Citrus Sinensis ID: 028627


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MRLSYSQAAHTFLFLVQWIDCRLAGALGLLRILIYKAYADGKTTMCTRERKASIKEFYGVIFPSLLQLQRGITDVEDKKQKEICDAKYKKKGRMDKGKLSEIDIEREEECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLKRLFMYIDKLPFITPNPTLVSYDPRYR
cccccccHHHHHHHHHHHHHHcccccccccEEEEEEEEEcccccccHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccc
ccEcccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccHcHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHccccccccHHHHHHccEEccccccEEccccccHHHHHHHHHHHHccccccHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEccccc
MRLSYSQAAHTFLFLVQWIDCRLAGALGLLRILIYKAYADGKTTMCTRERKASIKEFYGVIFPSLLQLQRGITDVEDKKQKEICDAkykkkgrmdkgklseidiEREEECGICLEIcckivlpdcnhsmcmrcyrnwrarsqscpfcrdslrrvnsgdlwiytseddiVDLASISRENLKRLFMYIdklpfitpnptlvsydpryr
MRLSYSQAAHTFLFLVQWIDCRLAGALGLLRILIYKAYADGKTTMCTRERKASIKEFYGVIFPSLLQLQRgitdvedkkqkeicdakykkkgrmdkgklseidiereeECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLrrvnsgdlwiytseddivdLASISRENLKRLFmyidklpfitpnptlvsydpryr
MRLSYSQAAHTFLFLVQWIDCrlagalgllriliYKAYADGKTTMCTRERKASIKEFYGVIFPSLLQLQRGITDVEDKKQKEICDAkykkkgrmdkgkLSEIDiereeecgicleicckiVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLKRLFMYIDKLPFITPNPTLVSYDPRYR
*******AAHTFLFLVQWIDCRLAGALGLLRILIYKAYADGKTTMCTRERKASIKEFYGVIFPSLLQLQRGITDVE******IC*****************IDIEREEECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLKRLFMYIDKLPFITPNPTLV*******
*****SQAAHTFLFLVQWIDCRLAGALGLLRILIYKAYAD******************GVIFPSLLQLQ*************************************EEECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLKRLFMYIDKLPFITPNPTLVSYDPRY*
********AHTFLFLVQWIDCRLAGALGLLRILIYKAYADGKTTMCTRERKASIKEFYGVIFPSLLQLQRGITDVEDKKQKEICDAKY**********LSEIDIEREEECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLKRLFMYIDKLPFITPNPTLVSYDPRYR
*RLSYSQAAHTFLFLVQWIDCRLAGALGLLRILIYKAYADGKTTMCTRERKASIKEFYGVIFPSLLQLQRGITDVEDKKQKEICDAKYKKKG*****KLSEIDIEREEECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLKRLFMYIDKLPFITPNPTLVSYDPR**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLSYSQAAHTFLFLVQWIDCRLAGALGLLRILIYKAYADGKTTMCTRERKASIKEFYGVIFPSLLQLQRGITDVEDKKQKEICDAKYKKKGRMDKGKLSEIDIEREEECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLKRLFMYIDKLPFITPNPTLVSYDPRYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q5ZM74230 RING finger protein 141 O yes no 0.291 0.260 0.393 1e-06
Q2XNS1231 RING finger protein 141 O yes no 0.296 0.264 0.358 6e-06
Q6IV57230 RING finger protein 141 O yes no 0.296 0.265 0.358 6e-06
Q32L15230 RING finger protein 141 O yes no 0.296 0.265 0.358 6e-06
Q99MB7230 RING finger protein 141 O yes no 0.296 0.265 0.358 6e-06
Q5R7K8230 RING finger protein 141 O yes no 0.296 0.265 0.358 6e-06
Q8WVD5230 RING finger protein 141 O yes no 0.296 0.265 0.358 6e-06
Q6IV56222 RING finger protein 141 O no no 0.310 0.288 0.343 2e-05
Q803C1485 E3 ubiquitin-protein liga yes no 0.451 0.191 0.32 5e-05
Q7ZX20540 E3 ubiquitin-protein liga N/A no 0.660 0.251 0.263 9e-05
>sp|Q5ZM74|RN141_CHICK RING finger protein 141 OS=Gallus gallus GN=RNF141 PE=2 SV=1 Back     alignment and function desciption
 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 6/66 (9%)

Query: 107 EEECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYT--- 163
           E+EC IC++    ++LP C HS C +C   W  R +SCP CR  +    +GD W+ +   
Sbjct: 152 EDECCICMDGRVDLILP-CAHSFCQKCIDKWSDRHRSCPVCRRQV--TGAGDSWVVSDAP 208

Query: 164 SEDDIV 169
           +EDDI 
Sbjct: 209 TEDDIA 214





Gallus gallus (taxid: 9031)
>sp|Q2XNS1|RN141_CANFA RING finger protein 141 OS=Canis familiaris GN=RNF141 PE=2 SV=1 Back     alignment and function description
>sp|Q6IV57|RN141_RAT RING finger protein 141 OS=Rattus norvegicus GN=Rnf141 PE=2 SV=1 Back     alignment and function description
>sp|Q32L15|RN141_BOVIN RING finger protein 141 OS=Bos taurus GN=RNF141 PE=2 SV=1 Back     alignment and function description
>sp|Q99MB7|RN141_MOUSE RING finger protein 141 OS=Mus musculus GN=Rnf141 PE=2 SV=2 Back     alignment and function description
>sp|Q5R7K8|RN141_PONAB RING finger protein 141 OS=Pongo abelii GN=RNF141 PE=2 SV=1 Back     alignment and function description
>sp|Q8WVD5|RN141_HUMAN RING finger protein 141 OS=Homo sapiens GN=RNF141 PE=1 SV=1 Back     alignment and function description
>sp|Q6IV56|RN141_DANRE RING finger protein 141 OS=Danio rerio GN=rnf141 PE=2 SV=2 Back     alignment and function description
>sp|Q803C1|RNF8_DANRE E3 ubiquitin-protein ligase RNF8 OS=Danio rerio GN=rnf8 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZX20|RNF8A_XENLA E3 ubiquitin-protein ligase RNF8-A OS=Xenopus laevis GN=rnf8-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
224140411241 predicted protein [Populus trichocarpa] 0.995 0.850 0.805 7e-95
225440680242 PREDICTED: uncharacterized protein LOC10 1.0 0.851 0.786 2e-94
224090988242 predicted protein [Populus trichocarpa] 0.995 0.847 0.786 1e-92
255574379278 protein binding protein, putative [Ricin 0.995 0.737 0.776 3e-91
449483479242 PREDICTED: uncharacterized LOC101207541 0.975 0.830 0.746 2e-87
449467505242 PREDICTED: uncharacterized protein LOC10 0.975 0.830 0.741 5e-87
312282839242 unnamed protein product [Thellungiella h 0.985 0.838 0.748 1e-86
15241003242 RING/U-box domain-containing protein [Ar 0.985 0.838 0.748 2e-86
255569333243 ubiquitin-protein ligase, putative [Rici 1.0 0.847 0.708 3e-85
297810245242 zinc finger family protein [Arabidopsis 0.985 0.838 0.729 7e-85
>gi|224140411|ref|XP_002323576.1| predicted protein [Populus trichocarpa] gi|222868206|gb|EEF05337.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 166/206 (80%), Positives = 185/206 (89%), Gaps = 1/206 (0%)

Query: 1   MRLSYSQAAHTFLFLVQWIDCRLAGALGLLRILIYKAYADGKTTMCTRERKASIKEFYGV 60
           MRLSYS AA+ FLFLVQW DC LAGALGLLRILIYKAY DGKTTM   ERKASI+EFYGV
Sbjct: 37  MRLSYSPAANFFLFLVQWTDCHLAGALGLLRILIYKAYEDGKTTMSIYERKASIREFYGV 96

Query: 61  IFPSLLQLQRGITDVEDKKQKEICDAKYKKKGRMDKGKLSEIDIEREEECGICLEICCKI 120
           IFPSLLQL+RGITDVED+KQKEIC AKYKKK  MDKGKLSEID+EREEECGIC+EI  ++
Sbjct: 97  IFPSLLQLERGITDVEDRKQKEIC-AKYKKKDEMDKGKLSEIDLEREEECGICMEINSRV 155

Query: 121 VLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLK 180
           VLP CNH+MCM+CYR+WR RSQSCPFCRDSL+RVNSGDLWIYT+ ++I+DL+SI+R+NLK
Sbjct: 156 VLPKCNHAMCMKCYRDWRTRSQSCPFCRDSLKRVNSGDLWIYTNNNEIIDLSSITRQNLK 215

Query: 181 RLFMYIDKLPFITPNPTLVSYDPRYR 206
           RLFMYIDKLP I P P  VSYDPRYR
Sbjct: 216 RLFMYIDKLPLIVPEPIFVSYDPRYR 241




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225440680|ref|XP_002280008.1| PREDICTED: uncharacterized protein LOC100261401 isoform 1 [Vitis vinifera] gi|297740213|emb|CBI30395.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224090988|ref|XP_002309135.1| predicted protein [Populus trichocarpa] gi|222855111|gb|EEE92658.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255574379|ref|XP_002528103.1| protein binding protein, putative [Ricinus communis] gi|223532492|gb|EEF34282.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449483479|ref|XP_004156604.1| PREDICTED: uncharacterized LOC101207541 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449467505|ref|XP_004151463.1| PREDICTED: uncharacterized protein LOC101207541 [Cucumis sativus] Back     alignment and taxonomy information
>gi|312282839|dbj|BAJ34285.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|15241003|ref|NP_195772.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|7327811|emb|CAB82268.1| putative protein [Arabidopsis thaliana] gi|15292803|gb|AAK92770.1| unknown protein [Arabidopsis thaliana] gi|20258865|gb|AAM14104.1| unknown protein [Arabidopsis thaliana] gi|66865962|gb|AAY57615.1| RING finger family protein [Arabidopsis thaliana] gi|332002973|gb|AED90356.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255569333|ref|XP_002525634.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223535070|gb|EEF36752.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297810245|ref|XP_002873006.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297318843|gb|EFH49265.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
TAIR|locus:2149750242 AIRP2 "ABA Insensitive RING Pr 0.985 0.838 0.591 1.2e-60
TAIR|locus:505006703242 AT5G58787 "AT5G58787" [Arabido 0.966 0.822 0.519 1.3e-52
TAIR|locus:505006120260 AT1G13195 [Arabidopsis thalian 0.393 0.311 0.543 6.3e-35
TAIR|locus:2024026251 AT1G24440 [Arabidopsis thalian 0.980 0.804 0.354 9.8e-32
UNIPROTKB|Q5ZM74230 RNF141 "RING finger protein 14 0.218 0.195 0.411 8.2e-05
UNIPROTKB|I3LDC9231 RNF141 "Uncharacterized protei 0.228 0.203 0.339 0.00079
UNIPROTKB|Q13064507 MKRN3 "Probable E3 ubiquitin-p 0.223 0.090 0.377 0.00094
TAIR|locus:2149750 AIRP2 "ABA Insensitive RING Protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 621 (223.7 bits), Expect = 1.2e-60, P = 1.2e-60
 Identities = 120/203 (59%), Positives = 134/203 (66%)

Query:     1 MRLSYSQAAHTFLFLVQWIDCXXXXXXXXXXXXXYKAYADGKTTMCTRERKASIKEFYGV 60
             MRLSYS AAH FLFL+QW DC             YKAY DGKTTM   ERK SI+EFY V
Sbjct:    37 MRLSYSPAAHLFLFLLQWTDCHFAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDV 96

Query:    61 IFPSLLQLQRGITDVEDKKQKEICDAXXXXXXXXXXXXLSEIDXXXXXXXXXXXXXXXXX 120
             +FPSLLQL  GITDVE++KQKEICD             +SEID                 
Sbjct:    97 LFPSLLQLHGGITDVEERKQKEICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKV 156

Query:   121 VLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLK 180
             VLP CNHSMC+ CYRNWRARSQSCPFCR SL+RVNSGDLWIYT   +I DL +I +ENLK
Sbjct:   157 VLPTCNHSMCINCYRNWRARSQSCPFCRGSLKRVNSGDLWIYTCSAEIADLPAIYKENLK 216

Query:   181 RLFMYIDKLPFITPNPTLVSYDP 203
             RL +YIDKLP +T +P LV Y P
Sbjct:   217 RLLIYIDKLPLVTSDPNLVPYAP 239




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
TAIR|locus:505006703 AT5G58787 "AT5G58787" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006120 AT1G13195 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024026 AT1G24440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM74 RNF141 "RING finger protein 141" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDC9 RNF141 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q13064 MKRN3 "Probable E3 ubiquitin-protein ligase makorin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_XVI1059
hypothetical protein (242 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 1e-07
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-07
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 7e-07
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-06
smart0018440 smart00184, RING, Ring finger 3e-05
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 9e-05
PHA02926242 PHA02926, PHA02926, zinc finger-like protein; Prov 1e-04
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-04
COG5236 493 COG5236, COG5236, Uncharacterized conserved protei 5e-04
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 7e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 7e-04
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 0.003
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
 Score = 50.2 bits (120), Expect = 1e-07
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 19/96 (19%)

Query: 72  ITDVEDKKQKEICDAKYKKKGRMDKGKLSEI-----------DIEREEECGICLEICCKI 120
           I  +  +K++++  A   KKG+  K  L  I           +  +++EC IC+E     
Sbjct: 128 INYIYMRKEEDMFYAIINKKGKNYKKFLKTIPSVLSEYEKLYNRSKDKECAICMEKVYDK 187

Query: 121 --------VLPDCNHSMCMRCYRNWRARSQSCPFCR 148
                   +L +CNH  C+ C   W+    +CP CR
Sbjct: 188 EIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCR 223


Length = 238

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227561 COG5236, COG5236, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 99.49
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.49
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.38
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.31
PHA02929238 N1R/p28-like protein; Provisional 99.29
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.28
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.27
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.26
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.19
PHA02926242 zinc finger-like protein; Provisional 99.17
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.15
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.14
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.14
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.08
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.06
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.01
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 99.01
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.99
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.99
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.98
KOG1002 791 consensus Nucleotide excision repair protein RAD16 98.98
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.86
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.84
PF1463444 zf-RING_5: zinc-RING finger domain 98.83
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.77
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.77
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.76
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.73
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.72
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.62
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.58
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.51
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.51
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.46
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.44
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.38
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 98.22
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 98.08
KOG2660 331 consensus Locus-specific chromosome binding protei 98.04
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.01
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.0
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
COG52191525 Uncharacterized conserved protein, contains RING Z 97.97
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.92
COG5152259 Uncharacterized conserved protein, contains RING a 97.91
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.87
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 97.83
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.8
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.77
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.75
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.68
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.61
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.59
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.58
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.5
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 97.49
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.43
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.42
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.33
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.16
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 97.04
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.94
PHA03096284 p28-like protein; Provisional 96.78
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.7
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.51
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.39
COG5222427 Uncharacterized conserved protein, contains RING Z 96.36
KOG4445 368 consensus Uncharacterized conserved protein, conta 96.31
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.15
KOG4739 233 consensus Uncharacterized protein involved in syna 96.07
KOG3002 299 consensus Zn finger protein [General function pred 96.01
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.95
KOG1941518 consensus Acetylcholine receptor-associated protei 95.87
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.75
KOG4367 699 consensus Predicted Zn-finger protein [Function un 95.67
KOG0298 1394 consensus DEAD box-containing helicase-like transc 95.66
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.64
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.61
PF04641260 Rtf2: Rtf2 RING-finger 95.51
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.51
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 95.47
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.36
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.97
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.87
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 94.69
PHA02825162 LAP/PHD finger-like protein; Provisional 94.64
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.32
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.29
PHA02862156 5L protein; Provisional 94.23
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 93.98
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 93.61
KOG1940276 consensus Zn-finger protein [General function pred 93.46
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.4
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 93.25
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.85
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 92.53
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.38
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 90.19
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 89.92
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 88.79
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 88.66
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 88.37
KOG3039 303 consensus Uncharacterized conserved protein [Funct 87.93
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 87.36
KOG03091081 consensus Conserved WD40 repeat-containing protein 86.63
KOG3899381 consensus Uncharacterized conserved protein [Funct 86.07
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 84.14
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 83.92
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 83.24
KOG2113394 consensus Predicted RNA binding protein, contains 82.66
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 81.51
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 80.46
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.49  E-value=1.4e-14  Score=125.40  Aligned_cols=200  Identities=31%  Similarity=0.467  Sum_probs=141.6

Q ss_pred             Ccccccch-hHHHHHHHHhhhcccccccchhhhhhhhhc-cCCCcccchhhh--HhhHHHHHHhhhhh---------HHH
Q 028627            1 MRLSYSQA-AHTFLFLVQWIDCRLAGALGLLRILIYKAY-ADGKTTMCTRER--KASIKEFYGVIFPS---------LLQ   67 (206)
Q Consensus         1 m~~~~~~~-~~~~~~~~~~~~~~~~~~lgl~~~l~~~~~-~~g~~~~~~~~r--~~si~~f~~~i~ps---------l~q   67 (206)
                      ||++|+.. .++...++.|++...+. .|+.+.+++..+ .++...+....+  ...+.++++..+++         +.+
T Consensus        25 cr~~h~~~~~~~~~~~~~~~s~~~~~-~~~~~~~~~~~~~~~~s~~~s~~~~~~~~~~~~s~~~~~~s~~~~~~~~~~~~  103 (344)
T KOG1039|consen   25 CRLSHSLPDEEFATLLTPTTSSAAAS-TGLSQSLIWANAVADASATMSVSSRPVLTAIRASSSISEPSSTQENPYSNHGQ  103 (344)
T ss_pred             eeeeccCchhhccccccccccccccc-cccchhhcccchhhccccccchhcccchhhhhhhhccccccccccCccccccc
Confidence            68888887 77888999999888776 677777777776 566666655555  56778888877777         222


Q ss_pred             HhhcCCchHHHH----------HHHhhHHHHhhhccc--------ccCCCcccccCccCccccccccccccc--------
Q 028627           68 LQRGITDVEDKK----------QKEICDAKYKKKGRM--------DKGKLSEIDIEREEECGICLEICCKIV--------  121 (206)
Q Consensus        68 l~~~~~~~~~~~----------~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~C~IC~~~~~~~~--------  121 (206)
                      ...+........          +...+...++.....        ..+.........+.+|.||++...+..        
T Consensus       104 ~~~g~~~~~~~~~~~~~c~l~~~~pi~~~~~~~~~~~~~~~~~~~~~e~~~a~~~s~~k~CGICme~i~ek~~~~~rfgi  183 (344)
T KOG1039|consen  104 CRFGNGDVTLNGNNPESCGLGTQHPICKRQYKNSMKRGSSCALSSAMERSFALQKSSEKECGICMETINEKAASERRFGI  183 (344)
T ss_pred             cccCCcccccccccccccccccccchhHHHHhhhhcccccccchHhhhhccCcCccccccceehhhhccccchhhhhccc
Confidence            222222111110          000111111111111        111122223356889999999987654        


Q ss_pred             ccCCCCcccHHHHHHHHh--c-----CCCCCCccccccccCCCCccccCCchhhhhhhhhcHHHHHHHHHHHhcCCCCCC
Q 028627          122 LPDCNHSMCMRCYRNWRA--R-----SQSCPFCRDSLRRVNSGDLWIYTSEDDIVDLASISRENLKRLFMYIDKLPFITP  194 (206)
Q Consensus       122 ~~~CgH~Fc~~Ci~~w~~--~-----~~~CP~Cr~~~~~~~~~~~~~~~~~~~~~d~~~~~~e~l~~l~~~i~~l~~~~p  194 (206)
                      .++|.|.||..||..|..  +     ++.||.||.+...+++...|+.++.++..++.+...+.-.+...|++..+..+|
T Consensus       184 lpnC~H~~Cl~Cir~wr~~~q~~~~~sksCP~CRv~s~~v~pS~~Wv~t~~~k~~li~e~~~~~s~~~c~yf~~~~g~cP  263 (344)
T KOG1039|consen  184 LPNCNHSFCLNCIRKWRQATQFESKTSKSCPFCRVPSSFVNPSSFWVETKEEKQKLIEEYEAEMSAKDCKYFSQGLGSCP  263 (344)
T ss_pred             CCCcchhhhhcHhHhhhhhhccccccccCCCcccCccccccccceeeeecccccccHHHHHHHhhccchhhhcCCCCCCC
Confidence            378999999999999994  4     689999999999999999999999888888888888888889999999999999


Q ss_pred             Ccceecc
Q 028627          195 NPTLVSY  201 (206)
Q Consensus       195 ~~~~~~~  201 (206)
                      ..-.++|
T Consensus       264 f~s~~~y  270 (344)
T KOG1039|consen  264 FGSKCFY  270 (344)
T ss_pred             CCCcccc
Confidence            9888888



>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-21
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-17
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-10
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-09
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-08
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 5e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 7e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 9e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-07
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 3e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 5e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 6e-07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 4e-06
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 5e-06
2ecw_A85 Tripartite motif-containing protein 30; metal bind 5e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 7e-06
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 8e-06
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 1e-05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 1e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 1e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-05
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 6e-05
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 9e-05
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 9e-05
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 1e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-04
2ysj_A63 Tripartite motif-containing protein 31; ring-type 1e-04
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 5e-04
2ect_A78 Ring finger protein 126; metal binding protein, st 7e-04
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 8e-04
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 85.5 bits (211), Expect = 2e-21
 Identities = 33/146 (22%), Positives = 54/146 (36%), Gaps = 20/146 (13%)

Query: 47  TRERKASIKEFYGVIFPSLLQLQRGITDVEDKKQKEICDAKYKKKGRMDKGKLSEIDIER 106
             E   S K+F  +I     +L          +Q +    K + +       +++  +E 
Sbjct: 15  MEELNRSKKDFEAIIQAKNKEL----------EQTKEEKEKMQAQKEEVLSHMND-VLEN 63

Query: 107 EEECGICLEICCKIVLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLWIYTSED 166
           E +C IC E   + V  +C HS C  C   W  R   CP CR  ++      +       
Sbjct: 64  ELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINK 123

Query: 167 DIVDLASISRE---------NLKRLF 183
            + +L+S  +E           KRLF
Sbjct: 124 MVNNLSSEVKERRIVLIRERKAKRLF 149


>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.53
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.52
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.49
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.48
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.47
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.47
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.47
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.47
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.46
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.46
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.46
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.46
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.46
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.45
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.45
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.45
2ect_A78 Ring finger protein 126; metal binding protein, st 99.43
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.42
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.42
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.42
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.42
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.4
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.4
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.39
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.39
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.39
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.39
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.38
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.38
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.38
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.38
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.37
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.36
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.35
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.35
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.34
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.33
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.33
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.33
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.31
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.31
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.31
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.27
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.25
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.25
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.25
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.24
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.23
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.22
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.21
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.2
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.2
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.17
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.15
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.15
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.14
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.11
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.09
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.08
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.05
2ea5_A68 Cell growth regulator with ring finger domain prot 99.0
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.97
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.94
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.94
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.91
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.81
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.76
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.7
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.57
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.45
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.36
3nw0_A238 Non-structural maintenance of chromosomes element 97.63
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.38
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.14
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 94.08
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.83
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 84.42
1z60_A59 TFIIH basal transcription factor complex P44 subun 83.46
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 80.57
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 80.38
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.53  E-value=4.8e-15  Score=99.29  Aligned_cols=56  Identities=25%  Similarity=0.701  Sum_probs=49.5

Q ss_pred             CccCcccccccccccc-------cccCCCCcccHHHHHHHHhcCCCCCCccccccccCCCCcc
Q 028627          105 EREEECGICLEICCKI-------VLPDCNHSMCMRCYRNWRARSQSCPFCRDSLRRVNSGDLW  160 (206)
Q Consensus       105 ~~~~~C~IC~~~~~~~-------~~~~CgH~Fc~~Ci~~w~~~~~~CP~Cr~~~~~~~~~~~~  160 (206)
                      .++..|+||++.+.++       +.++|||.||..|+.+|+....+||+||.++...+...++
T Consensus         8 ~~~~~C~IC~~~~~~~~~~~~~~~~~~CgH~fc~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~   70 (71)
T 3ng2_A            8 SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY   70 (71)
T ss_dssp             TTCCBCTTTCCBHHHHHTTTCCEEECTTSCEEEHHHHHHHHHHCSBCTTTCCBCCCCSCCCCC
T ss_pred             CCCCCCcccChhhhccccccCCeEeCCCCChHhHHHHHHHHHcCCCCCCCCCccChhheeecc
Confidence            5678999999999887       7899999999999999999999999999999876665543



>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-09
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-09
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 7e-06
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 7e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 3e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 4e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 0.003
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 0.003
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 49.2 bits (117), Expect = 5e-09
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%)

Query: 108 EECGICLEICCKIVLPDCNHSMCMRCYRNW-RARSQSCPFCRDSLRRVNS 156
           + C IC E    + +  C H MC  C  +W  +  Q CPFCR  ++    
Sbjct: 24  QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEP 73


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.48
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.48
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.47
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.46
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.45
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.42
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.38
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.37
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.37
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.34
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.32
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.26
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.21
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.18
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.0
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.46
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 93.37
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 88.99
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 88.19
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.49  E-value=8.2e-15  Score=99.29  Aligned_cols=49  Identities=33%  Similarity=0.852  Sum_probs=44.0

Q ss_pred             cCcccccccccccccccCCCCcccHHHHHHHHh-cCCCCCCccccccccC
Q 028627          107 EEECGICLEICCKIVLPDCNHSMCMRCYRNWRA-RSQSCPFCRDSLRRVN  155 (206)
Q Consensus       107 ~~~C~IC~~~~~~~~~~~CgH~Fc~~Ci~~w~~-~~~~CP~Cr~~~~~~~  155 (206)
                      ...|+||++.+.+++.++|||.||..||..|+. ++.+||+||..+....
T Consensus        23 ~~~C~IC~~~~~~~~~~~CgH~fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~   72 (79)
T d1fbva4          23 FQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTE   72 (79)
T ss_dssp             TTBCTTTSSSBCCEECSSSCCEECHHHHHHHHHTTCCSCTTTCCCCCCCC
T ss_pred             CCCCccCCCcCCCeEEeCCCCeeeHHHHHHHHHHCcCcCCCCCcCccCCc
Confidence            457999999999999999999999999999997 5678999999997544



>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure