Citrus Sinensis ID: 028754

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MPIGLLRADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLHSSVFASADPQVTAAGDLKLSKDPKPKYRGKYV
ccccEEEEcccccccccccccccEEEEEccccccccccEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccccccccEEEEEEccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccccccccccccc
ccccEEEEcccccccccccccHEEEEEccccccHHHHHHEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccHHcccccccEEEEEEcccccccHccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccccccccccccc
mpigllradnnlppwrpglkEVFDaiicdppygvraggrksggrkllkgvvdpytvpddkrvghipstapyclSECVHDLLDLAGRMLVMGGRLvyfypvlredstrnpfpehpcfklvasSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWledgnlhssvfasadpqvtaagdlklskdpkpkyrgkyv
mpigllradnnlppwrPGLKEVFDAIICDppygvraggrksggrkllkgvvdpytvpddkrvghipsTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLHSSVFASADPQvtaagdlklskdpkpkyrgkyv
MPIGLLRADNNLPPWRPGLKEVFDAIICDPPYgvraggrksggrkllkgvvDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLHSSVFASADPQVTAAGDLKLSKDPKPKYRGKYV
**********NLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLHSSVF****************************
MPIGLLRADNNLPPWRPGLKEVFDAIICDPPYGVR******************YTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKI****************EFRENHLKWLE*************************************
MPIGLLRADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLHSSVFASADPQVTAAGDLKLSKDP*********
*PIGLLRADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGG********DPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLH***F****************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIGLLRADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLHSSVFASADPQVTAAGDLKLSKDPKPKYRGKYV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
Q54QA6507 tRNA (guanine(10)-N2)-met yes no 0.676 0.272 0.438 1e-25
Q6YJI5461 tRNA (guanine(10)-N2)-met yes no 0.651 0.288 0.411 2e-24
Q6NS23478 tRNA (guanine(10)-N2)-met N/A no 0.764 0.326 0.375 5e-24
Q7Z4G4463 tRNA (guanine(10)-N2)-met yes no 0.661 0.291 0.422 8e-24
Q5R962463 tRNA (guanine(10)-N2)-met yes no 0.661 0.291 0.415 1e-23
Q7TNK6463 tRNA (guanine(10)-N2)-met yes no 0.647 0.285 0.415 4e-23
Q05B63460 tRNA (guanine(10)-N2)-met yes no 0.647 0.286 0.415 5e-23
Q9CWH5460 tRNA (guanine(10)-N2)-met yes no 0.647 0.286 0.415 7e-23
O94636469 tRNA (guanine(10)-N2)-met yes no 0.568 0.247 0.364 9e-12
Q12463433 tRNA (guanine(10)-N2)-met yes no 0.691 0.325 0.292 2e-05
>sp|Q54QA6|TRM11_DICDI tRNA (guanine(10)-N2)-methyltransferase homolog OS=Dictyostelium discoideum GN=trmt11 PE=3 SV=1 Back     alignment and function desciption
 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 89/146 (60%), Gaps = 8/146 (5%)

Query: 3   IGLLRADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDKRV 62
           +G +  DN+ PPWR  +  +FD+II DPPYG+RAG RK G ++  K V     VP+  R 
Sbjct: 287 LGTILCDNSCPPWR--VNSMFDSIITDPPYGIRAGARKIGFKENRKFV----PVPEGLRR 340

Query: 63  GHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLV-AS 121
            HIP    Y + + + DLL+LA + L++GGRLVY+ P    D      P HPC +L+ AS
Sbjct: 341 DHIPQCIDYSVPDVMADLLELAAKTLIVGGRLVYWLPT-TPDYKETDLPRHPCLRLITAS 399

Query: 122 SEQILSSRYSRVLLTMVKIGPYTEEI 147
             QIL++R+ R L+TM KI  Y + I
Sbjct: 400 CLQILTNRWGRRLVTMEKIIEYNDSI 425
Catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q6YJI5|TRM11_CHICK tRNA (guanine(10)-N2)-methyltransferase homolog OS=Gallus gallus GN=TRMT11 PE=2 SV=1 Back     alignment and function description
>sp|Q6NS23|TRM11_XENLA tRNA (guanine(10)-N2)-methyltransferase homolog OS=Xenopus laevis GN=trmt11 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z4G4|TRM11_HUMAN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens GN=TRMT11 PE=1 SV=1 Back     alignment and function description
>sp|Q5R962|TRM11_PONAB tRNA (guanine(10)-N2)-methyltransferase homolog OS=Pongo abelii GN=TRMT11 PE=2 SV=1 Back     alignment and function description
>sp|Q7TNK6|TRM11_RAT tRNA (guanine(10)-N2)-methyltransferase homolog OS=Rattus norvegicus GN=Trmt11 PE=2 SV=1 Back     alignment and function description
>sp|Q05B63|TRM11_BOVIN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Bos taurus GN=TRMT11 PE=2 SV=1 Back     alignment and function description
>sp|Q9CWH5|TRM11_MOUSE tRNA (guanine(10)-N2)-methyltransferase homolog OS=Mus musculus GN=Trmt11 PE=2 SV=1 Back     alignment and function description
>sp|O94636|TRM11_SCHPO tRNA (guanine(10)-N2)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm11 PE=3 SV=2 Back     alignment and function description
>sp|Q12463|TRM11_YEAST tRNA (guanine(10)-N2)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM11 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
356524876 483 PREDICTED: tRNA guanosine-2'-O-methyltra 1.0 0.422 0.834 1e-96
356512097 483 PREDICTED: tRNA guanosine-2'-O-methyltra 1.0 0.422 0.814 5e-95
147789091 477 hypothetical protein VITISV_002923 [Viti 1.0 0.427 0.848 2e-92
225447846 477 PREDICTED: tRNA guanosine-2'-O-methyltra 1.0 0.427 0.843 6e-92
224054310 474 predicted protein [Populus trichocarpa] 1.0 0.430 0.775 2e-88
18404931 477 methyltransferase / nucleic acid binding 0.995 0.425 0.746 2e-85
297818174 477 methyltransferase/ nucleic acid binding 0.990 0.423 0.75 3e-84
357149526 475 PREDICTED: tRNA guanosine-2'-O-methyltra 0.975 0.418 0.741 6e-83
413937262 472 hypothetical protein ZEAMMB73_610590 [Ze 0.960 0.415 0.756 8e-83
413937260 320 hypothetical protein ZEAMMB73_610590 [Ze 0.960 0.612 0.756 8e-83
>gi|356524876|ref|XP_003531054.1| PREDICTED: tRNA guanosine-2'-O-methyltransferase TRM11 homolog [Glycine max] Back     alignment and taxonomy information
 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 183/205 (89%), Gaps = 1/205 (0%)

Query: 1   MPIGLLRADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDK 60
           MP+GLLRADNNLPPWR  LKEVFDAIICDPPYGVRAGGRKSGGRKLLKG V+PYTVPD+K
Sbjct: 279 MPVGLLRADNNLPPWRSTLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGAVEPYTVPDEK 338

Query: 61  RVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDS-TRNPFPEHPCFKLV 119
           R  HIPSTA Y L ECVHDLLDLA +MLVMGGRLVYFYPVLRED    N FPEHPCFKL+
Sbjct: 339 RTNHIPSTAAYSLVECVHDLLDLAAKMLVMGGRLVYFYPVLREDGFAENHFPEHPCFKLI 398

Query: 120 ASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLHSSVFASA 179
           +SSEQILSSRYSRVLLTMVK GPYTEEIAE AR KH+EF+ENH+KWLEDGNLHS+VF+ A
Sbjct: 399 SSSEQILSSRYSRVLLTMVKTGPYTEEIAEAAREKHIEFKENHVKWLEDGNLHSAVFSPA 458

Query: 180 DPQVTAAGDLKLSKDPKPKYRGKYV 204
           D Q+T AGD KL KDPKPKYRGKYV
Sbjct: 459 DAQLTEAGDPKLIKDPKPKYRGKYV 483

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356512097|ref|XP_003524757.1| PREDICTED: tRNA guanosine-2'-O-methyltransferase TRM11 homolog [Glycine max] Back     alignment and taxonomy information
>gi|147789091|emb|CAN78018.1| hypothetical protein VITISV_002923 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447846|ref|XP_002271199.1| PREDICTED: tRNA guanosine-2'-O-methyltransferase TRM11 homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|224054310|ref|XP_002298196.1| predicted protein [Populus trichocarpa] gi|118486632|gb|ABK95153.1| unknown [Populus trichocarpa] gi|222845454|gb|EEE83001.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18404931|ref|NP_566792.1| methyltransferase / nucleic acid binding protein [Arabidopsis thaliana] gi|13430750|gb|AAK25997.1|AF360287_1 unknown protein [Arabidopsis thaliana] gi|9294300|dbj|BAB02202.1| unnamed protein product [Arabidopsis thaliana] gi|15293219|gb|AAK93720.1| unknown protein [Arabidopsis thaliana] gi|332643633|gb|AEE77154.1| methyltransferase / nucleic acid binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297818174|ref|XP_002876970.1| methyltransferase/ nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297322808|gb|EFH53229.1| methyltransferase/ nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357149526|ref|XP_003575142.1| PREDICTED: tRNA guanosine-2'-O-methyltransferase TRM11 homolog [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|413937262|gb|AFW71813.1| hypothetical protein ZEAMMB73_610590 [Zea mays] Back     alignment and taxonomy information
>gi|413937260|gb|AFW71811.1| hypothetical protein ZEAMMB73_610590 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
TAIR|locus:2079261477 TRM11 "tRNA modification 11" [ 0.990 0.423 0.669 1.3e-70
DICTYBASE|DDB_G0283969507 trmt11 "tRNA guanosine-2'-O-me 0.676 0.272 0.383 1.2e-19
UNIPROTKB|F1NB37461 TRMT11 "tRNA (guanine(10)-N2)- 0.651 0.288 0.382 8.4e-19
UNIPROTKB|Q6YJI5461 TRMT11 "tRNA (guanine(10)-N2)- 0.651 0.288 0.382 8.4e-19
UNIPROTKB|E2RRG7463 TRMT11 "Uncharacterized protei 0.676 0.298 0.363 6.4e-18
UNIPROTKB|E2QXF9393 TRMT11 "Uncharacterized protei 0.661 0.343 0.370 7.8e-18
UNIPROTKB|F1S2W7460 TRMT11 "Uncharacterized protei 0.637 0.282 0.376 1.7e-17
UNIPROTKB|Q7Z4G4463 TRMT11 "tRNA (guanine(10)-N2)- 0.647 0.285 0.381 2.9e-17
UNIPROTKB|Q05B63460 TRMT11 "tRNA (guanine(10)-N2)- 0.637 0.282 0.376 3.7e-17
MGI|MGI:1920931460 Trmt11 "tRNA methyltransferase 0.637 0.282 0.369 7.9e-17
TAIR|locus:2079261 TRM11 "tRNA modification 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 715 (256.8 bits), Expect = 1.3e-70, P = 1.3e-70
 Identities = 138/206 (66%), Positives = 153/206 (74%)

Query:     1 MPIGLLRADNNLPPWRPGLKEVFDAIICDPPYXXXXXXXXXXXXXXXXXXXDPYTVPDDK 60
             MP+ LLR DNN+PPWR GLKE+FDAIICDPPY                   DPYTVPDDK
Sbjct:   274 MPVALLRMDNNVPPWRSGLKEIFDAIICDPPYGVRAGGRKSGGRKILRGTVDPYTVPDDK 333

Query:    61 RVGHIPSTAPYCLSECVHDLLDLAGRMLVMGGRLVYFYPVLREDS-TRNPFPEHPCFKLV 119
             R  HIPST  Y L ECVHDLL LA RMLVM GRLV+F+PVLR+++ +   FPEHPCFKLV
Sbjct:   334 RTDHIPSTGAYSLVECVHDLLHLAARMLVMKGRLVFFFPVLRDETGSEVKFPEHPCFKLV 393

Query:   120 ASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRENHLKWLEDGNLHSSVFASA 179
             A SEQILSSRYSRVLLTMVK+ PY+EE+ E AR  HLEFRENHLKWLEDGN+HSS+F   
Sbjct:   394 AVSEQILSSRYSRVLLTMVKVEPYSEEVEEAARLMHLEFRENHLKWLEDGNIHSSIFKPI 453

Query:   180 DP-QVTAAGDLKLSKDPKPKYRGKYV 204
             D  Q+    D K  KDPKPKYRGKYV
Sbjct:   454 DSSQIDT--DSKAFKDPKPKYRGKYV 477
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0006400 "tRNA modification" evidence=IMP
GO:0080180 "2-methylguanosine metabolic process" evidence=IMP
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
DICTYBASE|DDB_G0283969 trmt11 "tRNA guanosine-2'-O-methyltransferase 11" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NB37 TRMT11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YJI5 TRMT11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRG7 TRMT11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXF9 TRMT11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2W7 TRMT11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z4G4 TRMT11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B63 TRMT11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1920931 Trmt11 "tRNA methyltransferase 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
COG1041347 COG1041, COG1041, Predicted DNA modification methy 0.001
>gnl|CDD|223971 COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score = 38.5 bits (90), Expect = 0.001
 Identities = 24/121 (19%), Positives = 35/121 (28%), Gaps = 35/121 (28%)

Query: 20  KEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDKRVGHIPSTAPYCLSECVHD 79
               DAI  DPPYG                                       L E   +
Sbjct: 262 DNSVDAIATDPPYGRST------------------------------KIKGEGLDELYEE 291

Query: 80  LLDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVK 139
            L+ A  +L  GGR+V+  P            E   FK++      +    +RV+  + K
Sbjct: 292 ALESASEVLKPGGRIVFAAPRDPRHEL-----EELGFKVLGRFTMRVHGSLTRVIYVVRK 346

Query: 140 I 140
            
Sbjct: 347 K 347

Length = 347

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
KOG2671421 consensus Putative RNA methylase [Replication, rec 100.0
COG1041347 Predicted DNA modification methylase [DNA replicat 99.74
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.59
COG4123248 Predicted O-methyltransferase [General function pr 98.97
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.9
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.68
PRK13699227 putative methylase; Provisional 98.17
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 98.05
PRK11524284 putative methyltransferase; Provisional 97.91
PRK14967223 putative methyltransferase; Provisional 97.68
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 97.62
PRK10901427 16S rRNA methyltransferase B; Provisional 97.6
PF07669106 Eco57I: Eco57I restriction-modification methylase; 97.57
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.55
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 97.52
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.49
PRK14901434 16S rRNA methyltransferase B; Provisional 97.49
PRK14903431 16S rRNA methyltransferase B; Provisional 97.49
PHA03412241 putative methyltransferase; Provisional 97.48
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.46
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.43
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.36
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.28
PRK14968188 putative methyltransferase; Provisional 97.23
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 97.21
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 97.19
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 97.15
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 97.12
PRK14902444 16S rRNA methyltransferase B; Provisional 97.04
PRK14904445 16S rRNA methyltransferase B; Provisional 96.98
TIGR00536284 hemK_fam HemK family putative methylases. The gene 96.93
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 96.81
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 96.74
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.72
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.5
PHA03411279 putative methyltransferase; Provisional 96.49
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 96.45
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 96.39
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 96.38
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 96.33
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 96.18
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 96.12
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 96.07
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 95.74
COG1743 875 Adenine-specific DNA methylase containing a Zn-rib 95.63
COG2890280 HemK Methylase of polypeptide chain release factor 95.43
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 95.08
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 94.95
PLN02232160 ubiquinone biosynthesis methyltransferase 94.93
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 94.53
TIGR00438188 rrmJ cell division protein FtsJ. 94.08
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 93.8
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 93.48
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 93.38
PLN02233261 ubiquinone biosynthesis methyltransferase 93.31
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 93.29
COG0286489 HsdM Type I restriction-modification system methyl 93.2
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 92.81
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 92.56
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 92.24
COG1092393 Predicted SAM-dependent methyltransferases [Genera 91.79
PRK00811283 spermidine synthase; Provisional 91.58
PLN02672 1082 methionine S-methyltransferase 91.39
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 91.02
PRK04266226 fibrillarin; Provisional 90.43
COG0863302 DNA modification methylase [DNA replication, recom 90.42
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 90.24
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 89.85
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 89.27
PRK01581374 speE spermidine synthase; Validated 89.17
PLN02244340 tocopherol O-methyltransferase 88.83
COG2521287 Predicted archaeal methyltransferase [General func 88.8
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 88.74
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 88.25
PRK10258251 biotin biosynthesis protein BioC; Provisional 88.24
PF05063176 MT-A70: MT-A70 ; InterPro: IPR007757 N6-methyladen 88.09
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 87.9
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 86.58
COG1568354 Predicted methyltransferases [General function pre 85.93
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 85.88
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 85.4
KOG3045325 consensus Predicted RNA methylase involved in rRNA 85.39
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 85.31
PRK03612521 spermidine synthase; Provisional 85.1
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 84.98
KOG3420185 consensus Predicted RNA methylase [Translation, ri 84.87
smart00650169 rADc Ribosomal RNA adenine dimethylases. 84.8
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 84.38
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 84.33
COG2263198 Predicted RNA methylase [Translation, ribosomal st 83.62
PRK08317241 hypothetical protein; Provisional 83.58
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 83.32
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 83.27
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 82.89
PLN02336475 phosphoethanolamine N-methyltransferase 82.82
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 82.57
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 82.52
PLN02490340 MPBQ/MSBQ methyltransferase 82.08
TIGR00497501 hsdM type I restriction system adenine methylase ( 81.68
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 80.72
PRK06922677 hypothetical protein; Provisional 80.11
PLN02336 475 phosphoethanolamine N-methyltransferase 80.07
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=5e-42  Score=309.42  Aligned_cols=156  Identities=40%  Similarity=0.655  Sum_probs=136.7

Q ss_pred             CCCceeEeeCCCCCCCCCCccceeEEEeCCCCcccccccccCCcccccCcCCCCCCCCCCccCCCCCCCCcChHHHHHHH
Q 028754            1 MPIGLLRADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDKRVGHIPSTAPYCLSECVHDL   80 (204)
Q Consensus         1 ~p~dvl~~D~t~~p~R~~~~~~fDAIVtDPPYGiRe~~r~~G~~~~~~~~~~~~~~~~~~~~~~ip~~~~Y~l~~l~~DL   80 (204)
                      +++||++||++++|||+++  .||||||||||||||++||+|+++..+..      .++.+.+|+|.+.+|++.+|+.||
T Consensus       265 ~fldvl~~D~sn~~~rsn~--~fDaIvcDPPYGVRe~~rk~~~k~~~r~~------~~~~~~~h~p~~~~ysl~~~v~dl  336 (421)
T KOG2671|consen  265 QFLDVLTADFSNPPLRSNL--KFDAIVCDPPYGVREGARKTGKKKSVRTT------EESSRGDHYPSTEQYSLSSLVYDL  336 (421)
T ss_pred             hhhheeeecccCcchhhcc--eeeEEEeCCCcchhhhhhhhcccCcccCc------ccccccccCCccchhHHHHHHhhH
Confidence            4789999999999999988  99999999999999999999988776643      236899999999999999999999


Q ss_pred             HHHHhcccccCCEEEEEEeeccCCCCCCCCCCCCCeeEEeEEEEecCCceeEEEEEEEEcCCCcHHHHHHHHHhhhhhhH
Q 028754           81 LDLAGRMLVMGGRLVYFYPVLREDSTRNPFPEHPCFKLVASSEQILSSRYSRVLLTMVKIGPYTEEIAETARRKHLEFRE  160 (204)
Q Consensus        81 L~~Aa~lL~~gGRLvf~LP~~~~e~~e~~lp~h~gl~Lv~~~~Q~l~~k~sR~Litm~K~~~~~~~~~~~~~~~~~~fr~  160 (204)
                      |.+++++|+.|||||||+|+..+++.+..+|.|++|.|+++|+|.++ +|+|+|+||+|...|............++ |+
T Consensus       337 l~fss~~L~~ggrlv~w~p~~~e~~~~~~~P~h~~lsl~~ns~q~~~-~~srrllt~~k~~~~~~~~S~~~v~~~~~-r~  414 (421)
T KOG2671|consen  337 LCFSSRRLVDGGRLVFWLPTITEEYGEDDIPSHPYLSLIYNSEQPFT-HWSRRLLTYQKLPRYSDSKSLNLVPKINN-RT  414 (421)
T ss_pred             HHhhHhhhhcCceEEEecCchhhccCcccCCCCcchhhhhhhccccc-hhhhhheeeeeccccCcccccccCCchhh-cc
Confidence            99999999999999999999999999999999999999999999999 99999999999998754333222222233 88


Q ss_pred             hhhccc
Q 028754          161 NHLKWL  166 (204)
Q Consensus       161 ~~~~~~  166 (204)
                      +||.++
T Consensus       415 ~~~~N~  420 (421)
T KOG2671|consen  415 RYFNNF  420 (421)
T ss_pred             hhhhcc
Confidence            887654

>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF07669 Eco57I: Eco57I restriction-modification methylase; InterPro: IPR011639 This entry contains restriction modification methylases, which in the case of endonuclease Eco57I is found adjacent to the DNA cleavage domain, which recognises asymmetric DNA sequence 5'-CTGAAG [, ] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF05063 MT-A70: MT-A70 ; InterPro: IPR007757 N6-methyladenosine (m6A) is present at internal sites in eukaryotic mRNA Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.11
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 97.97
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.83
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 97.8
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 97.75
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 97.52
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 97.24
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.14
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.07
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 97.06
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 96.96
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 96.74
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 96.6
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 96.44
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 96.38
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 95.65
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 95.49
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 95.23
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 95.04
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 94.48
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 94.34
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 94.18
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 94.13
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 94.01
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 93.3
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 93.09
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 92.72
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 92.63
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 91.8
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 91.31
d2h00a1250 Methyltransferase 10 domain containing protein MET 90.91
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 90.53
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 90.26
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 90.26
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 89.93
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 88.78
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 88.46
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 86.87
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 86.65
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 86.35
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 86.32
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 85.48
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 84.87
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 83.82
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 83.64
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 83.0
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 82.55
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: N-6 DNA Methylase-like
domain: Hypothetical protein Lmo1582
species: Listeria monocytogenes [TaxId: 1639]

Probab=98.11  E-value=1.5e-06  Score=54.09  Aligned_cols=114  Identities=16%  Similarity=0.130  Sum_probs=61.7

Q ss_pred             CEEEEECCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             53683089999889986410088818998533322325875455676789877899866888989976768999999999
Q 028754            4 GLLRADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVVDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDL   83 (204)
Q Consensus         4 dil~~D~~~~p~R~~~~~~~DaIVtDPPYGiRa~~r~~G~~~~~~~~~~~~~~~~~~~~~~ip~~~~y~l~~l~~dLL~~   83 (204)
                      .+...|.....+.    ..||.|||+||||...........                     .-...+....++.-+++.
T Consensus       174 ~~~~~d~~~~~~~----~~fD~vi~NPPy~~~~~~~~~~~~---------------------~~~~~~~~~~~~~~Fi~~  228 (328)
T d2f8la1         174 TLLHQDGLANLLV----DPVDVVISDLPVGYYPDDENAKTF---------------------ELCREEGHSFAHFLFIEQ  228 (328)
T ss_dssp             EEEESCTTSCCCC----CCEEEEEEECCCSEESCHHHHTTS---------------------TTCCSSSCEEHHHHHHHH
T ss_pred             HHHCCCCCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHC---------------------CHHCCCCCCHHHHHHHHH
T ss_conf             4420243334220----002333457987777530122200---------------------011035744699999999


Q ss_pred             HHCCCCCCCEEEEEEEECC--CCCCC---CCCCCCCCEEEEEEE-EEECCCC-EEEEEEEEEECCC
Q ss_conf             8501206978999972005--88788---988888990688279-9834891-0499999997199
Q 028754           84 AGRMLVMGGRLVYFYPVLR--EDSTR---NPFPEHPCFKLVASS-EQILSSR-YSRVLLTMVKIGP  142 (204)
Q Consensus        84 Aa~lL~~gGRLvf~lP~~~--de~~e---~~lp~h~gl~Li~~~-~Q~l~~k-~sR~Litm~K~~~  142 (204)
                      +.++|++||++++++|...  +...+   ..+..+..+.-+-.. ...+... ..-.+++++|...
T Consensus       229 ~~~~Lk~~G~~~~I~p~~~l~~~~~~~lR~~L~~~~~i~~ii~lp~~~F~~~~~~t~ilvl~K~~~  294 (328)
T d2f8la1         229 GMRYTKPGGYLFFLVPDAMFGTSDFAKVDKFIKKNGHIEGIIKLPETLFKSEQARKSILILEKADV  294 (328)
T ss_dssp             HHHTEEEEEEEEEEEEGGGGGSTTHHHHHHHHHHHEEEEEEEECCGGGSCC-CCCEEEEEEEECCT
T ss_pred             HHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEEEECCCC
T ss_conf             998468988569992572013853689999998579189999788466689999769999988898
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure