Citrus Sinensis ID: 027979

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MINEGEGGALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVILQIAS
cccccccccEEEEEEEEcccEEEEEcccHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHcccccccccEEccEEEEEEEcccHHHHHHHccccccHHHHHHHHHHccEEEEEccccccccccccHHHHHHHHHHHcccccEEEEEEcccccccccccccccccHHHHcccccHHHHccccccccccccEEEEEEEccccccHHHHHHHHHc
ccccccccccHHHHHHHccccEEccHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHEcHHHHHHHHHccccEEEEEEHHHHHHHHccccHHHHHccHHHHHHHHcEEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHccccccHHHHHHcHHHHHHHHcccccccHHccccEEEEEccccccHHHHHHHHHc
minegeggALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLettglanpaplasvLWLDDQLESAVRLDSIITVVDAKNLLFQIdkyrhlssypeaiHQIAFADVVILNkvdlvspersgdslDELEKEIHEINSLAHVIRSVRCQvdlsevlncraydaTHVTRLEGLleehqykssqnlhdnnvrtlsiceplavNLDKVILQIAS
MINEGEGGALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLEttglanpapLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSIceplavnldKVILQIAS
MINEGEGGALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVILQIAS
********ALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLV*************KEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVILQI**
*******GALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGL***********LHDNNVRTLSICEPLAVNLDKVILQIAS
********ALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVILQIAS
******GGALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVILQIAS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINEGEGGALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVILQIAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
Q8VEH6393 COBW domain-containing pr yes no 0.731 0.402 0.469 1e-35
Q9BRT8395 COBW domain-containing pr no no 0.736 0.402 0.453 2e-35
Q99MB4394 COBW domain-containing pr yes no 0.736 0.403 0.453 4e-35
Q5JTY5395 COBW domain-containing pr no no 0.736 0.402 0.447 7e-35
Q8IUF1395 COBW domain-containing pr no no 0.736 0.402 0.447 8e-35
Q4V339395 COBW domain-containing pr no no 0.736 0.402 0.441 2e-34
Q5RIA9395 COBW domain-containing pr no no 0.736 0.402 0.441 2e-34
O74310411 COBW domain-containing pr yes no 0.740 0.389 0.458 2e-32
P53729429 Uncharacterized protein Y yes no 0.851 0.428 0.334 2e-26
Q869Q0 475 COBW domain-containing pr no no 0.763 0.347 0.324 2e-19
>sp|Q8VEH6|CBWD1_MOUSE COBW domain-containing protein 1 OS=Mus musculus GN=Cbwd1 PE=2 SV=1 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/162 (46%), Positives = 108/162 (66%), Gaps = 4/162 (2%)

Query: 6   EGGALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLW 65
           +GG L EEW+EL NGC+CC+VK S ++A+E L+Q+K + D+ILLETTGLA+P  +AS+ W
Sbjct: 90  QGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFW 149

Query: 66  LDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPE 125
           +D +L S + LD IITVVD+K  L  + + +      EA  Q+A AD++++NK DLVS E
Sbjct: 150 VDAELGSDIYLDGIITVVDSKYGLKHLTEEKPDGLVNEATRQVALADMILINKTDLVSEE 209

Query: 126 RSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYD 167
                L+ L   I  IN L  V+ + R +V LS +L+  AYD
Sbjct: 210 E----LNNLRTTIRSINGLGKVLETQRSRVHLSNILDLHAYD 247

Mus musculus (taxid: 10090)
>sp|Q9BRT8|CBWD1_HUMAN COBW domain-containing protein 1 OS=Homo sapiens GN=CBWD1 PE=1 SV=1 Back     alignment and function description
>sp|Q99MB4|CBWD1_RAT COBW domain-containing protein 1 OS=Rattus norvegicus GN=Cbwd1 PE=2 SV=2 Back     alignment and function description
>sp|Q5JTY5|CBWD3_HUMAN COBW domain-containing protein 3 OS=Homo sapiens GN=CBWD3 PE=2 SV=1 Back     alignment and function description
>sp|Q8IUF1|CBWD2_HUMAN COBW domain-containing protein 2 OS=Homo sapiens GN=CBWD2 PE=1 SV=1 Back     alignment and function description
>sp|Q4V339|CBWD6_HUMAN COBW domain-containing protein 6 OS=Homo sapiens GN=CBWD6 PE=2 SV=1 Back     alignment and function description
>sp|Q5RIA9|CBWD5_HUMAN COBW domain-containing protein 5 OS=Homo sapiens GN=CBWD5 PE=2 SV=1 Back     alignment and function description
>sp|O74310|YOG5_SCHPO COBW domain-containing protein C15D4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.05 PE=3 SV=1 Back     alignment and function description
>sp|P53729|YN8H_YEAST Uncharacterized protein YNR029C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR029C PE=1 SV=1 Back     alignment and function description
>sp|Q869Q0|Y4527_DICDI COBW domain-containing protein DDB_G0274527 OS=Dictyostelium discoideum GN=DDB_G0274527 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
297738062 621 unnamed protein product [Vitis vinifera] 0.981 0.341 0.811 3e-92
225423525 368 PREDICTED: COBW domain-containing protei 0.981 0.576 0.811 1e-91
145336129 374 Cobalamin biosynthesis CobW-like protein 0.962 0.556 0.745 2e-85
62321492 364 hypothetical protein [Arabidopsis thalia 0.962 0.571 0.745 3e-85
224101437 375 predicted protein [Populus trichocarpa] 0.981 0.565 0.754 5e-84
297845544 374 hypothetical protein ARALYDRAFT_472757 [ 0.962 0.556 0.731 7e-84
356494965 365 PREDICTED: COBW domain-containing protei 0.967 0.572 0.747 3e-83
255542064 413 protein with unknown function [Ricinus c 0.986 0.515 0.739 9e-83
449523868 367 PREDICTED: COBW domain-containing protei 0.972 0.572 0.728 3e-81
357487507 370 COBW domain-containing protein [Medicago 0.967 0.564 0.719 1e-80
>gi|297738062|emb|CBI27263.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 189/212 (89%)

Query: 1   MINEGEGGALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPL 60
           MINEG+ GALVEEWVELANGCICCTVKHSLVQALEQLVQ KERLDHILLETTGLANPAPL
Sbjct: 75  MINEGDNGALVEEWVELANGCICCTVKHSLVQALEQLVQMKERLDHILLETTGLANPAPL 134

Query: 61  ASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVD 120
           ASVLWLDDQLES+VRLDSIITVVDAKNL FQ++ +   SS+PEA  QIAFADVVILNKVD
Sbjct: 135 ASVLWLDDQLESSVRLDSIITVVDAKNLRFQLNSHHGSSSFPEAFLQIAFADVVILNKVD 194

Query: 121 LVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEE 180
           LVSPE SG  L+ELEKEIH INSLA++I SVRCQVDLS++L+CRAYDATH T LE LLEE
Sbjct: 195 LVSPEESGGVLEELEKEIHNINSLANIIHSVRCQVDLSKILDCRAYDATHATHLEALLEE 254

Query: 181 HQYKSSQNLHDNNVRTLSICEPLAVNLDKVIL 212
           +Q  SS++LHD+NVRTL I EPL V+LDKV L
Sbjct: 255 NQSLSSKDLHDSNVRTLCISEPLPVDLDKVRL 286

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225423525|ref|XP_002274691.1| PREDICTED: COBW domain-containing protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|145336129|ref|NP_173974.3| Cobalamin biosynthesis CobW-like protein [Arabidopsis thaliana] gi|63147374|gb|AAY34160.1| At1g26520 [Arabidopsis thaliana] gi|332192579|gb|AEE30700.1| Cobalamin biosynthesis CobW-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|62321492|dbj|BAD94941.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224101437|ref|XP_002312279.1| predicted protein [Populus trichocarpa] gi|222852099|gb|EEE89646.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297845544|ref|XP_002890653.1| hypothetical protein ARALYDRAFT_472757 [Arabidopsis lyrata subsp. lyrata] gi|297336495|gb|EFH66912.1| hypothetical protein ARALYDRAFT_472757 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356494965|ref|XP_003516351.1| PREDICTED: COBW domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255542064|ref|XP_002512096.1| protein with unknown function [Ricinus communis] gi|223549276|gb|EEF50765.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|449523868|ref|XP_004168945.1| PREDICTED: COBW domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357487507|ref|XP_003614041.1| COBW domain-containing protein [Medicago truncatula] gi|355515376|gb|AES96999.1| COBW domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
TAIR|locus:2197895374 AT1G26520 "AT1G26520" [Arabido 0.962 0.556 0.745 2.2e-80
UNIPROTKB|Q9BRT8395 CBWD1 "COBW domain-containing 0.884 0.483 0.411 2.8e-34
MGI|MGI:2385089393 Cbwd1 "COBW domain containing 0.879 0.483 0.421 4.6e-34
UNIPROTKB|Q5JTY5395 CBWD3 "COBW domain-containing 0.884 0.483 0.406 5.8e-34
UNIPROTKB|Q4V339395 CBWD6 "COBW domain-containing 0.884 0.483 0.401 7.4e-34
UNIPROTKB|Q8IUF1395 CBWD2 "COBW domain-containing 0.884 0.483 0.406 7.4e-34
RGD|708495394 Cbwd1 "COBW domain containing 0.879 0.482 0.411 1.2e-33
DICTYBASE|DDB_G0281589 396 DDB_G0281589 "COBW domain-cont 0.402 0.219 0.459 1.4e-33
UNIPROTKB|Q5RIA9395 CBWD5 "COBW domain-containing 0.884 0.483 0.401 1.5e-33
ZFIN|ZDB-GENE-040426-2388366 cbwd "COBW domain containing" 0.912 0.538 0.403 2.5e-33
TAIR|locus:2197895 AT1G26520 "AT1G26520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 807 (289.1 bits), Expect = 2.2e-80, P = 2.2e-80
 Identities = 158/212 (74%), Positives = 184/212 (86%)

Query:     1 MINEGEGGALVEEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPL 60
             MINEGE GA+VEEWVELANGC+CCTVKHSLVQALEQLVQRK+RLDHILLETTGLANPAPL
Sbjct:    88 MINEGEEGAIVEEWVELANGCVCCTVKHSLVQALEQLVQRKDRLDHILLETTGLANPAPL 147

Query:    61 ASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVD 120
             AS+LWLDDQLES V+LD I+TVVDAKNL FQ+++ R  SS+PEA +QIAFAD +I+NKVD
Sbjct:   148 ASILWLDDQLESEVKLDCIVTVVDAKNLRFQLNERRDSSSFPEAFNQIAFADTIIMNKVD 207

Query:   121 LVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEE 180
             L+S E S    DELEKEIH INSLA+VIRSVRCQVDLS +LNC+AYD+THV+RLE LLE 
Sbjct:   208 LISQEES----DELEKEIHSINSLANVIRSVRCQVDLSNILNCQAYDSTHVSRLESLLEA 263

Query:   181 HQYKSSQNLHDNNVRTLSICEPLAVNLDKVIL 212
             ++  ++ +LHD+ VRTL I EP  +NLDKV L
Sbjct:   264 NKSLTTTDLHDSGVRTLCISEPQPINLDKVRL 295
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|Q9BRT8 CBWD1 "COBW domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2385089 Cbwd1 "COBW domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JTY5 CBWD3 "COBW domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V339 CBWD6 "COBW domain-containing protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IUF1 CBWD2 "COBW domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|708495 Cbwd1 "COBW domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281589 DDB_G0281589 "COBW domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RIA9 CBWD5 "COBW domain-containing protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2388 cbwd "COBW domain containing" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
COG0523323 COG0523, COG0523, Putative GTPases (G3E family) [G 7e-53
cd03112158 cd03112, CobW_like, The function of this protein f 8e-39
pfam02492178 pfam02492, cobW, CobW/HypB/UreG, nucleotide-bindin 2e-38
TIGR02475341 TIGR02475, CobW, cobalamin biosynthesis protein Co 1e-22
PRK11537318 PRK11537, PRK11537, putative GTP-binding protein Y 1e-17
>gnl|CDD|223597 COG0523, COG0523, Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information 
 Score =  172 bits (437), Expect = 7e-53
 Identities = 83/208 (39%), Positives = 122/208 (58%), Gaps = 21/208 (10%)

Query: 2   INE-GE----GGALV----EEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETT 52
           +NE GE    GGAL+    EE VEL NGCICCTV+  L+ ALE+L++R++R D +++ETT
Sbjct: 34  VNEFGEVGIDGGALLSDTGEEVVELTNGCICCTVRDDLLPALERLLRRRDRPDRLVIETT 93

Query: 53  GLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFAD 112
           GLA+PAP+      D +L   VRLD ++TVVDA + L  +D     +    A  Q+AFAD
Sbjct: 94  GLADPAPVIQTFLTDPELADGVRLDGVVTVVDAAHFLEGLD-----AIAELAEDQLAFAD 148

Query: 113 VVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDAT-HV 171
           V++LNK DLV  E     L+ LE  + ++N  A +I +    VDL+E+L+   +D    V
Sbjct: 149 VIVLNKTDLVDAE----ELEALEARLRKLNPRARIIETSYGDVDLAELLDEGLFDLDRDV 204

Query: 172 TRLEGLLEEHQYKSSQNLHDNNVRTLSI 199
            R   L  +HQ+       +  + + S+
Sbjct: 205 GRTSPLFSDHQHDHE--HDEGGISSFSV 230

Length = 323
>gnl|CDD|239386 cd03112, CobW_like, The function of this protein family is unkown Back     alignment and domain information
>gnl|CDD|217066 pfam02492, cobW, CobW/HypB/UreG, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|233883 TIGR02475, CobW, cobalamin biosynthesis protein CobW Back     alignment and domain information
>gnl|CDD|183183 PRK11537, PRK11537, putative GTP-binding protein YjiA; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
COG0523323 Putative GTPases (G3E family) [General function pr 100.0
KOG2743391 consensus Cobalamin synthesis protein [Coenzyme tr 100.0
PRK11537318 putative GTP-binding protein YjiA; Provisional 100.0
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 100.0
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 99.97
cd03112158 CobW_like The function of this protein family is u 99.95
TIGR00101199 ureG urease accessory protein UreG. This model rep 99.69
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 99.58
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 99.54
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.91
PRK09435332 membrane ATPase/protein kinase; Provisional 98.35
COG2403449 Predicted GTPase [General function prediction only 98.26
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.55
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.11
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.0
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 96.89
PRK00089292 era GTPase Era; Reviewed 96.81
cd00881189 GTP_translation_factor GTP translation factor fami 96.58
cd03114148 ArgK-like The function of this protein family is u 96.47
PRK13768253 GTPase; Provisional 95.95
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 95.81
PRK15494339 era GTPase Era; Provisional 95.67
COG1159298 Era GTPase [General function prediction only] 95.65
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 95.41
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 95.26
TIGR00436270 era GTP-binding protein Era. Era is an essential G 95.07
cd03115173 SRP The signal recognition particle (SRP) mediates 94.93
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 94.72
PRK00093435 GTP-binding protein Der; Reviewed 93.93
cd01878204 HflX HflX subfamily. A distinct conserved domain w 93.83
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 93.59
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 93.45
COG0218200 Predicted GTPase [General function prediction only 93.44
COG2262411 HflX GTPases [General function prediction only] 93.22
COG1160444 Predicted GTPases [General function prediction onl 93.21
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 93.03
PRK14974336 cell division protein FtsY; Provisional 92.99
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 92.64
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 92.61
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 92.54
PRK12298390 obgE GTPase CgtA; Reviewed 92.19
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 92.11
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 91.96
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 91.59
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 91.43
TIGR00231161 small_GTP small GTP-binding protein domain. This m 91.39
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 91.25
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 91.21
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 90.97
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 90.76
TIGR00959428 ffh signal recognition particle protein. This mode 90.65
PRK01889 356 GTPase RsgA; Reviewed 90.54
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 90.36
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 90.31
PRK10867433 signal recognition particle protein; Provisional 90.12
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 89.76
PRK12296 500 obgE GTPase CgtA; Reviewed 89.73
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 89.42
PRK09866 741 hypothetical protein; Provisional 89.33
TIGR00064272 ftsY signal recognition particle-docking protein F 89.32
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 89.24
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 89.12
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 88.91
cd03110179 Fer4_NifH_child This protein family's function is 88.88
cd04105203 SR_beta Signal recognition particle receptor, beta 88.79
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 88.77
PRK12299335 obgE GTPase CgtA; Reviewed 88.67
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 88.51
PF09439181 SRPRB: Signal recognition particle receptor beta s 88.5
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 88.35
KOG0090238 consensus Signal recognition particle receptor, be 88.23
cd00154159 Rab Rab family. Rab GTPases form the largest famil 87.91
cd01881176 Obg_like The Obg-like subfamily consists of five w 87.72
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 87.44
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 87.37
PRK10416318 signal recognition particle-docking protein FtsY; 87.2
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 86.81
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 86.69
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 86.69
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 86.68
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 86.68
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 86.68
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 86.67
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 86.23
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 86.17
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 86.11
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 85.98
PRK15467158 ethanolamine utilization protein EutP; Provisional 85.95
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 85.49
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 85.42
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 85.35
KOG0780 483 consensus Signal recognition particle, subunit Srp 85.31
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 85.27
COG3276 447 SelB Selenocysteine-specific translation elongatio 85.02
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 84.99
PRK12297424 obgE GTPase CgtA; Reviewed 84.71
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 84.63
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 84.4
PTZ00099176 rab6; Provisional 84.37
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 84.1
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 84.1
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 83.67
PRK00771437 signal recognition particle protein Srp54; Provisi 83.66
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 83.5
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 83.39
PRK11058426 GTPase HflX; Provisional 83.29
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 82.92
smart00178184 SAR Sar1p-like members of the Ras-family of small 82.9
cd00876160 Ras Ras family. The Ras family of the Ras superfam 82.89
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 82.45
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 82.41
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 82.32
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 82.32
PRK00049 396 elongation factor Tu; Reviewed 82.05
COG1161 322 Predicted GTPases [General function prediction onl 81.82
PRK12736 394 elongation factor Tu; Reviewed 81.74
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 81.57
cd04171164 SelB SelB subfamily. SelB is an elongation factor 81.38
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 81.37
PRK00454196 engB GTP-binding protein YsxC; Reviewed 81.3
PRK04000 411 translation initiation factor IF-2 subunit gamma; 81.16
KOG2484 435 consensus GTPase [General function prediction only 80.92
PF00025175 Arf: ADP-ribosylation factor family The prints ent 80.91
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 80.61
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 80.49
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 80.35
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 80.1
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=4.6e-48  Score=334.19  Aligned_cols=203  Identities=38%  Similarity=0.624  Sum_probs=172.6

Q ss_pred             Cccc----CCCc-eee----eeeeecCCCcEEeecchhHHHHHHHHHHhcCCCCEEEEecCCCCCcHHHHHHhhcCcccc
Q 027979            1 MINE----GEGG-ALV----EEWVELANGCICCTVKHSLVQALEQLVQRKERLDHILLETTGLANPAPLASVLWLDDQLE   71 (216)
Q Consensus         1 ~~ne----g~dg-~~~----~~v~eL~~GCiCCsl~~dl~~~L~~l~~~~~~~d~IiIE~sG~a~P~~i~~~l~~~~~l~   71 (216)
                      +|||    |||| .++    ++++||+|||||||+|+|+++++.+|.+++.+||||+|||||+|+|.|++++++.++.+.
T Consensus        33 IVNEfGEvgID~~~~l~~~~e~~~El~nGCICCT~r~dl~~~~~~L~~~~~~~D~ivIEtTGlA~P~pv~~t~~~~~~l~  112 (323)
T COG0523          33 IVNEFGEVGIDGGALLSDTGEEVVELTNGCICCTVRDDLLPALERLLRRRDRPDRLVIETTGLADPAPVIQTFLTDPELA  112 (323)
T ss_pred             EEecCccccccCCCccccCCccEEEeCCceEEEeccchhHHHHHHHHhccCCCCEEEEeCCCCCCCHHHHHHhccccccc
Confidence            4899    8994 666    479999999999999999999999998856779999999999999999999998778899


Q ss_pred             cceeeccEEEEEcccchHHHHhhcccCCChhHHHHHHhhccEEEEccCCCCCCCCccchHHHHHHHHHhhCCCCEEEEee
Q 027979           72 SAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSV  151 (216)
Q Consensus        72 ~~~~l~~vI~vVDa~~~~~~l~~~~~~~~~~~~~~QI~~AD~IvlnK~D~v~~~~~~~~l~~i~~~l~~lNP~A~iv~~~  151 (216)
                      +.++++++||||||.+|...+...     ..++.+||++||+|+|||+|+++++    .++++++.++++||.|+|+.++
T Consensus       113 ~~~~ld~vvtvVDa~~~~~~~~~~-----~~~~~~Qia~AD~ivlNK~Dlv~~~----~l~~l~~~l~~lnp~A~i~~~~  183 (323)
T COG0523         113 DGVRLDGVVTVVDAAHFLEGLDAI-----AELAEDQLAFADVIVLNKTDLVDAE----ELEALEARLRKLNPRARIIETS  183 (323)
T ss_pred             cceeeceEEEEEeHHHhhhhHHHH-----HHHHHHHHHhCcEEEEecccCCCHH----HHHHHHHHHHHhCCCCeEEEcc
Confidence            999999999999999999887531     3467899999999999999999986    4799999999999999999999


Q ss_pred             cCCCChhhhhccCCCCccchhhhhhhhhhhcc--CCCCCCCCCCEEEEEEEcCCCCCHHHHHHhHc
Q 027979          152 RCQVDLSEVLNCRAYDATHVTRLEGLLEEHQY--KSSQNLHDNNVRTLSICEPLAVNLDKVILQIA  215 (216)
Q Consensus       152 ~~~v~~~~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~h~~~v~t~~~~~~~p~~~~~~~~~l~  215 (216)
                      ++.+++..+++...|+..+.   ..+...+..  ++.|++|+++++|+++..++|+||++|..||.
T Consensus       184 ~~~~~~~~ll~~~~~~~~~~---~~~~~~~~~~~~h~h~~~~~~i~s~~~~~~~p~~~~~l~~~l~  246 (323)
T COG0523         184 YGDVDLAELLDEGLFDLDRD---VGRTSPLFSDHQHDHEHDEGGISSFSVRADRPFDPERLEAFLD  246 (323)
T ss_pred             ccCCCHHHhhcccccccccc---ccccCccccccCCCchhcccCceEEEEecCCCCCHHHHHHHHH
Confidence            99999999999999986551   111111111  12233333479999999999999999999985

>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
1nij_A318 Yjia Protein Length = 318 6e-09
4ixn_A318 Crystal Structure Of Zn(ii)-bound E37a,c66a,c67a Tr 7e-07
>pdb|1NIJ|A Chain A, Yjia Protein Length = 318 Back     alignment and structure 
Iteration: 1

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 85/178 (47%), Gaps = 26/178 (14%)
Query: 17  LANGCICCTVKHSLVQALEQLVQRKER----LDHILLETTGLANPAPLASVLWLDDQLES 72
           L NGCICC+  + L  AL  L+   ++     D +++E TG+A+P P+    +  + L  
Sbjct: 60  LTNGCICCSRSNELEDALLDLLDNLDKGNIQFDRLVIECTGMADPGPIIQTFFSHEVLCQ 119
Query: 73  AVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLD 132
              LD +I +VDA +   Q++++    S      Q+ +AD ++L K D+     +G++ +
Sbjct: 120 RYLLDGVIALVDAVHADEQMNQFTIAQS------QVGYADRILLTKTDV-----AGEA-E 167
Query: 133 ELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLH 190
           +L + +  IN+ A V       +DL  + N   +          +LEE+   +    H
Sbjct: 168 KLHERLARINARAPVYTVTHGDIDLGLLFNTNGF----------MLEENVVSTKPRFH 215
>pdb|4IXN|A Chain A, Crystal Structure Of Zn(ii)-bound E37a,c66a,c67a Triple Mutant Yjia Gtpase Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 2e-66
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Length = 318 Back     alignment and structure
 Score =  206 bits (527), Expect = 2e-66
 Identities = 49/221 (22%), Positives = 93/221 (42%), Gaps = 29/221 (13%)

Query: 2   INE-GEGG---ALV----EEWVELANGCICCTVKHSLVQALEQLVQRKER----LDHILL 49
            NE GE      L+     +   L NGCICC+  + L  AL  L+   ++     D +++
Sbjct: 37  ENEFGEVSVDDQLIGDRATQIKTLTNGCICCSRSNELEDALLDLLDNLDKGNIQFDRLVI 96

Query: 50  ETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIA 109
           E TG+A+P P+    +  + L     LD +I +VDA +          ++ +  A  Q+ 
Sbjct: 97  ECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHAD------EQMNQFTIAQSQVG 150

Query: 110 FADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYDAT 169
           +AD ++L K D+          ++L + +  IN+ A V       +DL  + N   +   
Sbjct: 151 YADRILLTKTDVAGE------AEKLHERLARINARAPVYTVTHGDIDLGLLFNTNGFMLE 204

Query: 170 HVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKV 210
                E ++             N++ ++ +     V++ +V
Sbjct: 205 -----ENVVSTKPRFHFIADKQNDISSIVVELDYPVDISEV 240

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.97
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.63
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.17
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.01
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.96
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.88
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 97.81
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.55
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.44
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 96.68
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 96.15
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 96.13
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 95.86
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 95.18
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 94.36
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.33
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 94.14
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 94.12
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 94.02
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 93.99
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 93.57
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 93.18
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 93.1
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 93.1
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 92.71
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 92.56
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 92.38
2ged_A193 SR-beta, signal recognition particle receptor beta 92.38
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 92.18
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 92.11
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 92.11
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 92.0
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 91.88
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 91.59
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 91.48
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 91.42
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 91.35
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 91.3
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 91.24
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 91.12
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 91.11
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 91.09
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 91.03
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 91.03
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 90.89
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 90.69
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 90.68
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 90.63
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 90.51
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 90.5
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 90.43
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 90.38
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 90.35
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 90.26
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 90.26
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 90.25
3iby_A256 Ferrous iron transport protein B; G protein, G dom 90.22
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 90.2
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 89.94
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 89.91
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 89.88
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 89.63
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 89.6
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 89.59
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 89.48
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 88.89
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 88.35
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 88.32
2fh5_B214 SR-beta, signal recognition particle receptor beta 88.24
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 88.2
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 88.11
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 87.75
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 87.69
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 87.65
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 87.45
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 87.39
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 87.13
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 87.13
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 86.83
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 86.82
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 86.76
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 86.72
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 86.65
1nrj_B218 SR-beta, signal recognition particle receptor beta 86.42
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 86.33
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 86.06
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 86.03
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 85.95
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 85.61
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 85.57
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 85.39
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 85.28
3lxx_A239 GTPase IMAP family member 4; structural genomics c 85.17
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 85.06
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 84.96
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 84.71
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 84.64
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 84.61
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 84.59
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 84.48
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 84.48
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 84.24
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 83.49
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 82.93
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 82.92
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 82.84
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 82.72
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 82.3
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 81.92
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 81.46
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 81.14
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 81.01
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 80.9
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 80.89
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 80.85
3t1o_A198 Gliding protein MGLA; G domain containing protein, 80.62
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 80.33
3o47_A329 ADP-ribosylation factor GTPase-activating protein 80.31
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
Probab=99.97  E-value=7.6e-30  Score=220.08  Aligned_cols=197  Identities=24%  Similarity=0.418  Sum_probs=158.3

Q ss_pred             ccc----CCCceee----eeeeecCCCcEEeecchhHHHHHHHHH---HhcC-CCCEEEEecCCCCCcHHHHHHhhcCcc
Q 027979            2 INE----GEGGALV----EEWVELANGCICCTVKHSLVQALEQLV---QRKE-RLDHILLETTGLANPAPLASVLWLDDQ   69 (216)
Q Consensus         2 ~ne----g~dg~~~----~~v~eL~~GCiCCsl~~dl~~~L~~l~---~~~~-~~d~IiIE~sG~a~P~~i~~~l~~~~~   69 (216)
                      +||    ++||..+    ++++||+||||||+.+.++..+|..++   +... .++++++|++|+++|.+++..++.++.
T Consensus        37 ~~d~G~i~idg~~l~~~~~~~~el~~gCicc~~~~~~~~~l~~l~~~~q~~~~~~~~~v~E~~~l~~p~~~~~~~~~~~~  116 (318)
T 1nij_A           37 ENEFGEVSVDDQLIGDRATQIKTLTNGCICCSRSNELEDALLDLLDNLDKGNIQFDRLVIECTGMADPGPIIQTFFSHEV  116 (318)
T ss_dssp             CSSCCSCCEEEEEECTTSCEEEEETTSCEEECTTSCHHHHHHHHHHHHHHTSCCCSEEEEEEETTCCHHHHHHHHHHSHH
T ss_pred             EecCcccCccHHHHhCCCCCEEEECCCceEEcccHHHHHHHHHHHhHHhcCCCCCCEEEEeCCCCCCHHHHHHHHhcCcc
Confidence            567    5667665    478999999999999999999998885   3221 359999999999999999887744566


Q ss_pred             cccceeeccEEEEEcccchHHHHhhcccCCChhHHHHHHhhccEEEEccCCCCCCCCccchHHHHHHHHHhhCCCCEEEE
Q 027979           70 LESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIR  149 (216)
Q Consensus        70 l~~~~~l~~vI~vVDa~~~~~~l~~~~~~~~~~~~~~QI~~AD~IvlnK~D~v~~~~~~~~l~~i~~~l~~lNP~A~iv~  149 (216)
                      .....+++.++++||+.++..++.+      .+...+|+.+||++++||+|++++.      +++.+.++++||++.|+.
T Consensus       117 ~~~~~~l~~~l~~vd~~~~~~~~~~------ls~g~~Q~~~ad~ill~k~dl~de~------~~l~~~l~~l~~~~~ii~  184 (318)
T 1nij_A          117 LCQRYLLDGVIALVDAVHADEQMNQ------FTIAQSQVGYADRILLTKTDVAGEA------EKLHERLARINARAPVYT  184 (318)
T ss_dssp             HHHHEEEEEEEEEEETTTHHHHHHH------CHHHHHHHHTCSEEEEECTTTCSCT------HHHHHHHHHHCSSSCEEE
T ss_pred             ccCeEEECCEEEEEEHHHHHHHHhh------chHHHHHHHhCCEEEEECcccCCHH------HHHHHHHHHhCCCCeEEE
Confidence            6778899999999999999887754      4566799999999999999999652      678899999999999999


Q ss_pred             eecCCCChhhhhccCCCCccchhhhhhhhhhhccCCCCCCCCCCEEEEEEEcCCCCCHHHHHHhHc
Q 027979          150 SVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVILQIA  215 (216)
Q Consensus       150 ~~~~~v~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~t~~~~~~~p~~~~~~~~~l~  215 (216)
                      ++++.++++.+++...|+......     ...++..++++|+++|++++++.++|+|+++|..||+
T Consensus       185 ~sh~~~~~~~l~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~v~s~~~~~~~~~~~~~l~~~l~  245 (318)
T 1nij_A          185 VTHGDIDLGLLFNTNGFMLEENVV-----STKPRFHFIADKQNDISSIVVELDYPVDISEVSRVME  245 (318)
T ss_dssp             CCSSCCCGGGGSCCCTTSCCSCCC-----SSCCCSCSTGGGGCSEEEEEEEESSCBCHHHHHHHHH
T ss_pred             ecccCCCHHHHhCCCCCChhhhhc-----ccCcccccccCCCCCeEEEEEEeCCCCCHHHHHHHHH
Confidence            999999999999987765433210     0001111233456889999999999999999999985
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1nija1222 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-t 2e-18
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 9e-04
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 222 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Hypothetical protein YjiA, N-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 78.4 bits (192), Expect = 2e-18
 Identities = 42/171 (24%), Positives = 79/171 (46%), Gaps = 16/171 (9%)

Query: 1   MINEGEGGALVEEWVELANGCICCTVKHSLVQAL----EQLVQRKERLDHILLETTGLAN 56
            +++   G    +   L NGCICC+  + L  AL    + L +   + D +++E TG+A+
Sbjct: 43  SVDDQLIGDRATQIKTLTNGCICCSRSNELEDALLDLLDNLDKGNIQFDRLVIECTGMAD 102

Query: 57  PAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVIL 116
           P P+    +  + L     LD +I +VDA +   Q++++        A  Q+ +AD ++L
Sbjct: 103 PGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTI------AQSQVGYADRILL 156

Query: 117 NKVDLVSPERSGDSLDELEKEIHEINSLAHVIRSVRCQVDLSEVLNCRAYD 167
            K D+          ++L + +  IN+ A V       +DL  + N   + 
Sbjct: 157 TKTDVAGE------AEKLHERLARINARAPVYTVTHGDIDLGLLFNTNGFM 201
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 100.0
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.53
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.56
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.27
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.28
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.17
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.04
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 89.91
d2fh5b1207 Signal recognition particle receptor beta-subunit 86.2
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 86.17
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 84.97
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 84.45
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 83.54
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 82.74
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 82.33
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 81.81
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 81.78
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 81.18
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 80.2
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Hypothetical protein YjiA, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=3.4e-36  Score=245.84  Aligned_cols=158  Identities=28%  Similarity=0.521  Sum_probs=138.6

Q ss_pred             Cccc-C---CCceee----eeeeecCCCcEEeecchhHHHHHHHHHHh----cCCCCEEEEecCCCCCcHHHHHHhhcCc
Q 027979            1 MINE-G---EGGALV----EEWVELANGCICCTVKHSLVQALEQLVQR----KERLDHILLETTGLANPAPLASVLWLDD   68 (216)
Q Consensus         1 ~~ne-g---~dg~~~----~~v~eL~~GCiCCsl~~dl~~~L~~l~~~----~~~~d~IiIE~sG~a~P~~i~~~l~~~~   68 (216)
                      ++|| |   +|+.++    ..++++.+||+||+.++++..++..++.+    ..+||+|+||+||+++|.+++..++.++
T Consensus        35 I~Ne~g~~~iD~~~~~~~~~~~~el~~gcicc~~~~~~~~~l~~~~~~~~~~~~~~d~iiIE~sG~~~p~~l~~~~~~~~  114 (222)
T d1nija1          35 IENEFGEVSVDDQLIGDRATQIKTLTNGCICCSRSNELEDALLDLLDNLDKGNIQFDRLVIECTGMADPGPIIQTFFSHE  114 (222)
T ss_dssp             ECSSCCSCCEEEEEECTTSCEEEEETTSCEEECTTSCHHHHHHHHHHHHHHTSCCCSEEEEEEETTCCHHHHHHHHHHSH
T ss_pred             EEecccchhhhhhhhcccccceEEecCCcceeccchhHHHHHHHHHHHHhhccCCcceeEEeecccchhhHHHHHHHhhh
Confidence            3688 4   455555    36899999999999999999998776642    3579999999999999999999987777


Q ss_pred             ccccceeeccEEEEEcccchHHHHhhcccCCChhHHHHHHhhccEEEEccCCCCCCCCccchHHHHHHHHHhhCCCCEEE
Q 027979           69 QLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVI  148 (216)
Q Consensus        69 ~l~~~~~l~~vI~vVDa~~~~~~l~~~~~~~~~~~~~~QI~~AD~IvlnK~D~v~~~~~~~~l~~i~~~l~~lNP~A~iv  148 (216)
                      .+...+.++++|+|||+.++..++.+      ++.+.+||++||+|||||+|++++      .+++++.++++||+|+|+
T Consensus       115 ~~~~~~~l~~vi~vVDa~~~~~~~~~------~~~~~~Qi~~AD~ivlNK~Dl~~~------~~~~~~~l~~lNP~a~Ii  182 (222)
T d1nija1         115 VLCQRYLLDGVIALVDAVHADEQMNQ------FTIAQSQVGYADRILLTKTDVAGE------AEKLHERLARINARAPVY  182 (222)
T ss_dssp             HHHHHEEEEEEEEEEETTTHHHHHHH------CHHHHHHHHTCSEEEEECTTTCSC------THHHHHHHHHHCSSSCEE
T ss_pred             cccccccccchhhhhhhhhhhhhhhh------hHHHHHHHHhCCcccccccccccH------HHHHHHHHHHHhCCCeEE
Confidence            77889999999999999999998876      467789999999999999999875      378999999999999999


Q ss_pred             EeecCCCChhhhhccCCCCccc
Q 027979          149 RSVRCQVDLSEVLNCRAYDATH  170 (216)
Q Consensus       149 ~~~~~~v~~~~l~~~~~~~~~~  170 (216)
                      .+++|++|++.|++.+.|+...
T Consensus       183 ~~~~g~v~~~~ll~~~~~d~e~  204 (222)
T d1nija1         183 TVTHGDIDLGLLFNTNGFMLEE  204 (222)
T ss_dssp             ECCSSCCCGGGGSCCCTTSCCS
T ss_pred             EeeCCccCHHHhhCCCCCCccc
Confidence            9999999999999999998754
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure