA repair, electron transfer, exc 82.78
3fy4_A 537 6-4 photolyase; DNA repair, clock cryptochrome; HE 81.64
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 81.29
1owl_A 484 Photolyase, deoxyribodipyrimidine photolyase; DNA 80.83
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 80.48
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.94  E-value=3.9e-26  Score=170.45  Aligned_cols=143  Identities=21%  Similarity=0.220  Sum_probs=117.5

Q ss_pred             CCCCcEEEEEecCChhHHHHHHHHHHHhCCCCCeEEEEEEEeCCcccCcccccccCCCCCCCcCCCccccccchHHHHHH
Q 027929           22 NGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLT  101 (217)
Q Consensus        22 ~~~~~~IlVavD~s~~s~~al~~A~~la~~~~~~l~lvhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  101 (217)
                      .+++++||||+|+|+.+..+++||+.+|+..+++|+++||++...........              ....+.+...+..
T Consensus         2 ~~~~~~ILv~~D~s~~s~~al~~A~~la~~~~a~l~ll~v~~~~~~~~~~~~~--------------~~~~~~~~~~~~~   67 (146)
T 3s3t_A            2 NARYTNILVPVDSSDAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHTPALDP--------------VLSELLDAEAAHA   67 (146)
T ss_dssp             CCCCCEEEEECCSSHHHHHHHHHHHHHHHHHTCEEEEEEEEECCCCCCGGGHH--------------HHHHHHHHHHHHH
T ss_pred             CCccceEEEEcCCCHHHHHHHHHHHHHHHhcCCEEEEEEEecCcccccccccc--------------ccHHHHHHHHHHH
Confidence            46899999999999999999999999999999999999999875432110000              1122233344455


Q ss_pred             HHHHHHHhhhhhhcCc-eEEEEEeecCChHHHHHH-HHHHcCCCEEEEecCCCCCCcccccCCccccchhHHHhcCCCcc
Q 027929          102 ATNAKNIAEPLEEAGL-QYKIHIVKDHDMKERLCL-EVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCP  179 (217)
Q Consensus       102 ~~~~~~~~~~~~~~~v-~v~~~v~~g~~~~~~I~~-~a~~~~~dlIVlG~~~~~~~~~~~~~~~~~gS~s~~ll~~a~~P  179 (217)
                      ++.++++.+.+...|+ .+++.+..| ++.+.|++ ++++.++||||||+++  ++.+.++   ++||++++|+++++||
T Consensus        68 ~~~l~~~~~~~~~~g~~~~~~~~~~g-~~~~~I~~~~a~~~~~dliV~G~~~--~~~~~~~---~~Gs~~~~vl~~~~~p  141 (146)
T 3s3t_A           68 KDAMRQRQQFVATTSAPNLKTEISYG-IPKHTIEDYAKQHPEIDLIVLGATG--TNSPHRV---AVGSTTSYVVDHAPCN  141 (146)
T ss_dssp             HHHHHHHHHHHTTSSCCCCEEEEEEE-CHHHHHHHHHHHSTTCCEEEEESCC--SSCTTTC---SSCHHHHHHHHHCSSE
T ss_pred             HHHHHHHHHHHHhcCCcceEEEEecC-ChHHHHHHHHHhhcCCCEEEECCCC--CCCcceE---EEcchHHHHhccCCCC
Confidence            5556666667777899 999999999 79999999 9999999999999999  9999999   9999999999999999


Q ss_pred             EEEEe
Q 027929          180 VVVLR  184 (217)
Q Consensus       180 Vlvv~  184 (217)
                      |||||
T Consensus       142 VlvV~  146 (146)
T 3s3t_A          142 VIVIR  146 (146)
T ss_dssp             EEEEC
T ss_pred             EEEeC
Confidence            99997
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>1p3y_1 MRSD protein; flavoprotein, FMN, rossmann fold, HFCD family, oxdidative decarboxylation, cystein, lantibiotics, mersacidin, oxidore; HET: FAD; 2.54A {Bacillus SP} SCOP: c.34.1.1 Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>1dnp_A DNA photolyase; DNA repair, electron transfer, excitation energy transfer, carbon-carbon, lyase (carbon-carbon); HET: DNA FAD MHF; 2.30A {Escherichia coli} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 217
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 1e-16
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 4e-16
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 4e-13
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 6e-13
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 3e-12
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 2e-04
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 72.3 bits (176), Expect = 1e-16
 Identities = 32/164 (19%), Positives = 65/164 (39%), Gaps = 10/164 (6%)

Query: 26  RKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDE 85
           +KI    D S+ +  A++          + V+LLHV     +   D   +       +  
Sbjct: 4   KKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKS 63

Query: 86  GGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAM 145
                 +L +  T+      +NI + LE+ G + K  IV     +E + +          
Sbjct: 64  VEEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIA--------E 115

Query: 146 IMGGRGIGIGAVRRSSVGR--LGSVSDYCVHHCVCPVVVLRYPD 187
             G   I +G+  ++++    LGSV++  +     PV+V++  +
Sbjct: 116 DEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRKN 159
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.97
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.93
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.93
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.91
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.9
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.87
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 95.49
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 95.14
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.03
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.0
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.99
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.58
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 93.41
d1efpb_246 Small, beta subunit of electron transfer flavoprot 93.04
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 92.45
d1g5qa_174 Epidermin modifying enzyme (peptidyl-cysteine deca 92.39
d1u3da2185 Cryptochrome {Thale cress (Arabidopsis thaliana) [ 92.09
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 91.47
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 91.27
d3clsc1262 Small, beta subunit of electron transfer flavoprot 91.11
d3clsd1192 Large, alpha subunit of electron transfer flavopro 87.59
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 87.46
d1efvb_252 Small, beta subunit of electron transfer flavoprot 86.26
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 84.11
d1dnpa2200 DNA photolyase {Escherichia coli [TaxId: 562]} 81.61
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 81.46
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 81.14
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.97  E-value=1e-29  Score=191.62  Aligned_cols=159  Identities=22%  Similarity=0.228  Sum_probs=122.3

Q ss_pred             CCCcEEEEEecCChhHHHHHHHHHHHhCCCCCeEEEEEEEeCCcccCcccccccCCCCCCCcCCCccccccchHHHHHHH
Q 027929           23 GAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYGADWGFINNTENRNDDEGGWGGIQLDSTETDLTA  102 (217)
Q Consensus        23 ~~~~~IlVavD~s~~s~~al~~A~~la~~~~~~l~lvhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  102 (217)
                      +|++|||||+|+|+.+.++++||+.+|+..+++|+++||++.......................+.....+.+...+..+
T Consensus         1 ~m~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (160)
T d1mjha_           1 VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAK   80 (160)
T ss_dssp             CCCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHH
T ss_pred             CCcCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHHH
Confidence            48999999999999999999999999999999999999998754322111111111111111222233334444455555


Q ss_pred             HHHHHHhhhhhhcCceEEEEEeecCChHHHHHHHHHHcCCCEEEEecCCCCCCcccccCCccccchhHHHhcCCCccEEE
Q 027929          103 TNAKNIAEPLEEAGLQYKIHIVKDHDMKERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVV  182 (217)
Q Consensus       103 ~~~~~~~~~~~~~~v~v~~~v~~g~~~~~~I~~~a~~~~~dlIVlG~~~~~~~~~~~~~~~~~gS~s~~ll~~a~~PVlv  182 (217)
                      +..+.+...+...|+.+++.+..| ++.+.|++++++.++||||||+++  ++.+.++   |+||++++|+++++|||||
T Consensus        81 ~~l~~~~~~~~~~gv~~~~~~~~G-~~~~~I~~~a~~~~~dliV~G~~~--~~~~~~~---~~GS~a~~vl~~s~~pVlv  154 (160)
T d1mjha_          81 NKMENIKKELEDVGFKVKDIIVVG-IPHEEIVKIAEDEGVDIIIMGSHG--KTNLKEI---LLGSVTENVIKKSNKPVLV  154 (160)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEEEEE-CHHHHHHHHHHHTTCSEEEEESCC--SSCCTTC---SSCHHHHHHHHHCCSCEEE
T ss_pred             HHHHHHHHHHHhcCCeEEEEEEec-cHHHHHhhhhhccccceEEeccCC--CCccccc---ccCcHHHHHHhcCCCCEEE
Confidence            666667777788999999999999 799999999999999999999999  9999999   9999999999999999999


Q ss_pred             EeCCC
Q 027929          183 LRYPD  187 (217)
Q Consensus       183 v~~~~  187 (217)
                      ||++.
T Consensus       155 V~~~~  159 (160)
T d1mjha_         155 VKRKN  159 (160)
T ss_dssp             ECCCC
T ss_pred             EcCCC
Confidence            99764
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1g5qa_ c.34.1.1 (A:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1dnpa2 c.28.1.1 (A:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure