Citrus Sinensis ID: 027953

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------

MKTILLNLTVIALLITVVASDTPATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQTVIQTYNETTFSSCTTDDASDDDTFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISVNRGLGLPPSLNQPPPPPYIEPPGPETSQMTPVNINGGSPEIDNSALRSVANMRFLLSPLLIGVTSLLLAF

cHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccHHHHHccccEEEccEEEEEEcccccEEEEcccccccccccccccccccccccccccccccccEEEEEccccccEEEEcccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc

cHHHHHHHHHHHHHHHHHHHHcHHHHHccEEEccccccEEccccccccccHHHHHcccEEEEccEEEEEEccccEEEEEEEcccccccccccccccccEEEcccccccccccEEEEEEcccccEEEEEccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHc

MKTILLNLTVIALLITVVasdtpataytnhtvggpagwsfdainnisatnysswaanqtynlgDYLIFNTNTNQTVIQTYNettfsscttddasdddtfhyngggnefgqnVTIAVpltttgtnyffsdaedglqcqrGVAFEISVnrglglppslnqpppppyieppgpetsqmtpvninggspeidnsALRSVANMRFLLSPLLIGVTSLLLAF

MKTILLNLTVIALLITVVASDTPATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQTVIQTYNEttfsscttddasdddtFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISVNRGlglppslnqpppppyieppgpETSQMTPVNINGGSPEIDNSALRSVANMRFLLSPLLIGVTSLLLAF

**TILLNLTVIALLITVVASDTPATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQTVIQTYNETTFSSCTTDDASDDDTFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISVNRGL******************************************RSVANMRFLLSPLLIGVTSLLL**

******NLTVIALLITVVASDTPATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQTVIQTYNETTFSSCTTDDASDDDTFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISV****************************************************RFLLSPLLIGVTSLLLAF

*KTILLNLTVIALLITVVASDTPATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQTVIQTYNETTFSSCTTDDASDDDTFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISVNRG*****************************************ALRSVANMRFLLSPLLIGVTSLLLAF

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooo

SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooo

SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		216	2.2.26 [Sep-21-2011]
Q41001		189	Blue copper protein OS=Pi	N/A	no	0.453	0.518	0.278	5e-06
Q39131		172	Lamin-like protein OS=Ara	no	no	0.592	0.744	0.281	6e-06
P80728		108	Mavicyanin OS=Cucurbita p	N/A	no	0.476	0.953	0.270	0.0002

>sp\|Q41001\|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1	Back alignment and function desciption

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 24/122 (19%)

Query: 7   NLTVIALLITVVASDTPATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYL 66
           N  V+  L+ ++    P+ A T +TVG  +GW       +   +YS+WA+++T+ +GD L
Sbjct: 5   NALVLCFLLAIINMALPSLA-TVYTVGDTSGW-------VIGGDYSTWASDKTFAVGDSL 56

Query: 67  IFNTNTNQTVIQTYNETTFSSCTTDDASDDDTFHYNGGGNEFGQNVTIA--VPLTTTGTN 124
           +FN       +    E+ + SCT+              GN    + T A  +PL   G +
Sbjct: 57  VFNYGAGAHTVDEVKESDYKSCTS--------------GNSISTDSTGATTIPLKKAGKH 102

Query: 125 YF 126
           YF
Sbjct: 103 YF 104

Pisum sativum (taxid: 3888)

>sp\|Q39131\|LAML_ARATH Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1	Back alignment and function description

>sp\|P80728\|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		216
449454510		216	PREDICTED: blue copper protein-like [Cuc	0.944	0.944	0.635	3e-55
255541370		213	copper ion binding protein, putative [Ri	0.958	0.971	0.571	5e-51
225453816		205	PREDICTED: early nodulin-like protein 1-	0.898	0.946	0.625	6e-47
224173639		169	predicted protein [Populus trichocarpa]	0.685	0.875	0.635	1e-46
296089107		199	unnamed protein product [Vitis vinifera]	0.796	0.864	0.635	8e-46
357507017		208	hypothetical protein MTR_7g075770 [Medic	0.666	0.692	0.606	4e-44
356568300		209	PREDICTED: uncharacterized protein LOC10	0.944	0.976	0.582	1e-43
224127442		199	predicted protein [Populus trichocarpa]	0.685	0.743	0.628	2e-43
356530123		199	PREDICTED: lamin-like protein-like [Glyc	0.847	0.919	0.56	7e-39
242084596		241	hypothetical protein SORBIDRAFT_08g00178	0.875	0.784	0.440	6e-33

>gi\|449454510\|ref\|XP_004144997.1\| PREDICTED: blue copper protein-like [Cucumis sativus] gi\|449473465\|ref\|XP_004153889.1\| PREDICTED: blue copper protein-like [Cucumis sativus] gi\|449498902\|ref\|XP_004160666.1\| PREDICTED: blue copper protein-like [Cucumis sativus]	Back alignment and taxonomy information

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 131/206 (63%), Positives = 156/206 (75%), Gaps = 2/206 (0%)

Query: 10  VIALLITVVASDTPATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFN 69
           + ALLIT VAS TP TAYTN+TVGGPAGW F+A NNIS TNYSSWAA+QT+NLGD+LIF 
Sbjct: 11  LFALLITAVASQTPPTAYTNYTVGGPAGWFFNATNNISTTNYSSWAASQTFNLGDFLIFR 70

Query: 70  TNTNQTVIQTYNETTFSSCTTDDASDDDTFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSD 129
           TN+NQTVIQTYN TTF+SC+ DDASD+DT  Y GG + F + + I VPLT  G NYFFSD
Sbjct: 71  TNSNQTVIQTYNLTTFNSCSFDDASDNDTVQYYGGDSNFNKPLVIPVPLTIKGPNYFFSD 130

Query: 130 AEDGLQCQRGVAFEISVNRGLGLPPSLNQPPPPPYIEPPGPETSQMTPVNINGGSPEIDN 189
           A+DG+QCQRG+AFEI VN GLGLPPSLNQPPPPPY  PP  ++SQ  P  I   + +  N
Sbjct: 131 ADDGVQCQRGMAFEIEVNTGLGLPPSLNQPPPPPYATPPDSDSSQTPPFTIPDETKK--N 188

Query: 190 SALRSVANMRFLLSPLLIGVTSLLLA 215
              +SVAN+R  L    + V  LL++
Sbjct: 189 GGFKSVANLRQDLFFFFMAVIPLLMS 214

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255541370\|ref\|XP_002511749.1\| copper ion binding protein, putative [Ricinus communis] gi\|223548929\|gb\|EEF50418.1\| copper ion binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225453816\|ref\|XP_002276737.1\| PREDICTED: early nodulin-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224173639\|ref\|XP_002339794.1\| predicted protein [Populus trichocarpa] gi\|222832256\|gb\|EEE70733.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296089107\|emb\|CBI38810.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357507017\|ref\|XP_003623797.1\| hypothetical protein MTR_7g075770 [Medicago truncatula] gi\|355498812\|gb\|AES80015.1\| hypothetical protein MTR_7g075770 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356568300\|ref\|XP_003552350.1\| PREDICTED: uncharacterized protein LOC100783106 [Glycine max]	Back alignment and taxonomy information

>gi\|224127442\|ref\|XP_002320075.1\| predicted protein [Populus trichocarpa] gi\|222860848\|gb\|EEE98390.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356530123\|ref\|XP_003533633.1\| PREDICTED: lamin-like protein-like [Glycine max]	Back alignment and taxonomy information

>gi\|242084596\|ref\|XP_002442723.1\| hypothetical protein SORBIDRAFT_08g001780 [Sorghum bicolor] gi\|241943416\|gb\|EES16561.1\| hypothetical protein SORBIDRAFT_08g001780 [Sorghum bicolor]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		216
TAIR\|locus:2201801		228	ENODL18 "early nodulin-like pr	0.634	0.600	0.361	2.8e-18
TAIR\|locus:2062525		261	UCC1 "uclacyanin 1" [Arabidops	0.240	0.199	0.387	1.5e-06

TAIR\|locus:2201801 ENODL18 "early nodulin-like protein 18" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 221 (82.9 bits), Expect = 2.8e-18, P = 2.8e-18
 Identities = 51/141 (36%), Positives = 75/141 (53%)

Query:    11 IALLITVVASDTPATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNT 70
             + L++ ++     A AY N+TVG   GW FD     SA NY  WA +++++LGD+LIFNT
Sbjct:    11 VLLIMCLMLLSLSADAYKNYTVGESTGW-FDIQERPSA-NYQKWADSKSFSLGDFLIFNT 68

Query:    71 NTNQTVIQTYNEXXXXXXXXXXXXXXXXFHYNGGGNEFGQNV--TIAVPLTTTGTNYFFS 128
             ++N +V+QTY+                   ++         V  +I+VPL   G+NYFFS
Sbjct:    69 DSNHSVVQTYDFKTYKDCDYDNNENNDTTEWSAANPSATSPVPVSISVPLVKEGSNYFFS 128

Query:   129 DAEDGLQCQRGVAFEISVNRG 149
                DG QC+ G  F I+V  G
Sbjct:   129 GNYDGEQCKFGQHFMINVTHG 149

GO:0005507 "copper ion binding" evidence=IEA;ISS

GO:0005886 "plasma membrane" evidence=ISM

GO:0009055 "electron carrier activity" evidence=IEA

GO:0031225 "anchored to membrane" evidence=TAS

TAIR\|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_scaffold_21730000001	hypothetical protein (169 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		216
pfam02298		84	pfam02298, Cu_bind_like, Plastocyanin-like domain	1e-12
PLN03148		167	PLN03148, PLN03148, Blue copper-like protein; Prov	3e-08

>gnl\|CDD\|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain	Back alignment and domain information

 Score = 61.2 bits (149), Expect = 1e-12
 Identities = 26/103 (25%), Positives = 41/103 (39%), Gaps = 21/103 (20%)

Query: 38  WSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQ-TVIQTYNETTFSSCTTDDASDD 96
           W+          +Y+ WA+ +T+ +GD L+FN +     V++   +  + SC T      
Sbjct: 1   WTV-----PLNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEV-TKADYESCNTSKP--- 51

Query: 97  DTFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRG 139
               Y  G      N  I  PLT  G +YF         C+ G
Sbjct: 52  -IRTYTTG------NDII--PLTKPGQHYFICGVPG--HCKGG 83

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84

>gnl\|CDD\|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		216
PLN03148		167	Blue copper-like protein; Provisional	100.0
PF02298		85	Cu_bind_like: Plastocyanin-like domain; InterPro:	99.96
PRK02710		119	plastocyanin; Provisional	98.67
COG3794		128	PetE Plastocyanin [Energy production and conversio	98.25
PF00127		99	Copper-bind: Copper binding proteins, plastocyanin	98.09
TIGR02656		99	cyanin_plasto plastocyanin. Members of this family	98.08
TIGR03102		115	halo_cynanin halocyanin domain. Halocyanins are bl	97.97
TIGR02375		116	pseudoazurin pseudoazurin. Pseudoazurin, also call	97.84
KOG3858		233	consensus Ephrin, ligand for Eph receptor tyrosine	96.1
TIGR02657		83	amicyanin amicyanin. Members of this family are am	96.1
PF13473		104	Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D	95.85
PF06525		196	SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb	95.82
TIGR03095		148	rusti_cyanin rusticyanin. Rusticyanin is a blue co	95.2
COG4454		158	Uncharacterized copper-binding protein [Inorganic	94.68
PF00812		145	Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a	94.22
TIGR03094		195	sulfo_cyanin sulfocyanin. Members of this family a	92.94
TIGR03096		135	nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de	92.69
TIGR02376		311	Cu_nitrite_red nitrite reductase, copper-containin	88.72
PRK02888		635	nitrous-oxide reductase; Validated	88.28
PF00116		120	COX2: Cytochrome C oxidase subunit II, periplasmic	85.16
PLN02604		566	oxidoreductase	85.03
PF07732		117	Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01	83.61
PLN00044		596	multi-copper oxidase-related protein; Provisional	83.49
PRK10378		375	inactive ferrous ion transporter periplasmic prote	82.77
TIGR02866		201	CoxB cytochrome c oxidase, subunit II. Cytochrome	80.2

>PLN03148 Blue copper-like protein; Provisional	Back alignment and domain information

Probab=100.00  E-value=6.4e-41  Score=279.02  Aligned_cols=102  Identities=34%  Similarity=0.644  Sum_probs=93.6

Q ss_pred             CccceEEEEcCCCCCCcCccCCCCcccccccccCCeeeeCCEEEEEEcCCCceEEEeCcccCCCCCCCCCCCCCcceecC
Q 027953           24 ATAYTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQTVIQTYNETTFSSCTTDDASDDDTFHYNG  103 (216)
Q Consensus        24 a~~a~~~~VGg~~GW~~~p~~n~~~~~Y~~WAs~~~F~VGDtLvF~y~~~~h~V~~V~k~~Yd~C~~~~~~~~~~~~~~~  103 (216)
                      ++.+++|+|||+.||+.+       .||++|+++++|++||+|+|+|+++.|+|+||+|++|++|+.++++.    .|++
T Consensus        17 ~~~a~~~~VGd~~GW~~~-------~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~----~~ts   85 (167)
T PLN03148         17 ATTATDHIVGANKGWNPG-------INYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAG----NWTS   85 (167)
T ss_pred             hccceEEEeCCCCCcCCC-------CChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCcc----eecC
Confidence            345779999999999954       78999999999999999999999999999999999999999887654    8899


Q ss_pred             CCCccccceeEEEEeccccceEEEecCCCcccccCCCeEEEEee
Q 027953          104 GGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISVN  147 (216)
Q Consensus       104 G~~~f~~~~t~~V~L~~~G~~YFiC~~~~g~HC~~GmKl~I~V~  147 (216)
                      |++.        |+|+++|+|||||+ .  +||++||||.|+|.
T Consensus        86 G~d~--------v~L~~~G~~YFIcg-~--ghC~~GmKl~I~V~  118 (167)
T PLN03148         86 GKDF--------IPLNKAKRYYFICG-N--GQCFNGMKVTILVH  118 (167)
T ss_pred             CCcE--------EEecCCccEEEEcC-C--CccccCCEEEEEEc
Confidence            9997        99999999999999 4  79999999999995

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]	Back alignment and domain information

>PRK02710 plastocyanin; Provisional	Back alignment and domain information

>COG3794 PetE Plastocyanin [Energy production and conversion]	Back alignment and domain information

>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]	Back alignment and domain information

>TIGR02656 cyanin_plasto plastocyanin	Back alignment and domain information

>TIGR03102 halo_cynanin halocyanin domain	Back alignment and domain information

>TIGR02375 pseudoazurin pseudoazurin	Back alignment and domain information

>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02657 amicyanin amicyanin	Back alignment and domain information

>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D	Back alignment and domain information

>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus	Back alignment and domain information

>TIGR03095 rusti_cyanin rusticyanin	Back alignment and domain information

>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO)	Back alignment and domain information

>TIGR03094 sulfo_cyanin sulfocyanin	Back alignment and domain information

>TIGR03096 nitroso_cyanin nitrosocyanin	Back alignment and domain information

>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o	Back alignment and domain information

>PLN02604 oxidoreductase	Back alignment and domain information

>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties	Back alignment and domain information

>PLN00044 multi-copper oxidase-related protein; Provisional	Back alignment and domain information

>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional	Back alignment and domain information

>TIGR02866 CoxB cytochrome c oxidase, subunit II	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		216
1ws7_A		109	Crystal Structure Of Mavicyanin From Cucurbita Pepo		4e-04

>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109

Back alignment and structure

Iteration: 1

Score = 41.2 bits (95), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 33/123 (26%), Positives = 48/123 (39%), Gaps = 21/123 (17%) Query: 28 TNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTN-QTVIQTYNEXXXX 86 T H VG GW+ + +Y+ WA++ +++GD L+FN N V+Q E Sbjct: 3 TVHKVGDSTGWT-----TLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKS 57 Query: 87 XXXXXXXXXXXXFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISV 146 Y G + ++PL GT YF CQ G EI V Sbjct: 58 CNSSSPAAS-----YTSGAD--------SIPLKRPGTFYFLCGIPG--HCQLGQKVEIKV 102 Query: 147 NRG 149 + G Sbjct: 103 DPG 105

PyMOL of 1ws7

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		216
1jer_A		138	Cucumber stellacyanin; electron transport, copper,	1e-21
1x9u_A		116	Umecyanin; cupredoxin, phytocyanin, copper binding	2e-20
1ws8_A		109	Mavicyanin; oxidized form, phytocyanin, cupredoxin	4e-20
2cbp_A		96	Cucumber basic protein; electron transport, phytoc	2e-17
1f56_A		91	Plantacyanin; cupredoxin, copper protein, beta bar	4e-14

>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138	Back alignment and structure

 Score = 85.5 bits (211), Expect = 1e-21
 Identities = 37/151 (24%), Positives = 51/151 (33%), Gaps = 18/151 (11%)

Query: 28  TNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQ-TVIQTYNETTFS 86
           T H VG   GWS       S   YS WAA +T+ +GD L FN   N   V +   + +F 
Sbjct: 4   TVHIVGDNTGWSV----PSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFD 59

Query: 87  SCTTDDASDDDTFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISV 146
           +C   ++ +D                 +   L   G +YF         C  G    I+V
Sbjct: 60  ACNFVNSDND---VERTS--------PVIERLDELGMHYFVCTVGT--HCSNGQKLSINV 106

Query: 147 NRGLGLPPSLNQPPPPPYIEPPGPETSQMTP 177
                          PP    P P     +P
Sbjct: 107 VAANATVSMPPPSSSPPSSVMPPPVMPPPSP 137

PyMOL of 1jer

>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116	Back alignment and structure

>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109	Back alignment and structure

>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96	Back alignment and structure

>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		216
1jer_A		138	Cucumber stellacyanin; electron transport, copper,	100.0
1ws8_A		109	Mavicyanin; oxidized form, phytocyanin, cupredoxin	100.0
1x9u_A		116	Umecyanin; cupredoxin, phytocyanin, copper binding	100.0
2cbp_A		96	Cucumber basic protein; electron transport, phytoc	100.0
1f56_A		91	Plantacyanin; cupredoxin, copper protein, beta bar	99.97
1qhq_A		140	Protein (auracyanin); electron transfer, cupredoxi	99.2
1bxv_A		91	Plastocyanin; copper protein, electron transfer; 1	99.05
2cal_A		154	Rusticyanin; iron respiratory electron transport c	98.95
1pmy_A		123	Pseudoazurin; electron transfer(cuproprotein); 1.5	98.87
1paz_A		123	Pseudoazurin precursor; electron transfer(cupropro	98.86
2aan_A		139	Auracyanin A; cupredoxin fold, electron transport;	98.86
3erx_A		123	Pseudoazurin; copper protein, high-resolution, E t	98.76
3tu6_A		127	Pseudoazurin (blue copper protein); cupredoxins, b	98.72
1kdj_A		102	Plastocyanin; electron transfer, photosystem, PAI-	98.71
3ef4_A		124	Pseudoazurin, blue copper protein; electron transf	98.7
1plc_A		99	Plastocyanin; electron transport; 1.33A {Populus n	98.69
1iuz_A		98	Plastocyanin; electron transport; 1.60A {Ulva pert	98.68
2gim_A		106	Plastocyanin; beta sheet, Cu, helix, electron tran	98.68
1b3i_A		97	PETE protein, protein (plastocyanin); electron tra	98.61
2plt_A		98	Plastocyanin; electron transport; 1.50A {Chlamydom	98.59
1byp_A		99	Protein (plastocyanin); electron transfer, photosy	98.56
1pcs_A		98	Plastocyanin; electron transport; 2.15A {Synechocy	98.37
4hci_A		100	Cupredoxin 1; structural genomics, niaid, national	98.2
3ay2_A		167	Lipid modified azurin protein; beta sandwich, bact	98.03
3c75_A		132	Amicyanin; copper proteins, electron transfer comp	97.99
2ux6_A		122	Pseudoazurin; type-1 copper, metal-binding, redox	97.96
3cvb_A		105	Plastocyanin; cupredoxin, SELF assembly, copper, e	97.91
1cuo_A		129	Protein (azurin ISO-2); beta barrel, periplasmic,	97.88
1iko_P		178	Ephrin-B2; greek KEY, glycosylation, signaling pro	97.74
2ov0_A		105	Amicyanin; beta-sandwich, electron transport; 0.75	97.72
1id2_A		106	Amicyanin; beta barrel, type-1 blue copper protein	97.64
2iaa_C		128	Azurin; quinoprotein, tryptophan tryptophylquinone	97.54
2ccw_A		129	Azurin II, AZN-2; electron transport (cuproprotein	97.54
1nwp_A		128	Azurin; electron transport, cupredoxin, electron t	97.54
1iby_A		112	Nitrosocyanin; RED copper, cupredoxin, beta hairpi	97.07
2vsm_B		140	Ephrin-B2; developmental protein, henipavirus, neu	96.81
2x11_B		177	Ephrin-A5; receptor-signaling protein complex, dev	96.6
3czu_B		182	Ephrin-A1; ATP-binding, kinase, nucleotide-binding	96.07
2cua_A		135	Protein (CUA); CUA center, electron transport; 1.6	96.03
3d12_B		141	Ephrin-B3; beta propeller, protein-receptor comple	95.74
1shx_A		138	Ephrin-A5; ephrin signaling, hormone-growth factor	95.65
3fsa_A		125	Azurin; copper, cupredoxin fold, metal-binding, pr	94.76
3s8f_B		168	Cytochrome C oxidase subunit 2; complex IV, respir	94.49
2dv6_A		447	Nitrite reductase; electron transfer, reduction, d	93.79
2wo3_B		157	Ephrin-A2; transferase-signaling protein complex,	93.61
3sbq_A		638	Nitrous-oxide reductase; beta-propeller, cupredoxi	92.13
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	91.7
1mzy_A		333	Copper-containing nitrite reductase; mutant M182T,	82.04
1oe1_A		336	Dissimilatory copper-containing nitrite reductase;	81.62
1kbv_A		327	ANIA, major outer membrane protein PAN 1; ANIA[NO2	81.06

>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1	Back alignment and structure

Probab=100.00  E-value=1.3e-40  Score=268.71  Aligned_cols=108  Identities=26%  Similarity=0.497  Sum_probs=97.0

Q ss_pred             ceEEEEcCCCCCCcCccCCCCcccccccccCCeeeeCCEEEEEEcCCCceEEEe-CcccCCCCCCCCCCCCCcceecCCC
Q 027953           27 YTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQTVIQTY-NETTFSSCTTDDASDDDTFHYNGGG  105 (216)
Q Consensus        27 a~~~~VGg~~GW~~~p~~n~~~~~Y~~WAs~~~F~VGDtLvF~y~~~~h~V~~V-~k~~Yd~C~~~~~~~~~~~~~~~G~  105 (216)
                      +++|+|||+.||++++.    ..||++||++++|+|||+|+|+|..++|+|+|| +|++|+.|+.++++.    .+++|+
T Consensus         3 a~~~~VGg~~GW~~~~~----~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~----~~~~G~   74 (138)
T 1jer_A            3 STVHIVGDNTGWSVPSS----PNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDN----DVERTS   74 (138)
T ss_dssp             CCEEETTGGGCSSCCSS----TTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCC----CCCCCS
T ss_pred             ceEEEECCcCcCcCCCC----ccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccc----cccCCC
Confidence            56999999999999852    378999999999999999999999998999999 999999999887653    788998


Q ss_pred             CccccceeEEEEe-ccccceEEEecCCCcccccCCCeEEEEeeCCCCC
Q 027953          106 NEFGQNVTIAVPL-TTTGTNYFFSDAEDGLQCQRGVAFEISVNRGLGL  152 (216)
Q Consensus       106 ~~f~~~~t~~V~L-~~~G~~YFiC~~~~g~HC~~GmKl~I~V~~~~~~  152 (216)
                      +.        |+| +++|++||||+++  +||++||||+|+|....+.
T Consensus        75 ~~--------v~L~~~~G~~YFicg~~--gHC~~GmKl~I~V~~~~~~  112 (138)
T 1jer_A           75 PV--------IERLDELGMHYFVCTVG--THCSNGQKLSINVVAANAT  112 (138)
T ss_dssp             CE--------EEECCSSEEEEEECCST--TTGGGTCEEEEEEECCC--
T ss_pred             eE--------EEeccCCcCEEEEcCCC--CccccCCEEEEEEcCCCCC
Confidence            86        999 9999999999998  9999999999999886653

PyMOL of 1jer

>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A	Back alignment and structure

>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A	Back alignment and structure

>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1	Back alignment and structure

>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1	Back alignment and structure

>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A	Back alignment and structure

>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A	Back alignment and structure

>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A	Back alignment and structure

>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1	Back alignment and structure

>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A*	Back alignment and structure

>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus}	Back alignment and structure

>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A	Back alignment and structure

>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti}	Back alignment and structure

>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A	Back alignment and structure

>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0	Back alignment and structure

>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A	Back alignment and structure

>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A	Back alignment and structure

>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A	Back alignment and structure

>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A*	Back alignment and structure

>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1	Back alignment and structure

>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A	Back alignment and structure

>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A	Back alignment and structure

>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A	Back alignment and structure

>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae}	Back alignment and structure

>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A	Back alignment and structure

>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A	Back alignment and structure

>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A	Back alignment and structure

>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5	Back alignment and structure

>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ...	Back alignment and structure

>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1	Back alignment and structure

>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C*	Back alignment and structure

>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A	Back alignment and structure

>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A	Back alignment and structure

>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A	Back alignment and structure

>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E	Back alignment and structure

>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens}	Back alignment and structure

>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B*	Back alignment and structure

>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B*	Back alignment and structure

>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus}	Back alignment and structure

>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B*	Back alignment and structure

>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ...	Back alignment and structure

>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ...	Back alignment and structure

>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans}	Back alignment and structure

>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens}	Back alignment and structure

>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A	Back alignment and structure

>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ...	Back alignment and structure

>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		216
d1jera_		110	b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ	3e-18
d2cbpa_		96	b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ	1e-17
d1ws8a_		104	b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo)	2e-17
d1f56a_		91	b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera	1e-12

>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110	Back information, alignment and structure


class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Stellacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

 Score = 74.6 bits (183), Expect = 3e-18
 Identities = 33/120 (27%), Positives = 46/120 (38%), Gaps = 18/120 (15%)

Query: 28  TNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQ-TVIQTYNETTFS 86
           T H VG   GWS       S   YS WAA +T+ +GD L FN   N   V +   + +F 
Sbjct: 4   TVHIVGDNTGWSV----PSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFD 59

Query: 87  SCTTDDASDDDTFHYNGGGNEFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISV 146
           +C            +    N+  +   +   L   G +YF      G  C  G    I+V
Sbjct: 60  ACN-----------FVNSDNDVERTSPVIERLDELGMHYFVCTV--GTHCSNGQKLSINV 106

PyMOL of d1jera_

>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96	Back information, alignment and structure

>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104	Back information, alignment and structure

>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		216
d1ws8a_		104	Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663	100.0
d2cbpa_		96	Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3	100.0
d1jera_		110	Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3	100.0
d1f56a_		91	Plantacyanin {Spinach (Spinacia oleracea) [TaxId:	99.96
d1bypa_		99	Plastocyanin {White campion (Silene pratensis) [Ta	99.01
d1iuza_		98	Plastocyanin {Ulva pertusa, a sea lettuce [TaxId:	98.94
d2plta_		98	Plastocyanin {Green alga (Chlamydomonas reinhardti	98.88
d1kdja_		102	Plastocyanin {Fern (Adiantum capillus-veneris) [Ta	98.81
d1plca_		99	Plastocyanin {Poplar (Populus nigra), variant ital	98.79
d2q5ba1		105	Plastocyanin {Cyanobacterium (Phormidium laminosum	98.76
d2cj3a1		105	Plastocyanin {Anabaena variabilis [TaxId: 1172]}	98.75
d1paza_		120	Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta	98.75
d2jxma1		97	Plastocyanin {Photosynthetic prokaryote (Prochloro	98.69
d1adwa_		123	Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236	98.68
d1qhqa_		139	Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]	98.49
d1bqka_		124	Pseudoazurin {Achromobacter cycloclastes [TaxId: 2	98.48
d1pmya_		123	Pseudoazurin {Methylobacterium extorquens, strain	98.43
d1pcsa_		98	Plastocyanin {Cyanobacterium (Synechocystis sp.),	98.43
d1bxua_		91	Plastocyanin {Cyanobacterium (Synechocystis sp.),	98.34
d2ov0a1		105	Amicyanin {Paracoccus denitrificans [TaxId: 266]}	97.92
d1id2a_		106	Amicyanin {Paracoccus versutus (Thiobacillus versu	97.57
d1cuoa_		129	Azurin {Methylomonas sp. j [TaxId: 32038]}	97.22
d2ccwa1		129	Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d	96.99
d1ibya_		112	Red copper protein nitrosocyanin {Nitrosomonas eur	96.83
d1e30a_		153	Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920	96.76
d1shxa1		138	Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]}	96.07
d1qnia1		131	Nitrous oxide reductase, C-terminal domain {Pseudo	95.89
d2cuaa_		122	Cytochrome c oxidase {Thermus thermophilus, ba3 ty	95.85
d1aoza1		129	Ascorbate oxidase {Zucchini (Cucurbita pepo var. m	95.58
d1fwxa1		132	Nitrous oxide reductase, C-terminal domain {Paraco	95.57
d1jzga_		128	Azurin {Pseudomonas aeruginosa [TaxId: 287]}	95.4
d1kbva1		151	Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani	95.2
d1ikop_		141	Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId:	95.13
d1nwpa_		128	Azurin {Pseudomonas putida [TaxId: 303]}	93.62
d1oe2a1		159	Nitrite reductase, NIR {Alcaligenes xylosoxidans [	91.59
d1gyca1		130	Laccase {Trametes versicolor, laccase 2 [TaxId: 53	91.04
d1mzya1		153	Nitrite reductase, NIR {Rhodobacter sphaeroides [T	90.58
d2bw4a1		157	Nitrite reductase, NIR {Alcaligenes xylosoxidans [	90.49
d1hfua1		131	Laccase {Inky cap fungus (Coprinus cinereus) [TaxI	83.8
d1v10a1		136	Laccase {Rigidoporus lignosus [TaxId: 219653]}	81.81

>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]}	Back information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=3.2e-37  Score=235.94  Aligned_cols=102  Identities=31%  Similarity=0.651  Sum_probs=93.6

Q ss_pred             ceEEEEcCCCCCCcCccCCCCcccccccccCCeeeeCCEEEEEEcCCCceEEEeCcccCCCCCCCCCCCCCcceecCCCC
Q 027953           27 YTNHTVGGPAGWSFDAINNISATNYSSWAANQTYNLGDYLIFNTNTNQTVIQTYNETTFSSCTTDDASDDDTFHYNGGGN  106 (216)
Q Consensus        27 a~~~~VGg~~GW~~~p~~n~~~~~Y~~WAs~~~F~VGDtLvF~y~~~~h~V~~V~k~~Yd~C~~~~~~~~~~~~~~~G~~  106 (216)
                      |++|+|||+.||+.++.     .+|++|+++++|++||+|+|+|.+++|+|++|++++|++|+..+++    ..+++|++
T Consensus         2 at~~~VGg~~gW~~~~~-----~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~~~----~~~~~G~~   72 (104)
T d1ws8a_           2 ATVHKVGDSTGWTTLVP-----YDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPA----ASYTSGAD   72 (104)
T ss_dssp             CCEEETTGGGCSCSSSC-----CCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCS----EEECSSEE
T ss_pred             CcEEEeCCcCccCcCCC-----cCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCCcc----ccccCCCe
Confidence            56999999999998742     6899999999999999999999999999999999999999988754    37888887


Q ss_pred             ccccceeEEEEeccccceEEEecCCCcccccCCCeEEEEee
Q 027953          107 EFGQNVTIAVPLTTTGTNYFFSDAEDGLQCQRGVAFEISVN  147 (216)
Q Consensus       107 ~f~~~~t~~V~L~~~G~~YFiC~~~~g~HC~~GmKl~I~V~  147 (216)
                      .        |+|+++|++||||+++  +||++||||.|+|.
T Consensus        73 ~--------v~l~~~g~~yF~C~~~--~HC~~Gmkl~I~V~  103 (104)
T d1ws8a_          73 S--------IPLKRPGTFYFLCGIP--GHCQLGQKVEIKVD  103 (104)
T ss_dssp             E--------EECCSSEEEEEECCST--TTTTTTCEEEEEEC
T ss_pred             E--------EEEecCccEEEECCCc--chhhCCCEEEEEEC
Confidence            6        8999999999999998  99999999999995

PyMOL of d1ws8a_

>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]}	Back information, alignment and structure

>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]}	Back information, alignment and structure

>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]}	Back information, alignment and structure

>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]}	Back information, alignment and structure

>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]}	Back information, alignment and structure

>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]}	Back information, alignment and structure

>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}	Back information, alignment and structure

>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]}	Back information, alignment and structure

>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]}	Back information, alignment and structure

>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}	Back information, alignment and structure

>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]}	Back information, alignment and structure

>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]}	Back information, alignment and structure

>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]}	Back information, alignment and structure

>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]}	Back information, alignment and structure

>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]}	Back information, alignment and structure

>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]}	Back information, alignment and structure

>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]}	Back information, alignment and structure

>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}	Back information, alignment and structure

>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]}	Back information, alignment and structure

>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]}	Back information, alignment and structure

>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}	Back information, alignment and structure

>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}	Back information, alignment and structure

>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}	Back information, alignment and structure

>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}	Back information, alignment and structure

>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]}	Back information, alignment and structure

>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}	Back information, alignment and structure

>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}	Back information, alignment and structure

>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]}	Back information, alignment and structure