Citrus Sinensis ID: 028817

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MPPTLFPNSDSPPAPASQIHPVSSSSPSPSDTWNYIWISIFLYLFKRLSKSNPQSTILLPSQQRNNDSVPRSPAATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERKKQSLVHGITGDVVQKDYYTWPYHFSGSP
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccc
ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEccccHHcccccccccccccccccccccEEEEEEcccccccccccccccccEEEHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccEEEEcccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccEEccccccccccccccc
mpptlfpnsdsppapasqihpvsssspspsdtwnYIWISIFLYLFKRlsksnpqstillpsqqrnndsvprspaatdrrlnnrpvigilshpgdgasgrlnnsknASYIAASYVKFVESagarvipliynepEEILFEKLKLVNGVLltggwakkgLYFQIVEKIFKHEAIYERKKQslvhgitgdvvqkdyytwpyhfsgsp
MPPTLFPNSDSPPAPASQIhpvsssspspsdtWNYIWISIFLYLFKRLSKSNPQStillpsqqrnndsvprspaatdrrlnnrpvigilshpgdgasgrlNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERkkqslvhgitgdvVQKDYYTWPYHFSGSP
MPPTLFPNSDSPPAPASQIHPVsssspspsDTWNYIWISIFLYLFKRLSKSNPQSTILLPSQQRNNDSVPRSPAATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERKKQSLVHGITGDVVQKDYYTWPYHFSGSP
*******************************TWNYIWISIFLYLFKRL*********************************************************ASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERKKQSLVHGITGDVVQKDYYTWPYHF****
**PTL***************************WNYIWISIFLYLFKRLSKSNPQSTILLPSQQRNNDSV*********RLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERKKQSLVHGITGDVVQKDYYTWPYHFS***
*****************************SDTWNYIWISIFLYLFKRLSKSNPQSTILLPS*************ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERKKQSLVHGITGDVVQKDYYTWPYHFSGSP
***************************SPSDTWNYIWISIFLYLFKRLSKSNPQSTILLPSQQRNNDSVPRSPAATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERKKQSLVHGITGDVVQKDYYTWPYHFS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPTLFPNSDSPPAPASQIHPVSSSSPSPSDTWNYIWISIFLYLFKRLSKSNPQSTILLPSQQRNNDSVPRSPAATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERKKQSLVHGITGDVVQKDYYTWPYHFSGSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query203 2.2.26 [Sep-21-2011]
O65355 347 Gamma-glutamyl hydrolase yes no 0.650 0.380 0.649 6e-42
P93164 342 Gamma-glutamyl hydrolase no no 0.630 0.374 0.593 5e-35
Q54LN4 317 Gamma-glutamyl hydrolase yes no 0.423 0.271 0.386 7e-13
Q54HL4 347 Gamma-glutamyl hydrolase no no 0.349 0.204 0.486 9e-12
Q9Z0L8 317 Gamma-glutamyl hydrolase yes no 0.330 0.211 0.450 5e-08
Q62867 317 Gamma-glutamyl hydrolase yes no 0.339 0.217 0.455 1e-07
Q92820 318 Gamma-glutamyl hydrolase yes no 0.310 0.198 0.444 2e-06
A7YWG4 318 Gamma-glutamyl hydrolase yes no 0.300 0.191 0.485 5e-06
>sp|O65355|GGH_ARATH Gamma-glutamyl hydrolase OS=Arabidopsis thaliana GN=GGH PE=1 SV=2 Back     alignment and function desciption
 Score =  170 bits (431), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 89/137 (64%), Positives = 106/137 (77%), Gaps = 5/137 (3%)

Query: 33  WNYIWISIF-LYLFKRLSKSNPQSTILLPSQQRNNDSVPRSPAAT--DRRLNNRPVIGIL 89
           W+Y+W+ +  L LFK        +TILLPSQ      + RSP  +  D  LN RPVIGIL
Sbjct: 2   WSYVWLPLVALSLFKDSIIMAKAATILLPSQ--TGFDISRSPVCSAPDPNLNYRPVIGIL 59

Query: 90  SHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLT 149
           SHPGDGASGRL+N+ +AS IAASYVK  ES GARVIPLI+NEPEEILF+KL+LVNGV+LT
Sbjct: 60  SHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEPEEILFQKLELVNGVILT 119

Query: 150 GGWAKKGLYFQIVEKIF 166
           GGWAK+GLYF+IV+KIF
Sbjct: 120 GGWAKEGLYFEIVKKIF 136
Has endopeptidase activity against 4-amino-10-methylpteroyl penta-, tetra-, tri- and di-gamma-L-glutamate substrates and is responsible for the production of folic acid, pteglu from teroylpolyglutamates.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 9
>sp|P93164|GGH_SOYBN Gamma-glutamyl hydrolase OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q54LN4|GGHA_DICDI Gamma-glutamyl hydrolase A OS=Dictyostelium discoideum GN=gghA PE=3 SV=1 Back     alignment and function description
>sp|Q54HL4|GGHB_DICDI Gamma-glutamyl hydrolase B OS=Dictyostelium discoideum GN=gghB PE=3 SV=1 Back     alignment and function description
>sp|Q9Z0L8|GGH_MOUSE Gamma-glutamyl hydrolase OS=Mus musculus GN=Ggh PE=1 SV=2 Back     alignment and function description
>sp|Q62867|GGH_RAT Gamma-glutamyl hydrolase OS=Rattus norvegicus GN=Ggh PE=1 SV=1 Back     alignment and function description
>sp|Q92820|GGH_HUMAN Gamma-glutamyl hydrolase OS=Homo sapiens GN=GGH PE=1 SV=2 Back     alignment and function description
>sp|A7YWG4|GGH_BOVIN Gamma-glutamyl hydrolase OS=Bos taurus GN=GGH PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
302142873 514 unnamed protein product [Vitis vinifera] 0.674 0.266 0.664 3e-44
224104165 304 predicted protein [Populus trichocarpa] 0.660 0.440 0.673 4e-44
225461732 384 PREDICTED: gamma-glutamyl hydrolase [Vit 0.674 0.356 0.664 5e-44
224117460 367 predicted protein [Populus trichocarpa] 0.660 0.365 0.666 1e-43
255567082 388 Gamma-glutamyl hydrolase precursor, puta 0.665 0.347 0.668 2e-42
224122254 327 predicted protein [Populus trichocarpa] 0.551 0.342 0.773 1e-40
30699349 347 gamma-glutamyl hydrolase 2 [Arabidopsis 0.650 0.380 0.649 3e-40
334183996 333 gamma-glutamyl hydrolase 2 [Arabidopsis 0.650 0.396 0.649 3e-40
449518069 433 PREDICTED: LOW QUALITY PROTEIN: gamma-gl 0.674 0.316 0.643 3e-40
449456571 375 PREDICTED: gamma-glutamyl hydrolase-like 0.674 0.365 0.643 4e-40
>gi|302142873|emb|CBI20168.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 3/140 (2%)

Query: 30  SDTWNYIWISIFLYLFKRLSKSNPQSTILLPSQQR--NNDSVPRSPAATDRRLNNRPVIG 87
           S+ WNY+W+ + L + K L+ +  +STILLPS  R  +  S P  PA  D +LN RPV+G
Sbjct: 172 SEIWNYLWVPLLLSVSKELTAAKAESTILLPSDVRLGSARSSPSCPAP-DPKLNFRPVVG 230

Query: 88  ILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVL 147
           IL+HPGDGASGRLNN  NASYIAASYVKFVESAGARVIPLIYNEP EIL EKL LVNGV+
Sbjct: 231 ILTHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPLIYNEPLEILHEKLNLVNGVI 290

Query: 148 LTGGWAKKGLYFQIVEKIFK 167
            TGGWAK GLY+  V +IFK
Sbjct: 291 FTGGWAKSGLYYTTVGEIFK 310

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224104165|ref|XP_002333977.1| predicted protein [Populus trichocarpa] gi|222839427|gb|EEE77764.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225461732|ref|XP_002285525.1| PREDICTED: gamma-glutamyl hydrolase [Vitis vinifera] Back     alignment and taxonomy information
>gi|224117460|ref|XP_002331718.1| predicted protein [Populus trichocarpa] gi|222874324|gb|EEF11455.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255567082|ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] gi|223536197|gb|EEF37850.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224122254|ref|XP_002318789.1| predicted protein [Populus trichocarpa] gi|222859462|gb|EEE97009.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30699349|ref|NP_565186.2| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] gi|26454629|sp|O65355.2|GGH_ARATH RecName: Full=Gamma-glutamyl hydrolase; AltName: Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X carboxypeptidase; Flags: Precursor gi|17979073|gb|AAL49804.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana] gi|20465329|gb|AAM20068.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana] gi|332198016|gb|AEE36137.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334183996|ref|NP_001185429.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] gi|332198017|gb|AEE36138.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449518069|ref|XP_004166066.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449456571|ref|XP_004146022.1| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
TAIR|locus:2037603 347 GGH2 "gamma-glutamyl hydrolase 0.650 0.380 0.656 9.6e-41
TAIR|locus:2037583 348 GGH1 "gamma-glutamyl hydrolase 0.586 0.341 0.653 7.2e-36
UNIPROTKB|P93164 342 P93164 "Gamma-glutamyl hydrola 0.630 0.374 0.609 4.1e-33
TAIR|locus:2037573 352 GGH3 "gamma-glutamyl hydrolase 0.645 0.372 0.551 3.3e-31
DICTYBASE|DDB_G0289365 347 gghB "peptidase C26 family pro 0.339 0.198 0.5 5.3e-13
DICTYBASE|DDB_G0286535 317 gghA "peptidase C26 family pro 0.339 0.217 0.479 1.1e-12
UNIPROTKB|F1NR48 321 GGH "Uncharacterized protein" 0.591 0.373 0.36 3e-12
ZFIN|ZDB-GENE-050309-193 314 zgc:171566 "zgc:171566" [Danio 0.374 0.242 0.468 4e-11
ZFIN|ZDB-GENE-040426-2615 312 ggh "gamma-glutamyl hydrolase 0.334 0.217 0.465 2.4e-10
MGI|MGI:1329035 317 Ggh "gamma-glutamyl hydrolase" 0.423 0.271 0.419 1.1e-09
TAIR|locus:2037603 GGH2 "gamma-glutamyl hydrolase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 433 (157.5 bits), Expect = 9.6e-41, P = 9.6e-41
 Identities = 90/137 (65%), Positives = 107/137 (78%)

Query:    33 WNYIWISIF-LYLFKRLSKSNPQSTILLPSQQRNNDSVPRSP--AATDRRLNNRPVIGIL 89
             W+Y+W+ +  L LFK        +TILLPSQ      + RSP  +A D  LN RPVIGIL
Sbjct:     2 WSYVWLPLVALSLFKDSIIMAKAATILLPSQ--TGFDISRSPVCSAPDPNLNYRPVIGIL 59

Query:    90 SHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLT 149
             SHPGDGASGRL+N+ +AS IAASYVK  ES GARVIPLI+NEPEEILF+KL+LVNGV+LT
Sbjct:    60 SHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEPEEILFQKLELVNGVILT 119

Query:   150 GGWAKKGLYFQIVEKIF 166
             GGWAK+GLYF+IV+KIF
Sbjct:   120 GGWAKEGLYFEIVKKIF 136
GO:0003824 "catalytic activity" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006541 "glutamine metabolic process" evidence=IEA
GO:0008242 "omega peptidase activity" evidence=IEA;IDA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005773 "vacuole" evidence=IDA
GO:0046900 "tetrahydrofolylpolyglutamate metabolic process" evidence=IDA
GO:0006833 "water transport" evidence=RCA
GO:0006970 "response to osmotic stress" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
TAIR|locus:2037583 GGH1 "gamma-glutamyl hydrolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93164 P93164 "Gamma-glutamyl hydrolase" [Glycine max (taxid:3847)] Back     alignment and assigned GO terms
TAIR|locus:2037573 GGH3 "gamma-glutamyl hydrolase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289365 gghB "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286535 gghA "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NR48 GGH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050309-193 zgc:171566 "zgc:171566" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2615 ggh "gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1329035 Ggh "gamma-glutamyl hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.19.9LOW CONFIDENCE prediction!
3rd Layer3.4.19LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.904.3.1
hypothetical protein (303 aa)
(Populus trichocarpa)
Predicted Functional Partners:
FPGS4
folylpolyglutamate synthase (EC-6.3.2.17) (525 aa)
     •  0.899
FPGS2
folylpolyglutamate synthase (EC-6.3.2.17) (511 aa)
     •  0.899
FPGS5
folylpolyglutamate synthase (EC-6.3.2.12) (442 aa)
     •  0.899
grail3.16455000101
annotation not avaliable (82 aa)
     •  0.899
DHFR-TS-2
dihydrofolate reductase-thymidylate synthase (EC-1.5.1.3 2.1.1.45) (414 aa)
     •  0.899
FPGS3
folylpolyglutamate synthase (EC-6.3.2.17) (587 aa)
     •  0.899
FPGS1
folylpolyglutamate synthase (EC-6.3.2.17) (588 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
cd01747 273 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutam 2e-32
pfam07722219 pfam07722, Peptidase_C26, Peptidase C26 1e-21
cd01745189 cd01745, GATase1_2, Subgroup of proteins having th 7e-06
>gnl|CDD|153218 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information 
 Score =  117 bits (296), Expect = 2e-32
 Identities = 39/84 (46%), Positives = 50/84 (59%), Gaps = 5/84 (5%)

Query: 86  IGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNG 145
           IGIL+ P DGA    +N    SYIAASYVKF+ESAGARV+P+  NE EE   +  K +NG
Sbjct: 1   IGILTQPVDGAG---SNKTGHSYIAASYVKFLESAGARVVPIWINESEEYYDKLFKSING 57

Query: 146 VLLTGGWA--KKGLYFQIVEKIFK 167
           +L  GG        Y +  + I+ 
Sbjct: 58  ILFPGGAVDIDTSGYARTAKIIYN 81

Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 273
>gnl|CDD|219535 pfam07722, Peptidase_C26, Peptidase C26 Back     alignment and domain information
>gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 203
KOG1559 340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 99.97
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.91
COG2071243 Predicted glutamine amidotransferases [General fun 99.87
PRK11366 254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.78
cd01747 273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.74
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.35
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 98.61
PRK12564360 carbamoyl phosphate synthase small subunit; Review 98.41
PRK07765 214 para-aminobenzoate synthase component II; Provisio 98.36
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 98.22
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 98.2
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 98.14
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 98.12
PRK01175 261 phosphoribosylformylglycinamidine synthase I; Prov 98.08
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 98.01
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 97.98
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 97.97
PRK00758184 GMP synthase subunit A; Validated 97.97
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 97.96
PRK12838354 carbamoyl phosphate synthase small subunit; Review 97.95
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 97.82
PLN02832 248 glutamine amidotransferase subunit of pyridoxal 5' 97.82
PRK13143 200 hisH imidazole glycerol phosphate synthase subunit 97.8
TIGR01737 227 FGAM_synth_I phosphoribosylformylglycinamidine syn 97.78
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 97.77
PRK13146 209 hisH imidazole glycerol phosphate synthase subunit 97.76
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 97.75
cd01746 235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 97.73
PRK13152 201 hisH imidazole glycerol phosphate synthase subunit 97.72
PRK06895190 putative anthranilate synthase component II; Provi 97.71
CHL00188 210 hisH imidazole glycerol phosphate synthase subunit 97.68
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 97.67
cd01740 238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 97.67
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 97.61
PRK05670189 anthranilate synthase component II; Provisional 97.6
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 97.6
TIGR00379 449 cobB cobyrinic acid a,c-diamide synthase. This mod 97.55
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 97.54
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 97.52
PRK13181 199 hisH imidazole glycerol phosphate synthase subunit 97.48
TIGR00337 525 PyrG CTP synthase. CTP synthase is involved in pyr 97.47
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 97.45
PLN02347 536 GMP synthetase 97.44
PRK00074 511 guaA GMP synthase; Reviewed 97.44
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 97.42
cd01748 198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 97.35
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 97.22
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 97.21
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 97.17
PRK13566720 anthranilate synthase; Provisional 97.11
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 97.07
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 97.04
PRK13141 205 hisH imidazole glycerol phosphate synthase subunit 97.03
COG0311194 PDX2 Predicted glutamine amidotransferase involved 96.98
PRK05637208 anthranilate synthase component II; Provisional 96.97
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 96.95
PRK08007187 para-aminobenzoate synthase component II; Provisio 96.93
CHL00101190 trpG anthranilate synthase component 2 96.93
PRK14004 210 hisH imidazole glycerol phosphate synthase subunit 96.79
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 96.79
PRK07567 242 glutamine amidotransferase; Provisional 96.72
PRK06186 229 hypothetical protein; Validated 96.69
COG0047 231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 96.69
PRK00784 488 cobyric acid synthase; Provisional 96.68
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 96.66
PRK05380 533 pyrG CTP synthetase; Validated 96.6
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 96.57
PRK06490 239 glutamine amidotransferase; Provisional 96.48
PRK03619 219 phosphoribosylformylglycinamidine synthase I; Prov 96.45
PRK06774191 para-aminobenzoate synthase component II; Provisio 96.43
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 96.4
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 96.38
KOG3210 226 consensus Imidazoleglycerol-phosphate synthase sub 96.32
PLN02335 222 anthranilate synthase 96.32
PRK08250 235 glutamine amidotransferase; Provisional 96.26
PRK07053 234 glutamine amidotransferase; Provisional 96.18
PF13507 259 GATase_5: CobB/CobQ-like glutamine amidotransferas 96.07
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 96.01
PRK08857193 para-aminobenzoate synthase component II; Provisio 96.01
PLN02617 538 imidazole glycerol phosphate synthase hisHF 95.98
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 95.91
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 95.86
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 95.67
PRK09065 237 glutamine amidotransferase; Provisional 95.6
TIGR00313 475 cobQ cobyric acid synthase CobQ. 95.43
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 95.3
COG0118 204 HisH Glutamine amidotransferase [Amino acid transp 95.27
PRK05665 240 amidotransferase; Provisional 95.24
TIGR01815 717 TrpE-clade3 anthranilate synthase, alpha proteobac 95.09
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 95.05
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 94.45
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 94.06
PLN02889 918 oxo-acid-lyase/anthranilate synthase 93.9
PLN02327 557 CTP synthase 93.87
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 93.51
PRK05368 302 homoserine O-succinyltransferase; Provisional 93.09
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 92.64
TIGR01857 1239 FGAM-synthase phosphoribosylformylglycinamidine sy 92.46
PRK05297 1290 phosphoribosylformylglycinamidine synthase; Provis 91.96
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 91.84
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 91.72
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 91.1
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 90.98
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 90.87
TIGR01735 1310 FGAM_synt phosphoribosylformylglycinamidine syntha 90.74
PLN03206 1307 phosphoribosylformylglycinamidine synthase; Provis 90.65
TIGR02069 250 cyanophycinase cyanophycinase. This model describe 90.18
TIGR01739 1202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 89.94
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 89.84
PHA03366 1304 FGAM-synthase; Provisional 88.85
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 88.17
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 87.98
COG4917148 EutP Ethanolamine utilization protein [Amino acid 87.73
COG1492 486 CobQ Cobyric acid synthase [Coenzyme metabolism] 87.71
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 87.0
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 86.3
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 85.91
COG0303 404 MoeA Molybdopterin biosynthesis enzyme [Coenzyme m 85.29
PRK04155287 chaperone protein HchA; Provisional 85.26
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 85.2
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 84.15
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 84.05
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 83.81
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 83.12
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 83.08
PRK10355 330 xylF D-xylose transporter subunit XylF; Provisiona 82.97
TIGR02667163 moaB_proteo molybdenum cofactor biosynthesis prote 82.97
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 82.9
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 82.73
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 82.07
PRK14690419 molybdopterin biosynthesis protein MoeA; Provision 81.8
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 81.74
PRK08091228 ribulose-phosphate 3-epimerase; Validated 80.95
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 80.79
PRK11574196 oxidative-stress-resistance chaperone; Provisional 80.56
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 80.46
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information 
Probab=99.97  E-value=2.7e-32  Score=240.36  Aligned_cols=155  Identities=53%  Similarity=0.848  Sum_probs=137.3

Q ss_pred             hhhhHHHHHHHHHhhhhccCCCCcccccCccccC-CCCCCCCCCCCCCCCCCCCEEEEcCCCCCCCCCCCCCCCCchhhh
Q 028817           32 TWNYIWISIFLYLFKRLSKSNPQSTILLPSQQRN-NDSVPRSPAATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIA  110 (203)
Q Consensus        32 m~~~~~~~~~~~~~~~~~~~~~~~~~~lp~~~~~-~~~~~~~~~~~~~~~~~rPVIGIta~~~~~~~~~~~~~~~~syI~  110 (203)
                      ||+.++++.|+++.....+....+.|+||+|.+. .+.++.|. +||++++.||||||+++++++..+++.+.+.++||+
T Consensus         1 m~~~~~~~~l~~~~~S~~~~~~~~~ilLps~~g~e~SRspvcs-apdpnlnykPvIGIL~hpg~g~~~rl~n~t~~~yIA   79 (340)
T KOG1559|consen    1 MWRFLFFLSLLFFMASPGALLCAESILLPSQAGFELSRSPVCS-APDPNLNYKPVIGILSHPGDGASGRLKNATGRSYIA   79 (340)
T ss_pred             CcchHHHHHHHHhccChHHHHHHhheecccccccccccCcccc-CCCCCcccCceeEEeccCCCCccceeccccCcchhH
Confidence            8885544444433222345556778999999997 44589999 999999999999999999998778888889999999


Q ss_pred             HHHHHHHHHCCCeEEEeecCCCHHHHHHHHHhcCEEEeCCCCCCCCcChHHHHHHHHHHHHHHhCCCC-cceEeeCCc
Q 028817          111 ASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKHEAIYERKKQS-LVHGITGDV  187 (203)
Q Consensus       111 ~sYVkaVe~AGA~PV~LP~~~~~e~l~~~Ld~VDGVLLTGG~DVdP~yY~~~~~I~~~AL~~n~~g~~-PV~Gic~~~  187 (203)
                      ++|||..|.+|||+|++.++++++.+...|+.||||+||||+.....||+.+++||++++++||+|++ ||||||=|-
T Consensus        80 ASYVK~aEsgGARViPli~nepEe~lfqklelvNGviftGGwak~~dY~~vvkkifnk~le~nDaGehFPvyg~CLGF  157 (340)
T KOG1559|consen   80 ASYVKLAESGGARVIPLIYNEPEEILFQKLELVNGVIFTGGWAKRGDYFEVVKKIFNKVLERNDAGEHFPVYGICLGF  157 (340)
T ss_pred             HHHHHHHHcCCceEEEEecCCcHHHHHHHHHHhceeEecCcccccccHHHHHHHHHHHHHhccCCccccchhhhhhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999 999999773

>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>COG0303 MoeA Molybdopterin biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional Back     alignment and domain information
>TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>PRK14690 molybdopterin biosynthesis protein MoeA; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
1l9x_A 315 Structure Of Gamma-Glutamyl Hydrolase Length = 315 2e-07
>pdb|1L9X|A Chain A, Structure Of Gamma-Glutamyl Hydrolase Length = 315 Back     alignment and structure 
Iteration: 1

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 9/72 (12%)
Query: 83  RPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPE---EILFEK 139
           +P+IGIL         ++  +    YIAASYVK++ESAGARV+P+  +  E   EILF  
Sbjct: 30  KPIIGILMQK---CRNKVMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILF-- 84
Query: 140 LKLVNGVLLTGG 151
            K +NG+L  GG
Sbjct: 85  -KSINGILFPGG 95

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
1l9x_A 315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 3e-19
3fij_A 254 LIN1909 protein; 11172J, uncharacterized protein, 3e-07
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
 Score = 82.8 bits (204), Expect = 3e-19
 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 63  QRNNDSVPR-SPAATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAG 121
             ++  VPR S          +P+IGIL         ++  +    YIAASYVK++ESAG
Sbjct: 9   HHSSGLVPRGSHMRPHGDTAKKPIIGILMQK---CRNKVMKNYGRYYIAASYVKYLESAG 65

Query: 122 ARVIPLIYNEPEEILFEKLKLVNGVLLTGGWA--KKGLYFQIVEKIFK 167
           ARV+P+  +  E+      K +NG+L  GG    ++  Y ++ +  + 
Sbjct: 66  ARVVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRSDYAKVAKIFYN 113
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
3fij_A 254 LIN1909 protein; 11172J, uncharacterized protein, 99.77
1l9x_A 315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.66
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 98.99
2abw_A 227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 98.79
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 98.58
2a9v_A 212 GMP synthase; structural genomics, joint center fo 98.43
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 98.43
1q7r_A219 Predicted amidotransferase; structural genomics, Y 98.42
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 98.25
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 98.18
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 98.17
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 98.15
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 98.12
1o1y_A 239 Conserved hypothetical protein TM1158; flavodoxin- 98.11
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 98.1
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 98.04
3d54_D 213 Phosphoribosylformylglycinamidine synthase 1; alph 98.0
1i1q_B192 Anthranilate synthase component II; tryptophan bio 97.99
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 97.98
2w7t_A 273 CTP synthetase, putative cytidine triphosphate syn 97.96
4gud_A 211 Imidazole glycerol phosphate synthase subunit His; 97.85
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 97.74
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 97.72
3m3p_A 250 Glutamine amido transferase; structural genomics, 97.68
2v4u_A 289 CTP synthase 2; pyrimidine biosynthesis, glutamine 97.66
3uow_A 556 GMP synthetase; structural genomics consortium, SG 97.39
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 97.34
3l7n_A 236 Putative uncharacterized protein; glutamine amidot 97.3
1vco_A 550 CTP synthetase; tetramer, riken structural genomic 97.28
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 97.13
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 97.09
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 97.07
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 96.96
1s1m_A 545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 96.86
3ugj_A 1303 Phosphoribosylformylglycinamidine synthase; amidot 96.47
3nva_A 535 CTP synthase; rossman fold, nucleotide binding, LI 95.66
3en0_A 291 Cyanophycinase; serine protease, beta peptide spec 94.38
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 93.61
2vdj_A 301 Homoserine O-succinyltransferase; methionine biosy 93.52
2h2w_A 312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 93.2
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 91.07
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 90.29
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 90.06
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 88.06
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 86.42
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 86.3
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 86.08
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 84.62
3cne_A175 Putative protease I; structural genomics, PSI-2, M 84.57
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 84.41
2fzv_A279 Putative arsenical resistance protein; flavin bind 83.72
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 83.39
3gra_A202 Transcriptional regulator, ARAC family; transcript 82.51
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 82.45
1jlj_A189 Gephyrin; globular alpha/beta fold, structural pro 81.9
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 80.35
3er6_A209 Putative transcriptional regulator protein; struct 80.31
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
Probab=99.77  E-value=4.6e-19  Score=151.29  Aligned_cols=112  Identities=21%  Similarity=0.322  Sum_probs=75.1

Q ss_pred             CCCCCEEEEcCCCCCCCCCCCCCCCCchhhhHHHHHHHHHCCCeEEEeecCCCHHHHHHHHHhcCEEEeCCCCCCCCcCh
Q 028817           80 LNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGWAKKGLYF  159 (203)
Q Consensus        80 ~~~rPVIGIta~~~~~~~~~~~~~~~~syI~~sYVkaVe~AGA~PV~LP~~~~~e~l~~~Ld~VDGVLLTGG~DVdP~yY  159 (203)
                      |++||+|||+++..... ...+++..++|+.+.|+++|+++|+.|++||+..+.+ ++++++.+|||||+||.||+|.+|
T Consensus         1 m~~~p~IGi~~~~~~~~-~~~~~~~~~~~~~~~~~~~l~~aG~~pv~lp~~~~~~-~~~~l~~~DGlil~GG~~v~P~~y   78 (254)
T 3fij_A            1 MSLKPVIGITGNRLVKG-VDVFYGHRVTYTQQRYVDAIQKVGGFPIALPIDDPST-AVQAISLVDGLLLTGGQDITPQLY   78 (254)
T ss_dssp             --CCCEEEEEC-------------------CHHHHHHHHHHTCEEEEECCCCGGG-HHHHHHTCSEEEECCCSCCCGGGG
T ss_pred             CCCCCEEEEeCCccccc-ccccCCcchhhhhHHHHHHHHHCCCEEEEEeCCCchH-HHHHHhhCCEEEECCCCCCChhhc
Confidence            35789999999864322 1123446788999999999999999999999877666 889999999999999999999999


Q ss_pred             HH-----------HHHHHHHHHHHHhC-CCCcceEee----------CCccccccc
Q 028817          160 QI-----------VEKIFKHEAIYERK-KQSLVHGIT----------GDVVQKDYY  193 (203)
Q Consensus       160 ~~-----------~~~I~~~AL~~n~~-g~~PV~Gic----------~~~~~~~~~  193 (203)
                      ++           .++.+++++.+... .+.||||||          ||+|-||..
T Consensus        79 g~~~~~~~~~~~~~rd~~~~~lir~a~~~~~PiLGIC~G~Qll~~a~Gg~v~~~~~  134 (254)
T 3fij_A           79 LEEPSQEIGAYFPPRDSYEIALVRAALDAGKPIFAICRGMQLVNVALGGTLYQDIS  134 (254)
T ss_dssp             TCCCCTTCCCCCHHHHHHHHHHHHHHHHTTCCEEEETHHHHHHHHHTTCCEESSGG
T ss_pred             CCccCcccCCcChhhhHHHHHHHHHHHHcCCCEEEECHHHHHHHHHhCCceecccc
Confidence            54           34444444444332 346999999          457777754
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>1jlj_A Gephyrin; globular alpha/beta fold, structural protein; 1.60A {Homo sapiens} SCOP: c.57.1.1 PDB: 1ihc_A Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 203
d1l9xa_ 288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 4e-14
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.2 bits (163), Expect = 4e-14
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 83  RPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKL 142
           +P+IGIL         ++  +    YIAASYVK++ESAGARV+P+  +  E+      K 
Sbjct: 3   KPIIGILMQK---CRNKVMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKS 59

Query: 143 VNGVLLTGGWA 153
           +NG+L  GG  
Sbjct: 60  INGILFPGGSV 70

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
d1l9xa_ 288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.89
d2abwa1 218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 98.23
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 98.23
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 98.07
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 98.03
d1jvna2 232 GAT subunit, HisH, (or domain) of imidazoleglycero 97.74
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 97.68
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 97.38
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 97.35
d1o1ya_ 230 Hypothetical protein TM1158 {Thermotoga maritima [ 97.16
d1t3ta2 262 FGAM synthase PurL, amidotransferase domain {Salmo 97.15
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 97.15
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 96.99
d1vcoa1 250 CTP synthase PyrG, C-terminal domain {Thermus ther 96.8
d1gpma2 205 GMP synthetase {Escherichia coli [TaxId: 562]} 96.52
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 96.25
d1s1ma1 258 CTP synthase PyrG, C-terminal domain {Escherichia 95.73
d2ghra1 281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 93.6
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 90.54
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 87.86
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 87.48
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 86.07
d2ftsa3155 Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId 85.61
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 83.4
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 83.29
d1wu2a3144 MoeA, central domain {Pyrococcus horikoshii, PH164 81.58
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 81.14
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=8.6e-24  Score=181.23  Aligned_cols=102  Identities=29%  Similarity=0.418  Sum_probs=90.2

Q ss_pred             CCCEEEEcCCCCCCCCCCCCCCCCchhhhHHHHHHHHHCCCeEEEeecCCCHHHHHHHHHhcCEEEeCCCC-CCCCcChH
Q 028817           82 NRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEEILFEKLKLVNGVLLTGGW-AKKGLYFQ  160 (203)
Q Consensus        82 ~rPVIGIta~~~~~~~~~~~~~~~~syI~~sYVkaVe~AGA~PV~LP~~~~~e~l~~~Ld~VDGVLLTGG~-DVdP~yY~  160 (203)
                      +||||||++++....   .+.....+|++++||++|++|||+||+||++.+.++++++|+.+||||||||. +++|..|.
T Consensus         2 ~kPiIGI~~~~~~~~---~~~~~~~~yi~~sYvk~ie~aGa~vvpi~~~~~~~~~~~~l~~idGillpGG~~~~~~~~~~   78 (288)
T d1l9xa_           2 KKPIIGILMQKCRNK---VMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRSDYA   78 (288)
T ss_dssp             CCCEEEEECEECCSH---HHHTTCSEEEEHHHHHHHHHTTCEEEEECSSCCHHHHHHHHHHSSEEEECCCCCCTTTCHHH
T ss_pred             CCCEEEEeCCcccCc---ccccchHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHhhcCCeEecCCCCCccccccc
Confidence            689999999865421   23445678999999999999999999999999999999999999999999996 89998885


Q ss_pred             -HHHHHHHHHHHHHhCCCC-cceEeeCC
Q 028817          161 -IVEKIFKHEAIYERKKQS-LVHGITGD  186 (203)
Q Consensus       161 -~~~~I~~~AL~~n~~g~~-PV~Gic~~  186 (203)
                       .+++++++++++++.|+. ||||||-|
T Consensus        79 ~~~r~~~~~~l~~~~~~~~~PilGIC~G  106 (288)
T d1l9xa_          79 KVAKIFYNLSIQSFDDGDYFPVWGTCLG  106 (288)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCEEEETHH
T ss_pred             ccchHHHHHHHHHHHhhCCCCeEEEcHH
Confidence             689999999999999998 99999954
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1wu2a3 c.57.1.2 (A:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure