Citrus Sinensis ID: 028616
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 206 | ||||||
| 224063261 | 321 | predicted protein [Populus trichocarpa] | 0.985 | 0.632 | 0.725 | 4e-73 | |
| 356508073 | 321 | PREDICTED: F-box protein FBW2-like isofo | 0.990 | 0.635 | 0.700 | 4e-69 | |
| 449436998 | 318 | PREDICTED: F-box protein FBW2-like [Cucu | 0.980 | 0.635 | 0.645 | 3e-67 | |
| 255545780 | 329 | ubiquitin-protein ligase, putative [Rici | 0.995 | 0.623 | 0.658 | 3e-66 | |
| 225467167 | 317 | PREDICTED: F-box protein FBW2 isoform 1 | 0.975 | 0.634 | 0.626 | 7e-64 | |
| 147787397 | 225 | hypothetical protein VITISV_035646 [Viti | 0.888 | 0.813 | 0.593 | 2e-59 | |
| 18413178 | 317 | F-box protein FBW2 [Arabidopsis thaliana | 0.951 | 0.618 | 0.590 | 1e-58 | |
| 297813231 | 317 | F-box family protein [Arabidopsis lyrata | 0.951 | 0.618 | 0.576 | 1e-57 | |
| 359492882 | 296 | PREDICTED: F-box protein FBW2 [Vitis vin | 0.839 | 0.584 | 0.595 | 5e-56 | |
| 242065902 | 365 | hypothetical protein SORBIDRAFT_04g02735 | 0.975 | 0.550 | 0.565 | 2e-54 |
| >gi|224063261|ref|XP_002301066.1| predicted protein [Populus trichocarpa] gi|222842792|gb|EEE80339.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 279 bits (714), Expect = 4e-73, Method: Compositional matrix adjust.
Identities = 151/208 (72%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
Query: 1 MSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQ 60
+ DSIV QIAGRLS VTFLD+SYC+KI ALEAIGKHCKLLV LCRNMHPLDT +Q
Sbjct: 117 IGDSIVEQIAGRLSTVTFLDVSYCNKISGRALEAIGKHCKLLVGLCRNMHPLDTEGLEAQ 176
Query: 61 DDEANAIASTMPKLKRLEMAYHVISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFMKGN 120
DDEA AIA+TMPKLKRLEMAYH++STE +L+ILSSC LEF+DLRGCW+V LD+KF K
Sbjct: 177 DDEAYAIATTMPKLKRLEMAYHLVSTESLLQILSSCTNLEFMDLRGCWNVNLDNKFFKEK 236
Query: 121 FPNLKVLGPFVM-DYYEINDW-DDCSDYSDGSEYLAWEFLAGEMGDYDDDDEIYEGMWDD 178
F L VLGP VM DYYE NDW +DCS+YSD S+YLAW FLA G DDDE Y+ MWDD
Sbjct: 237 FQKLTVLGPLVMEDYYEANDWEEDCSEYSDDSDYLAWGFLA-GDGGDYDDDESYDEMWDD 295
Query: 179 EGRLEELELRFYDGIEEDAGIYGWPPSP 206
EGRLEELELRFY+G DAG+YGWPPSP
Sbjct: 296 EGRLEELELRFYEGA--DAGLYGWPPSP 321
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356508073|ref|XP_003522785.1| PREDICTED: F-box protein FBW2-like isoform 1 [Glycine max] gi|356508075|ref|XP_003522786.1| PREDICTED: F-box protein FBW2-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449436998|ref|XP_004136279.1| PREDICTED: F-box protein FBW2-like [Cucumis sativus] gi|449524052|ref|XP_004169037.1| PREDICTED: F-box protein FBW2-like isoform 1 [Cucumis sativus] gi|449524054|ref|XP_004169038.1| PREDICTED: F-box protein FBW2-like isoform 2 [Cucumis sativus] gi|449524056|ref|XP_004169039.1| PREDICTED: F-box protein FBW2-like isoform 3 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255545780|ref|XP_002513950.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547036|gb|EEF48533.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225467167|ref|XP_002269291.1| PREDICTED: F-box protein FBW2 isoform 1 [Vitis vinifera] gi|359496684|ref|XP_003635300.1| PREDICTED: F-box protein FBW2 isoform 2 [Vitis vinifera] gi|296085646|emb|CBI29445.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147787397|emb|CAN62342.1| hypothetical protein VITISV_035646 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|18413178|ref|NP_567343.1| F-box protein FBW2 [Arabidopsis thaliana] gi|30680931|ref|NP_849346.1| F-box protein FBW2 [Arabidopsis thaliana] gi|42572853|ref|NP_974523.1| F-box protein FBW2 [Arabidopsis thaliana] gi|145332987|ref|NP_001078359.1| F-box protein FBW2 [Arabidopsis thaliana] gi|238480265|ref|NP_001154215.1| F-box protein FBW2 [Arabidopsis thaliana] gi|75267749|sp|Q9ZPE4.1|FBW2_ARATH RecName: Full=F-box protein FBW2; AltName: Full=SKP1-interacting partner 18 gi|4325371|gb|AAD17367.1| contains similarity to Medicago truncatula N7 protein (GB:Y17613) [Arabidopsis thaliana] gi|7267540|emb|CAB78022.1| putative protein [Arabidopsis thaliana] gi|21536818|gb|AAM61150.1| F-box protein family, AtFBW2 [Arabidopsis thaliana] gi|27311651|gb|AAO00791.1| F-box protein family, AtFBW2 [Arabidopsis thaliana] gi|30984530|gb|AAP42728.1| At4g08980 [Arabidopsis thaliana] gi|222423880|dbj|BAH19904.1| AT4G08980 [Arabidopsis thaliana] gi|332657303|gb|AEE82703.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657304|gb|AEE82704.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657305|gb|AEE82705.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657306|gb|AEE82706.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657307|gb|AEE82707.1| F-box protein FBW2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297813231|ref|XP_002874499.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297320336|gb|EFH50758.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|359492882|ref|XP_002285756.2| PREDICTED: F-box protein FBW2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|242065902|ref|XP_002454240.1| hypothetical protein SORBIDRAFT_04g027350 [Sorghum bicolor] gi|241934071|gb|EES07216.1| hypothetical protein SORBIDRAFT_04g027350 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 206 | ||||||
| TAIR|locus:2122308 | 317 | FBW2 "AT4G08980" [Arabidopsis | 0.951 | 0.618 | 0.566 | 1.8e-55 | |
| TAIR|locus:2115949 | 302 | AT4G05460 "AT4G05460" [Arabido | 0.5 | 0.341 | 0.385 | 2.6e-12 | |
| TAIR|locus:2174398 | 300 | SKIP1 "SKP1 interacting partne | 0.606 | 0.416 | 0.338 | 5.7e-11 | |
| TAIR|locus:2118736 | 301 | AT4G30640 "AT4G30640" [Arabido | 0.606 | 0.415 | 0.297 | 2.3e-05 | |
| TAIR|locus:2140715 | 220 | AT4G03630 "AT4G03630" [Arabido | 0.490 | 0.459 | 0.349 | 4.6e-05 | |
| TAIR|locus:1005716270 | 246 | AT4G05497 "AT4G05497" [Arabido | 0.529 | 0.443 | 0.309 | 0.00022 |
| TAIR|locus:2122308 FBW2 "AT4G08980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 572 (206.4 bits), Expect = 1.8e-55, P = 1.8e-55
Identities = 119/210 (56%), Positives = 144/210 (68%)
Query: 1 MSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQ 60
+++S V +A +LS++TFLDLSYC KIG A++AIGKHCK L CRNMHPLD A +S
Sbjct: 118 LTNSGVVNVAEKLSSLTFLDLSYCCKIGPEAIQAIGKHCKSLREFCRNMHPLDVASVVSH 177
Query: 61 DDEANAIASTMPKLKRLEMAYHVISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFMKGN 120
DDEA AIA+TMPKLKRLE+AYH +STE VLKILS C LEFL+LRGCWDV+LD+KF K
Sbjct: 178 DDEAYAIANTMPKLKRLEIAYHRVSTEGVLKILSCCVFLEFLELRGCWDVQLDNKFFKEK 237
Query: 121 FPNLKVLGPFVMDYYE-INDWDDC-SDY-SDGSEYLAWEFLAXXXXXXXXXXXXXXXXWD 177
FP++KVLGP V+ +Y+ INDW+DC SDY SDGS+YLAWEF WD
Sbjct: 238 FPDMKVLGPRVIGFYDMINDWEDCCSDYFSDGSDYLAWEFFEDGVMGEFYEDEFEHG-WD 296
Query: 178 DEGRXXXXXXRFY-DGIEEDAGIYGWPPSP 206
D FY + D + WPPSP
Sbjct: 297 DN---------FYAENAVLDMEPHIWPPSP 317
|
|
| TAIR|locus:2115949 AT4G05460 "AT4G05460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174398 SKIP1 "SKP1 interacting partner 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118736 AT4G30640 "AT4G30640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140715 AT4G03630 "AT4G03630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716270 AT4G05497 "AT4G05497" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_II0452 | SubName- Full=Putative uncharacterized protein; (322 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 206 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 1e-04 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 41.2 bits (97), Expect = 1e-04
Identities = 33/134 (24%), Positives = 51/134 (38%), Gaps = 15/134 (11%)
Query: 2 SDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVL----CRNMHPLDTADK 57
D + +A + LDL C I + A+ +C L + RN H
Sbjct: 66 DDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQTINLGRHRNGH------- 118
Query: 58 LSQDDEANAIASTMPKLKRLEMAYHVISTEIVLKILSSCAL-LEFLDLRGCW---DVKLD 113
L D +A+ L+ + A ++ + V ++ S C+ LE L L C D +
Sbjct: 119 LITDVSLSALGKNCTFLQTVGFAGCDVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIP 178
Query: 114 DKFMKGNFPNLKVL 127
FPNL VL
Sbjct: 179 AILASNYFPNLSVL 192
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.35 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.34 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.29 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.21 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.12 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.05 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.86 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 98.85 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.83 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.82 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.76 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.75 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.65 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.43 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.35 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.3 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.12 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.87 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.86 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.86 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.56 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.56 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.55 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.43 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.41 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.37 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.36 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.24 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.23 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.21 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.19 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.18 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.17 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.13 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.11 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.87 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.81 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.76 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.71 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.7 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.69 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.62 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.57 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.43 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.37 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.24 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.07 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 95.88 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.85 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.78 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 95.75 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 95.51 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.45 | |
| KOG3735 | 353 | consensus Tropomodulin and leiomodulin [Cytoskelet | 95.39 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.25 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 95.2 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 95.06 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 94.96 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 94.73 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 94.58 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 94.17 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 94.08 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 94.03 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 93.95 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 93.78 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 93.39 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 93.32 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 93.23 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 92.68 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 92.64 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 92.17 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 90.83 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 88.68 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 88.21 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 87.44 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 87.05 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 85.8 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 83.81 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 83.23 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.35 E-value=1.8e-13 Score=120.37 Aligned_cols=120 Identities=24% Similarity=0.319 Sum_probs=93.3
Q ss_pred CHHHHHHHHhcCCCCcEEEeccCCCCCHHHHHHHHhcCCCCceEEeecccCCCCCCCCChHHHHHHHhcCCCCcEEEccC
Q 028616 2 SDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQDDEANAIASTMPKLKRLEMAY 81 (206)
Q Consensus 2 sd~~l~~l~~~~~~L~~L~Ls~c~~it~~~l~~l~~~c~~L~~L~L~~~~~~~~g~~v~d~~~~~ia~~~p~Lk~L~L~~ 81 (206)
.++.+..+++.||+++.|+|.+|.++|+..+..+++.|++|+.|.|..+ ..+++..+..+++.||+|++||++.
T Consensus 152 ~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c------~~iT~~~Lk~la~gC~kL~~lNlSw 225 (483)
T KOG4341|consen 152 GDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSC------SSITDVSLKYLAEGCRKLKYLNLSW 225 (483)
T ss_pred CcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhccc------chhHHHHHHHHHHhhhhHHHhhhcc
Confidence 4566777888888888888888888888888888888888888887532 1457778888888888888888888
Q ss_pred Cc-CCHHHHHHHHhCCCCccEEeeeCCCCCCCChHHH---HhcCCCCceeCC
Q 028616 82 HV-ISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFM---KGNFPNLKVLGP 129 (206)
Q Consensus 82 ~~-it~~~l~~il~~c~~Le~LdL~~C~~v~~~~~~l---~~~~~~L~~L~~ 129 (206)
|. |+..++..+.++|+.|+.+.++||... ....+ ...|+-+.++++
T Consensus 226 c~qi~~~gv~~~~rG~~~l~~~~~kGC~e~--~le~l~~~~~~~~~i~~lnl 275 (483)
T KOG4341|consen 226 CPQISGNGVQALQRGCKELEKLSLKGCLEL--ELEALLKAAAYCLEILKLNL 275 (483)
T ss_pred CchhhcCcchHHhccchhhhhhhhcccccc--cHHHHHHHhccChHhhccch
Confidence 86 888888888888888888888888877 44443 255555666653
|
|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 206 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 4e-13 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 4e-10 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-07 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 8e-10 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 65.7 bits (160), Expect = 4e-13
Identities = 29/131 (22%), Positives = 50/131 (38%), Gaps = 12/131 (9%)
Query: 1 MSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQ 60
+SD IV +A + S + L+LS CS AL+ + C L L L ++
Sbjct: 130 LSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELN-----LSWCFDFTE 183
Query: 61 DDEANAIASTMPKLKRLEMA--YHVISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFMK 118
A+A + +L ++ + + ++ C L LDL V L + +
Sbjct: 184 KHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS--VMLKNDCFQ 241
Query: 119 --GNFPNLKVL 127
L+ L
Sbjct: 242 EFFQLNYLQHL 252
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.62 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.52 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.5 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.46 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.44 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.43 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.41 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.4 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.39 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.38 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.28 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.17 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.17 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 99.08 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.02 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.94 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.91 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.83 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.81 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.74 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.74 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.73 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.73 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.66 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.66 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.65 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.59 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.43 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.36 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.35 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.31 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.31 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.31 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.25 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.25 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.24 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.22 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.21 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.21 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.16 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.15 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.15 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.15 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.14 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.13 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.13 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.13 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.12 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.11 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.11 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.1 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.1 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.09 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.09 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.09 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.09 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.09 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.09 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.07 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.07 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.03 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.03 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.03 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.02 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.01 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.01 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.01 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.98 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.98 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.98 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.97 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.96 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.95 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.94 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.94 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.94 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.93 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.93 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.93 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.92 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.92 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.92 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.92 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.91 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.91 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.9 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.89 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.89 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.88 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.87 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.87 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.86 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.85 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.84 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.84 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.83 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.83 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.83 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.82 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.81 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.81 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.8 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.8 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.79 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.78 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.78 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.77 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.75 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.74 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.73 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.72 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.71 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.7 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.68 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.68 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.68 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.67 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.65 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.63 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.63 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.59 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.59 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.57 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.56 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.55 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.52 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.51 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.47 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.47 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.46 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.34 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.3 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.28 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.14 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.11 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.09 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.97 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.95 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.94 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.91 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.61 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.56 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.34 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.27 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.01 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 93.82 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 92.76 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 92.42 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 91.17 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 90.46 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 88.62 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 88.41 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 80.4 |
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
Probab=99.62 E-value=5.7e-16 Score=122.68 Aligned_cols=104 Identities=13% Similarity=0.148 Sum_probs=88.8
Q ss_pred CCCcEEEeccCCCCCHHHHHHHHhcCCCCceEEeecccCCCCCCCCChHHHHHHHhc---CCCCcEEEccCCc-CCHHHH
Q 028616 14 SAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQDDEANAIAST---MPKLKRLEMAYHV-ISTEIV 89 (206)
Q Consensus 14 ~~L~~L~Ls~c~~it~~~l~~l~~~c~~L~~L~L~~~~~~~~g~~v~d~~~~~ia~~---~p~Lk~L~L~~~~-it~~~l 89 (206)
.+|+.|+|++|. ||+.|+..+ ..|++|+.|+|+.+. .|++.++.+|+.. +++|++|+|++|. ||+.|+
T Consensus 61 ~~L~~LDLs~~~-Itd~GL~~L-~~~~~L~~L~L~~C~------~ItD~gL~~L~~~~~~~~~L~~L~Ls~C~~ITD~Gl 132 (176)
T 3e4g_A 61 YKIQAIDATDSC-IMSIGFDHM-EGLQYVEKIRLCKCH------YIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGI 132 (176)
T ss_dssp CCEEEEEEESCC-CCGGGGGGG-TTCSCCCEEEEESCT------TCCHHHHHHHHTCHHHHHHCCEEEEESCTTCCHHHH
T ss_pred ceEeEEeCcCCC-ccHHHHHHh-cCCCCCCEEEeCCCC------ccCHHHHHHHHhcccccCCCCEEEcCCCCcCCHHHH
Confidence 469999999997 999999999 589999999998553 5799999999963 5799999999996 999999
Q ss_pred HHHHhCCCCccEEeeeCCCCCCCChH---HHHhcCCCCce
Q 028616 90 LKILSSCALLEFLDLRGCWDVKLDDK---FMKGNFPNLKV 126 (206)
Q Consensus 90 ~~il~~c~~Le~LdL~~C~~v~~~~~---~l~~~~~~L~~ 126 (206)
..+. .||+|++|+|++|..++.... .+++..|+++.
T Consensus 133 ~~L~-~~~~L~~L~L~~c~~Itd~gl~~~~L~~~lP~l~V 171 (176)
T 3e4g_A 133 IALH-HFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLEL 171 (176)
T ss_dssp HHGG-GCTTCCEEEEESCTTCCCHHHHHHHHHHHCTTCEE
T ss_pred HHHh-cCCCCCEEECCCCCCCCchHHHHHHHHHHCCCcEE
Confidence 9886 699999999999999944332 34578888775
|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.65 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.65 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.28 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.19 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.15 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.1 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.96 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.88 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.86 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.85 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.75 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.59 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.49 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.44 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.39 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.21 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.06 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.94 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.89 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.88 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.88 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.8 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.79 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.72 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.69 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.66 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.59 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.4 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.33 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.23 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.19 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.13 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.08 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.07 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.97 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.56 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.51 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.46 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.14 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.05 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 94.65 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 93.69 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65 E-value=2.7e-16 Score=130.37 Aligned_cols=121 Identities=21% Similarity=0.221 Sum_probs=92.6
Q ss_pred CCHHHHHHHHhcCCCCcEEEeccCCCCCHHHHHHHHhcCCCCceEEeecccCCCCCCCCChHHHHH-HHhcCCCCcEEEc
Q 028616 1 MSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQDDEANA-IASTMPKLKRLEM 79 (206)
Q Consensus 1 Isd~~l~~l~~~~~~L~~L~Ls~c~~it~~~l~~l~~~c~~L~~L~L~~~~~~~~g~~v~d~~~~~-ia~~~p~Lk~L~L 79 (206)
+++.++..++ ++|+|+.|+|++|..+|+.++.++++.||+|+.|+++.+. .+++.++.. ++..+++|++|+|
T Consensus 83 l~~~~~~~l~-~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~------~~~~~~~~~~~~~~~~~L~~L~l 155 (284)
T d2astb2 83 LSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCF------DFTEKHVQVAVAHVSETITQLNL 155 (284)
T ss_dssp CCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCT------TCCHHHHHHHHHHSCTTCCEEEC
T ss_pred CCcHHHHHHh-cCCCCcCccccccccccccccchhhHHHHhcccccccccc------ccccccchhhhcccccccchhhh
Confidence 4677777776 5889999999999889999999999999999999887431 356666644 4455678888888
Q ss_pred cCC--cCCHHHHHHHHhCCCCccEEeeeCCCCCCCChHHH--HhcCCCCceeCCC
Q 028616 80 AYH--VISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFM--KGNFPNLKVLGPF 130 (206)
Q Consensus 80 ~~~--~it~~~l~~il~~c~~Le~LdL~~C~~v~~~~~~l--~~~~~~L~~L~~~ 130 (206)
+++ .+++.++..++.+||+|++|+|++|..+ ++..+ ...+++|++|.+.
T Consensus 156 ~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~i--td~~~~~l~~~~~L~~L~L~ 208 (284)
T d2astb2 156 SGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVML--KNDCFQEFFQLNYLQHLSLS 208 (284)
T ss_dssp CSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTC--CGGGGGGGGGCTTCCEEECT
T ss_pred cccccccccccccccccccccccccccccccCC--CchhhhhhcccCcCCEEECC
Confidence 876 3888888888888888888888888877 44332 3567888888774
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|