Citrus Sinensis ID: 028972


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MSSYSREGRGQRSRSLSRSRRSRSRSRSRSPDAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITVEKAKRSRGRTPTPGHYHGLREKQRGNGRRRSRSYSPYRYNRDSYSRDRRGRSRSPYGRGRSRSPYGRRDHDLFRRRRERSLSAGSSGYRR
ccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccccEEEEcccccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHHHccccEEccEEEEEEHccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mssysregrgqrsrslsrsrrsrsrsrsrspdaanpgnnlyvtglstrvtnadlekffggegkvtechlvtdprtrescgFAFVTMETVEGADRCIKYLNRSVLEGRLITVEKakrsrgrtptpghyhglrekqrgngrrrsrsyspyrynrdsysrdrrgrsrspygrgrsrspygrrdhdLFRRRRErslsagssgyrr
mssysregrgqrsrslsrsrrsrsrsrsrspdaanpgnnlyvtglSTRVTNADLEkffggegkvtechlvtdprtreSCGFAFVTMETVEGADRCIKYlnrsvlegrlitvekakrsrgrtptpghyhglrekqrgngrrrsrsyspyrynrdsysrdrrgrsrspygrgrsrspygrrdhdlfrrrrerslsagssgyrr
MssysregrgqrsrslsrsrrsrsrsrsrsPDAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITVEKAKRSRGRTPTPGHYHGLREKQrgngrrrsrsyspyrynrdsysrdrrgrsrspygrgrsrspygrrdhdlfrrrrerslsAGSSGYRR
**************************************NLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITV******************************************************************************************
****************************************YVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITV******************************************************************************************
*********************************ANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITVEKA********TPGHYHGLR*************YSPYRY**************************GRRDHDLFRRRRE************
***********************************PGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITVEKAKR**********YHGLREKQRGNG***************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYSREGRGQRSRSLSRSRRSRSRSRSRSPDAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITVEKAKRSRGRTPTPGHYHGLREKQRGNGRRRSRSYSPYRYNRDSYSRDRRGRSRSPYGRGRSRSPYGRRDHDLFRRRRERSLSAGSSGYRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
Q10422297 Uncharacterized RNA-bindi yes no 0.472 0.319 0.421 1e-16
Q80YR5 991 Scaffold attachment facto yes no 0.393 0.079 0.455 1e-12
Q15424 915 Scaffold attachment facto no no 0.393 0.086 0.417 5e-12
Q5R452 914 Scaffold attachment facto yes no 0.393 0.086 0.417 5e-12
Q14151 953 Scaffold attachment facto no no 0.393 0.082 0.443 6e-12
D3YXK2 937 Scaffold attachment facto no no 0.393 0.084 0.417 2e-11
O88453 931 Scaffold attachment facto no no 0.393 0.084 0.417 2e-11
Q9NWH9 1034 SAFB-like transcription m no no 0.383 0.074 0.415 2e-11
Q8CH25 1031 SAFB-like transcription m no no 0.383 0.074 0.402 5e-11
Q498L2 998 SAFB-like transcription m N/A no 0.383 0.077 0.415 5e-11
>sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 Back     alignment and function desciption
 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 60/95 (63%)

Query: 35  NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR 94
           N GN+L+V+G+++R+   +L++ F   G VT   ++ +P T+ S GF F++  TVE A  
Sbjct: 98  NLGNDLFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTKASRGFGFLSFSTVEEATS 157

Query: 95  CIKYLNRSVLEGRLITVEKAKRSRGRTPTPGHYHG 129
            I  LN     GR++ V+KAKRSR  +PTPG Y G
Sbjct: 158 AIDNLNSQEFYGRVLNVQKAKRSRPHSPTPGKYMG 192





Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q80YR5|SAFB2_MOUSE Scaffold attachment factor B2 OS=Mus musculus GN=Safb2 PE=1 SV=2 Back     alignment and function description
>sp|Q15424|SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 Back     alignment and function description
>sp|Q5R452|SAFB1_PONAB Scaffold attachment factor B1 OS=Pongo abelii GN=SAFB PE=2 SV=1 Back     alignment and function description
>sp|Q14151|SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens GN=SAFB2 PE=1 SV=1 Back     alignment and function description
>sp|D3YXK2|SAFB1_MOUSE Scaffold attachment factor B1 OS=Mus musculus GN=Safb PE=1 SV=2 Back     alignment and function description
>sp|O88453|SAFB1_RAT Scaffold attachment factor B1 OS=Rattus norvegicus GN=Safb PE=1 SV=2 Back     alignment and function description
>sp|Q9NWH9|SLTM_HUMAN SAFB-like transcription modulator OS=Homo sapiens GN=SLTM PE=1 SV=2 Back     alignment and function description
>sp|Q8CH25|SLTM_MOUSE SAFB-like transcription modulator OS=Mus musculus GN=Sltm PE=1 SV=1 Back     alignment and function description
>sp|Q498L2|SLTM_XENLA SAFB-like transcription modulator OS=Xenopus laevis GN=sltm PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
225426196211 PREDICTED: uncharacterized RNA-binding p 0.796 0.758 0.748 5e-51
255537535204 Arginine/serine-rich-splicing factor, pu 0.776 0.764 0.703 3e-50
224074996208 predicted protein [Populus trichocarpa] 0.781 0.754 0.678 8e-45
294460169216 unknown [Picea sitchensis] 0.741 0.689 0.592 4e-42
356536248191 PREDICTED: uncharacterized RNA-binding p 0.597 0.628 0.719 5e-42
29893585 324 putative transformer serine/arginine-ric 0.850 0.527 0.6 2e-41
125543223 324 hypothetical protein OsI_10866 [Oryza sa 0.850 0.527 0.6 2e-41
108707341 347 RNA recognition motif family protein, ex 0.771 0.446 0.621 1e-40
108707340 346 RNA recognition motif family protein, ex 0.771 0.447 0.621 1e-40
223944069 315 unknown [Zea mays] gi|413956219|gb|AFW88 0.716 0.457 0.649 1e-40
>gi|225426196|ref|XP_002279684.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 128/171 (74%), Positives = 135/171 (78%), Gaps = 11/171 (6%)

Query: 32  DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG 91
           DA NPGNNLYVTGLSTRV  +DLEK+F  EGKV ECHLVTDPRTRES GF FVTMETVE 
Sbjct: 48  DAVNPGNNLYVTGLSTRVNASDLEKYFNSEGKVVECHLVTDPRTRESRGFGFVTMETVED 107

Query: 92  ADRCIKYLNRSVLEGRLITVEKAKRSRGRTPTPGHYHGLREKQRGNGRRRSRSYSPYRY- 150
           ADRCIKYLNRSVLEGRLITVEKAKR RGRTPTPG YHGLRE++   GRRRSRSYSP R+ 
Sbjct: 108 ADRCIKYLNRSVLEGRLITVEKAKRRRGRTPTPGRYHGLRERRGRGGRRRSRSYSPRRWQ 167

Query: 151 NRDSYSRDRRGRSRSPYGRGRSRSPYGRRDH--DLFRRRRERSLSAGSSGY 199
           +RD Y+RDRRGRSRSPYGR        R D   D  RRRRERSLS     Y
Sbjct: 168 DRDPYARDRRGRSRSPYGR--------RSDDYSDSNRRRRERSLSGAGRDY 210




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537535|ref|XP_002509834.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis] gi|223549733|gb|EEF51221.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224074996|ref|XP_002304510.1| predicted protein [Populus trichocarpa] gi|222841942|gb|EEE79489.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|294460169|gb|ADE75667.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|356536248|ref|XP_003536651.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like [Glycine max] Back     alignment and taxonomy information
>gi|29893585|gb|AAP06839.1| putative transformer serine/arginine-rich ribonucleoprotein [Oryza sativa Japonica Group] gi|125585702|gb|EAZ26366.1| hypothetical protein OsJ_10248 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125543223|gb|EAY89362.1| hypothetical protein OsI_10866 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|108707341|gb|ABF95136.1| RNA recognition motif family protein, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|108707340|gb|ABF95135.1| RNA recognition motif family protein, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|223944069|gb|ACN26118.1| unknown [Zea mays] gi|413956219|gb|AFW88868.1| hypothetical protein ZEAMMB73_204329 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
TAIR|locus:2025092 382 SR45a "serine/arginine rich-li 0.497 0.261 0.68 2e-31
ASPGD|ASPL0000005578307 AN6676 [Emericella nidulans (t 0.482 0.315 0.494 1.9e-21
DICTYBASE|DDB_G0292698306 DDB_G0292698 "RNA-binding regi 0.497 0.326 0.43 1.2e-17
POMBASE|SPAC25G10.01297 SPAC25G10.01 "RNA-binding prot 0.492 0.333 0.41 2.9e-16
UNIPROTKB|E1C875182 TRA2A "Uncharacterized protein 0.477 0.527 0.408 3.9e-12
UNIPROTKB|F1NPM7277 TRA2A "Uncharacterized protein 0.477 0.346 0.408 6.6e-12
UNIPROTKB|F1PPN1 953 SAFB2 "Uncharacterized protein 0.407 0.086 0.439 9.4e-12
UNIPROTKB|J9JHN8 954 SAFB2 "Uncharacterized protein 0.407 0.085 0.439 9.5e-12
MGI|MGI:2146808 991 Safb2 "scaffold attachment fac 0.412 0.083 0.433 9.9e-12
UNIPROTKB|H9KZ12 873 H9KZ12 "Uncharacterized protei 0.432 0.099 0.420 1.1e-11
TAIR|locus:2025092 SR45a "serine/arginine rich-like protein 45a" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 345 (126.5 bits), Expect = 2.0e-31, P = 2.0e-31
 Identities = 68/100 (68%), Positives = 80/100 (80%)

Query:    32 DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG 91
             DA NPGN+LYVTGLS RVT  DLE  F  EGKVT+ HLV DP TRES GF F++M++V  
Sbjct:    69 DAENPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGD 128

Query:    92 ADRCIKYLNRSVLEGRLITVEKAKRSRGRTPTPGHYHGLR 131
             A+RCI+ L+ SVL+GR+ITVEKA+R RGRTPTPG Y GLR
Sbjct:   129 ANRCIRSLDHSVLQGRVITVEKARRRRGRTPTPGKYLGLR 168




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0008380 "RNA splicing" evidence=NAS
GO:0009644 "response to high light intensity" evidence=IMP
GO:0043484 "regulation of RNA splicing" evidence=IMP
ASPGD|ASPL0000005578 AN6676 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292698 DDB_G0292698 "RNA-binding region RNP-1 domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC25G10.01 SPAC25G10.01 "RNA-binding protein" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E1C875 TRA2A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPM7 TRA2A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPN1 SAFB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHN8 SAFB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2146808 Safb2 "scaffold attachment factor B2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZ12 H9KZ12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-34
smart0036073 smart00360, RRM, RNA recognition motif 1e-22
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 7e-20
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-18
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 3e-17
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-17
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 5e-15
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-14
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-13
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 3e-13
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 2e-12
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 2e-12
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 6e-12
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 9e-12
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-11
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-11
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 2e-11
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 5e-11
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 9e-11
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-10
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 1e-10
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 5e-10
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 7e-10
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 8e-10
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-09
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 2e-09
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 2e-09
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-09
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 3e-09
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-09
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 4e-09
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 4e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 5e-09
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 6e-09
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 6e-09
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 7e-09
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 1e-08
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 1e-08
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-08
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 2e-08
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 3e-08
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 4e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 4e-08
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 4e-08
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 4e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 4e-08
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-08
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-08
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 5e-08
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 5e-08
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 8e-08
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-07
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 1e-07
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-07
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 1e-07
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 1e-07
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-07
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-07
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 2e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-07
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 3e-07
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 3e-07
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-07
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-07
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 4e-07
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 4e-07
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 4e-07
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 5e-07
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 5e-07
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 6e-07
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 6e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-07
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 7e-07
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 8e-07
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 9e-07
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-06
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 1e-06
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 1e-06
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-06
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 2e-06
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-06
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 2e-06
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-06
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-06
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-06
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 2e-06
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 4e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 6e-06
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 6e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 7e-06
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 7e-06
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 8e-06
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 9e-06
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 9e-06
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 1e-05
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 1e-05
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 1e-05
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 1e-05
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 1e-05
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 1e-05
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 2e-05
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-05
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 3e-05
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 3e-05
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 4e-05
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 4e-05
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 4e-05
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 4e-05
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 4e-05
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 4e-05
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 4e-05
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 4e-05
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 6e-05
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 6e-05
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 7e-05
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 8e-05
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 9e-05
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-04
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 1e-04
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 1e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 1e-04
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 1e-04
cd1253483 cd12534, RRM_SARFH, RNA recognition motif in Droso 1e-04
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 1e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-04
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 2e-04
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 2e-04
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-04
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-04
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-04
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-04
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 3e-04
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 3e-04
cd1254993 cd12549, RRM_Set1B, RNA recognition motif in verte 3e-04
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 3e-04
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 4e-04
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 4e-04
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 4e-04
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 5e-04
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 5e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 6e-04
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 6e-04
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 6e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 6e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 7e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 7e-04
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 8e-04
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 8e-04
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 8e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 9e-04
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 9e-04
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 9e-04
cd1242471 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 0.001
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 0.001
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 0.001
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 0.001
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 0.001
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 0.001
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 0.001
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 0.001
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 0.001
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 0.001
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 0.001
cd1228291 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 0.001
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 0.001
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 0.001
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 0.002
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.002
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 0.002
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 0.002
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 0.002
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 0.002
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.002
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 0.002
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 0.002
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 0.002
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 0.002
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.003
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 0.004
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 0.004
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.004
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
 Score =  116 bits (293), Expect = 2e-34
 Identities = 46/80 (57%), Positives = 54/80 (67%)

Query: 37  GNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCI 96
           GN L+V+GLSTR T  +LE  F   G+V E  L+ DP T ES GF FVT E+VE AD  I
Sbjct: 1   GNKLFVSGLSTRTTEKELEALFSKFGRVEEVLLMKDPETGESRGFGFVTFESVEDADAAI 60

Query: 97  KYLNRSVLEGRLITVEKAKR 116
           + LN   LEGR+I VEKAKR
Sbjct: 61  RDLNGKELEGRVIKVEKAKR 80


This subfamily corresponds to the RRM domain of hnRNP G, also termed glycoprotein p43 or RBMX, an RNA-binding motif protein located on the X chromosome. It is expressed ubiquitously and has been implicated in the splicing control of several pre-mRNAs. Moreover, hnRNP G may function as a regulator of transcription for SREBP-1c and GnRH1. Research has shown that hnRNP G may also act as a tumor-suppressor since it upregulates the Txnip gene and promotes the fidelity of DNA end-joining activity. In addition, hnRNP G appears to play a critical role in proper neural development of zebrafish and frog embryos. The family also includes several paralogs of hnRNP G, such as hRBMY and hnRNP G-T (also termed RNA-binding motif protein, X-linked-like-2). Both, hRBMY and hnRNP G-T, are exclusively expressed in testis and critical for male fertility. Like hnRNP G, hRBMY and hnRNP G-T interact with factors implicated in the regulation of pre-mRNA splicing, such as hTra2-beta1 and T-STAR. Although members in this family share a high conserved N-terminal RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), they appear to recognize different RNA targets. For instance, hRBMY interacts specifically with a stem-loop structure in which the loop is formed by the sequence CA/UCAA. In contrast, hnRNP G associates with single stranded RNA sequences containing a CCA/C motif. In addition to the RRM, hnRNP G contains a nascent transcripts targeting domain (NTD) in the middle region and a novel auxiliary RNA-binding domain (RBD) in its C-terminal region. The C-terminal RBD exhibits distinct RNA binding specificity, and would play a critical role in the regulation of alternative splicing by hnRNP G. . Length = 80

>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240993 cd12549, RRM_Set1B, RNA recognition motif in vertebrate histone-lysine N-methyltransferase Setd1B (Set1B) Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240870 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
KOG4207256 consensus Predicted splicing factor, SR protein su 99.9
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.89
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.88
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.81
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.8
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.79
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.78
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.77
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.77
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.76
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.74
KOG0122270 consensus Translation initiation factor 3, subunit 99.73
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.72
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.71
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.69
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.68
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.68
PLN03120260 nucleic acid binding protein; Provisional 99.67
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.67
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.67
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.66
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.66
smart0036272 RRM_2 RNA recognition motif. 99.65
PLN03213 759 repressor of silencing 3; Provisional 99.65
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.65
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.63
PLN03121243 nucleic acid binding protein; Provisional 99.63
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.62
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.62
smart0036071 RRM RNA recognition motif. 99.62
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.62
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.62
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.6
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.6
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.59
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.59
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.59
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.59
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.58
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.58
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.57
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.56
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.56
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.56
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.55
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.55
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.54
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.54
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.53
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.53
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 99.53
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.53
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.5
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.48
smart0036170 RRM_1 RNA recognition motif. 99.48
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.47
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.46
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 99.46
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 99.45
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.4
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.38
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.37
KOG0153377 consensus Predicted RNA-binding protein (RRM super 99.28
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 99.27
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 99.27
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.27
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.26
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 99.25
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.23
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.22
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 99.21
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.19
KOG0533243 consensus RRM motif-containing protein [RNA proces 99.18
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.16
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.15
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 99.13
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.12
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 99.1
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 99.07
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.04
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 99.03
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.9
KOG0226290 consensus RNA-binding proteins [General function p 98.86
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.85
KOG1995 351 consensus Conserved Zn-finger protein [General fun 98.85
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.85
KOG0151 877 consensus Predicted splicing regulator, contains R 98.84
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.79
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.69
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.68
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.6
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.6
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 98.55
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.55
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.51
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 98.47
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 98.45
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.41
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 98.41
KOG4210285 consensus Nuclear localization sequence binding pr 98.35
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 98.3
COG5175 480 MOT2 Transcriptional repressor [Transcription] 98.3
KOG3152278 consensus TBP-binding protein, activator of basal 98.26
KOG2314 698 consensus Translation initiation factor 3, subunit 98.26
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 98.24
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 98.21
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 98.18
KOG2416 718 consensus Acinus (induces apoptotic chromatin cond 98.08
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 98.07
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 98.05
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.03
KOG1855484 consensus Predicted RNA-binding protein [General f 98.01
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.0
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.0
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.95
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.9
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.85
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 97.81
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 97.8
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 97.65
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.62
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 97.61
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 97.59
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 97.5
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 97.45
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 97.41
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.4
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 97.25
KOG2135526 consensus Proteins containing the RNA recognition 97.2
KOG4660549 consensus Protein Mei2, essential for commitment t 97.13
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 97.04
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 97.02
KOG2068327 consensus MOT2 transcription factor [Transcription 97.01
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.97
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 96.88
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 96.81
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 96.8
KOG2591 684 consensus c-Mpl binding protein, contains La domai 96.73
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 96.69
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.53
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 96.38
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.22
KOG4210285 consensus Nuclear localization sequence binding pr 96.13
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 96.01
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 95.67
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 95.65
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 94.64
KOG2318 650 consensus Uncharacterized conserved protein [Funct 93.28
smart0059669 PRE_C2HC PRE_C2HC domain. 92.69
KOG4410396 consensus 5-formyltetrahydrofolate cyclo-ligase [C 92.38
KOG4483528 consensus Uncharacterized conserved protein [Funct 92.36
PF0753068 PRE_C2HC: Associated with zinc fingers; InterPro: 92.36
KOG4019193 consensus Calcineurin-mediated signaling pathway i 91.23
PF03468116 XS: XS domain; InterPro: IPR005380 The XS (rice ge 90.96
KOG4207256 consensus Predicted splicing factor, SR protein su 87.33
KOG2295 648 consensus C2H2 Zn-finger protein [General function 86.31
COG0724306 RNA-binding proteins (RRM domain) [General functio 84.7
KOG1295 376 consensus Nonsense-mediated decay protein Upf3 [RN 84.6
PRK1454884 50S ribosomal protein L23P; Provisional 83.78
TIGR0363677 L23_arch archaeal ribosomal protein L23. This mode 83.25
COG5638 622 Uncharacterized conserved protein [Function unknow 82.97
PF1551362 DUF4651: Domain of unknown function (DUF4651) 81.75
KOG4365 572 consensus Uncharacterized conserved protein [Funct 81.74
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 81.33
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
Probab=99.90  E-value=1.1e-22  Score=154.76  Aligned_cols=89  Identities=30%  Similarity=0.475  Sum_probs=83.1

Q ss_pred             CCCCCCCCeEEEeCCCCCCcHHHHHHHHcCCCCeeEEEEeeCCCCCCcccEEEEEEcCHHHHHHHHHHhCCCeeCCeeeE
Q 028972           31 PDAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLIT  110 (201)
Q Consensus        31 p~~~~~~~~l~V~nLp~~~t~~~L~~~F~~~G~i~~v~i~~~~~~~~~~g~afV~f~~~~~a~~al~~l~g~~l~g~~i~  110 (201)
                      |...+..+.|.|-||.+.|+.++|..+|++||.|.+|.|+.++.|++++|||||.|.+..+|+.||+.|+|.+|+|+.|.
T Consensus         7 PPdv~gm~SLkVdNLTyRTspd~LrrvFekYG~vgDVyIPrdr~Tr~sRgFaFVrf~~k~daedA~damDG~~ldgRelr   86 (256)
T KOG4207|consen    7 PPDVEGMTSLKVDNLTYRTSPDDLRRVFEKYGRVGDVYIPRDRYTRQSRGFAFVRFHDKRDAEDALDAMDGAVLDGRELR   86 (256)
T ss_pred             CCCcccceeEEecceeccCCHHHHHHHHHHhCcccceecccccccccccceeEEEeeecchHHHHHHhhcceeeccceee
Confidence            44555677899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeecccCCC
Q 028972          111 VEKAKRSRG  119 (201)
Q Consensus       111 V~~a~~~~~  119 (201)
                      |++|+....
T Consensus        87 Vq~arygr~   95 (256)
T KOG4207|consen   87 VQMARYGRP   95 (256)
T ss_pred             ehhhhcCCC
Confidence            999987654



>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00596 PRE_C2HC PRE_C2HC domain Back     alignment and domain information
>KOG4410 consensus 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG4483 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07530 PRE_C2HC: Associated with zinc fingers; InterPro: IPR006579 This domain is present in proteins found exclusively in the arthropods, including a number of Drosophila species, the silk moth and the gypsy moth Back     alignment and domain information
>KOG4019 consensus Calcineurin-mediated signaling pathway inhibitor DSCR1 [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF03468 XS: XS domain; InterPro: IPR005380 The XS (rice gene X and SGS3) domain is found in a family of plant proteins including gene X Q9SBW2 from SWISSPROT and SGS3 Q9LDX1 from SWISSPROT Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG2295 consensus C2H2 Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG1295 consensus Nonsense-mediated decay protein Upf3 [RNA processing and modification] Back     alignment and domain information
>PRK14548 50S ribosomal protein L23P; Provisional Back     alignment and domain information
>TIGR03636 L23_arch archaeal ribosomal protein L23 Back     alignment and domain information
>COG5638 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15513 DUF4651: Domain of unknown function (DUF4651) Back     alignment and domain information
>KOG4365 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 8e-09
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 1e-08
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 5e-07
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 5e-07
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 6e-07
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 6e-07
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 6e-07
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 7e-07
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 7e-07
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 7e-07
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 1e-06
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 1e-06
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 1e-06
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-06
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 1e-06
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 2e-06
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 2e-06
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 2e-06
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 2e-06
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 3e-06
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 3e-06
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 4e-06
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 5e-06
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 7e-06
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 7e-06
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 8e-06
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 1e-05
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 2e-05
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 2e-05
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 3e-05
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 3e-05
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 3e-05
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 4e-05
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 5e-05
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 5e-05
1sxl_A97 Resonance Assignments And Solution Structure Of The 7e-05
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 7e-05
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 7e-05
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 8e-05
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 8e-05
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 8e-05
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 1e-04
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 1e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 1e-04
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 1e-04
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-04
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-04
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-04
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 2e-04
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 3e-04
2hyi_B91 Structure Of The Human Exon Junction Complex With A 3e-04
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 3e-04
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 3e-04
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 3e-04
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 4e-04
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 4e-04
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 5e-04
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 5e-04
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 5e-04
2cq4_A114 Solution Structure Of Rna Binding Domain In Rna Bin 6e-04
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 7e-04
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure

Iteration: 1

Score = 57.0 bits (136), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 32/85 (37%), Positives = 47/85 (55%), Gaps = 2/85 (2%) Query: 32 DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG 91 +A +PG L++ GL+ L+ FG G ++E L+ D RT +S GFAF+T E Sbjct: 3 EADHPGK-LFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENPAD 60 Query: 92 ADRCIKYLNRSVLEGRLITVEKAKR 116 A K +N L G+ I VE+AK+ Sbjct: 61 AKNAAKDMNGKSLHGKAIKVEQAKK 85
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|2CQ4|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 23 Length = 114 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-27
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-26
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 5e-26
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 9e-26
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 5e-25
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 5e-24
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 9e-24
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-23
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 5e-23
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 6e-23
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-22
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 5e-22
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 9e-22
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-21
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-21
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 9e-21
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-20
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-20
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-15
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-20
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-20
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-20
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-20
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-20
3q2s_C229 Cleavage and polyadenylation specificity factor S; 4e-20
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 6e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-19
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 7e-20
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-15
2kt5_A124 RNA and export factor-binding protein 2; chaperone 9e-20
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-19
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-19
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-19
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-19
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 8e-15
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-19
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-19
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-19
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-19
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-19
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-19
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 8e-19
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-19
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-16
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-11
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-18
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-18
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-18
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-18
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 4e-18
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 5e-18
1x4e_A85 RNA binding motif, single-stranded interacting pro 5e-18
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 8e-18
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-17
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-17
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-17
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 7e-14
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-17
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-17
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-17
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-17
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-17
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-17
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-17
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-17
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-17
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-16
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-17
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-17
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-17
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 6e-17
2cpj_A99 Non-POU domain-containing octamer-binding protein; 7e-17
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 7e-17
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 8e-17
2cph_A107 RNA binding motif protein 19; RNA recognition moti 9e-17
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-16
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-16
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-16
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-16
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-08
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-15
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-15
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-16
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 9e-16
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-16
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 6e-15
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-16
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-16
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-16
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-16
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-16
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 4e-16
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-16
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 6e-16
2cqd_A116 RNA-binding region containing protein 1; RNA recog 8e-16
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 8e-16
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-15
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-15
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-15
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-15
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-15
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-15
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-15
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 5e-15
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-15
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-15
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 7e-15
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-14
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-14
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-14
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-14
1x5p_A97 Negative elongation factor E; structure genomics, 2e-14
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-14
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-14
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-14
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-14
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-14
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-14
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-14
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 6e-14
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 6e-14
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 9e-14
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 9e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-13
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-11
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 1e-13
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 1e-13
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-13
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-13
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-13
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-13
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-13
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-13
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-13
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 4e-13
2i2y_A150 Fusion protein consists of immunoglobin G- binding 5e-13
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 5e-13
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 8e-13
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 8e-13
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-12
2div_A99 TRNA selenocysteine associated protein; structural 1e-12
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-12
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-12
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-12
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-12
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-11
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-11
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-11
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 5e-11
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 6e-11
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-10
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-10
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-10
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-10
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 5e-10
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 9e-10
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 9e-10
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-09
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-09
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 3e-09
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-09
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 8e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-08
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-08
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 3e-08
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 3e-08
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-08
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 6e-08
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 7e-08
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 8e-08
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-06
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 5e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-05
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-05
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 2e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 4e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 7e-04
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
 Score = 98.5 bits (246), Expect = 4e-27
 Identities = 28/110 (25%), Positives = 42/110 (38%)

Query: 17  SRSRRSRSRSRSRSPDAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTR 76
           S     R      S +   P   LY+  LS RVT  DL   F    +     +     T 
Sbjct: 5   SSGEEIRKIPMFSSYNPGEPNKVLYLKNLSPRVTERDLVSLFARFQEKKGPPIQFRMMTG 64

Query: 77  ESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITVEKAKRSRGRTPTPGH 126
              G AF+T    E A + +  +N   L G+++ +E  K  + R+  P  
Sbjct: 65  RMRGQAFITFPNKEIAWQALHLVNGYKLYGKILVIEFGKNKKQRSSGPSS 114


>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.92
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.91
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.9
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.9
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.9
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.9
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.9
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.89
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.89
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.89
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.89
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.89
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.89
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.89
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.89
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.89
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.89
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.89
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.89
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.89
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.89
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.89
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.89
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.89
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.89
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.89
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.89
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.89
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.89
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.89
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.89
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.89
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.88
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.88
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.88
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.88
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.88
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.88
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.88
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.88
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.88
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.88
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.88
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.88
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.88
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.88
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.88
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.88
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.87
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.87
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.87
2div_A99 TRNA selenocysteine associated protein; structural 99.87
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.87
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.87
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.87
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.87
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.87
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.87
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.87
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.87
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.87
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.87
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.87
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.87
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.86
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.86
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.86
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.86
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.86
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.86
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.86
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.86
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.86
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.86
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.85
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.85
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.85
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.85
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.85
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.85
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.85
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.85
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.85
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.85
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.85
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.85
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.85
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.85
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.85
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.85
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.85
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.85
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.85
2dis_A109 Unnamed protein product; structural genomics, RRM 99.85
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.85
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.85
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.85
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.85
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.85
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.84
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.84
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.84
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.84
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.84
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.84
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.84
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.84
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.84
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.84
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.83
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.83
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.83
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.83
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.83
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.83
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.83
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.83
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.83
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.73
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.83
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.83
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.83
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.83
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.82
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.82
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.82
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.82
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.82
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.82
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.82
1x5p_A97 Negative elongation factor E; structure genomics, 99.82
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.82
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.82
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.82
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.82
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.82
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.81
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.81
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.81
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.81
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.81
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.81
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.8
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.8
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.8
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.8
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.8
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.8
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.8
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.79
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.79
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.79
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.79
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.79
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.79
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.78
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.78
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.78
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.78
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.77
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.77
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.77
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.77
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.76
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.76
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.76
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.76
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.76
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.75
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.75
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.75
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.75
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.74
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.74
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.74
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.73
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.73
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.72
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.72
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.72
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.71
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.71
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.7
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.7
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.7
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.69
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.69
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.69
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.66
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.66
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.66
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.66
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.65
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.65
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.65
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.64
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.63
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.63
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.63
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.62
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.6
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.59
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.58
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.53
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.5
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.4
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.2
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.18
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.95
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.46
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 98.41
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.34
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 98.28
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 98.07
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.99
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.91
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 97.84
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.95
2i2y_A150 Fusion protein consists of immunoglobin G- binding 96.93
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 96.85
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 94.74
4eyt_A129 Telomerase associated protein P65; RNA, LA protein 93.71
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 93.04
4e8u_A172 Putative uncharacterized protein T8P19.180; XS dom 83.67
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.92  E-value=2.7e-24  Score=149.40  Aligned_cols=82  Identities=32%  Similarity=0.466  Sum_probs=78.8

Q ss_pred             CCCCeEEEeCCCCCCcHHHHHHHHcCCCCeeEEEEeeCCCCCCcccEEEEEEcCHHHHHHHHHHhCCCeeCCeeeEEeec
Q 028972           35 NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLITVEKA  114 (201)
Q Consensus        35 ~~~~~l~V~nLp~~~t~~~L~~~F~~~G~i~~v~i~~~~~~~~~~g~afV~f~~~~~a~~al~~l~g~~l~g~~i~V~~a  114 (201)
                      ..+++|||+|||.++|+++|+++|++||+|..|.|+.++.++.++|||||+|.+.++|++||+.|||..|+|+.|.|++|
T Consensus        17 ~~gt~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~A   96 (99)
T 4fxv_A           17 FQGTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYA   96 (99)
T ss_dssp             CCCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEEC
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEEECCHHHHHHHHHHhCCCEECCEEEEEEEe
Confidence            45789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cc
Q 028972          115 KR  116 (201)
Q Consensus       115 ~~  116 (201)
                      ++
T Consensus        97 kP   98 (99)
T 4fxv_A           97 RP   98 (99)
T ss_dssp             CB
T ss_pred             eC
Confidence            75



>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>4eyt_A Telomerase associated protein P65; RNA, LA protein, LARP7, RRM, XRRM, RNA binding protein; 2.50A {Tetrahymena thermophila} PDB: 4erd_A Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>4e8u_A Putative uncharacterized protein T8P19.180; XS domain, RNA binding protein, RNA directed DNA methylation; 2.70A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 201
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-20
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-18
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-16
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-16
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-16
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-16
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 6e-16
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-15
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-15
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 3e-15
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-15
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-15
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-15
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 9e-15
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-14
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-14
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-14
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-14
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-14
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-14
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-14
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-14
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-13
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-13
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-13
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-13
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 7e-13
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 9e-13
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-12
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-12
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-12
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-12
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-12
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 3e-12
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-12
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 5e-12
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-11
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-11
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-11
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-11
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-11
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-11
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 4e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 5e-11
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 5e-11
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 7e-11
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 8e-11
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-10
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 4e-10
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 7e-10
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-09
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-09
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 7e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 4e-08
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 4e-08
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 4e-08
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 6e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-07
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-07
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 4e-07
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 5e-07
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 6e-07
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 7e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 9e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 1e-06
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 2e-06
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-06
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 8e-06
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 8e-05
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 1e-04
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Poly(A)-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 79.2 bits (195), Expect = 2e-20
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 39  NLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKY 98
           +LYV  L   VT A L + F   G +    +  D  TR S G+A+V  +    A+R +  
Sbjct: 2   SLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDT 61

Query: 99  LNRSVLEGRLITVEKAKR 116
           +N  V++G+ + +  ++R
Sbjct: 62  MNFDVIKGKPVRIMWSQR 79


>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.92
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.91
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.91
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.91
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.91
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.91
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.91
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.91
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.91
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.9
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.9
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.9
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.9
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.9
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.89
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.89
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.89
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.89
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.89
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.89
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.89
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.89
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.89
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.89
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.89
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.88
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.88
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.88
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.88
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.88
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.88
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.88
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.88
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.87
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.87
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.87
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.87
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.87
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.87
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.87
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.86
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.86
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.86
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.85
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.85
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.85
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.85
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.85
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.85
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.85
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.84
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.84
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.84
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.84
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.84
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.84
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.84
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.84
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.83
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.83
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.83
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.83
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.83
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.83
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.82
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.82
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.82
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.82
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.82
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.82
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.81
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.81
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.8
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.8
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.75
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.71
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.69
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.67
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.66
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.64
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.62
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.6
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.56
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 98.43
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.32
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.04
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 97.36
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 84.46
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein 8
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.92  E-value=1.2e-24  Score=146.43  Aligned_cols=87  Identities=28%  Similarity=0.346  Sum_probs=81.2

Q ss_pred             CCCCCCCCeEEEeCCCCCCcHHHHHHHHcCCCCeeEEEEeeCCCCCCcccEEEEEEcCHHHHHHHHHHhCCCeeCCeeeE
Q 028972           31 PDAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADRCIKYLNRSVLEGRLIT  110 (201)
Q Consensus        31 p~~~~~~~~l~V~nLp~~~t~~~L~~~F~~~G~i~~v~i~~~~~~~~~~g~afV~f~~~~~a~~al~~l~g~~l~g~~i~  110 (201)
                      |.....+.+|||+|||.++++++|.++|++||+|..|.|+.++.++.++|||||+|.+.++|+.||+.|||..|+|+.|.
T Consensus         1 P~~s~~~~~l~V~nL~~~~t~~~l~~~F~~~G~i~~v~i~~d~~tg~~~g~afV~f~~~~~A~~A~~~lng~~l~g~~l~   80 (88)
T d1rk8a_           1 PQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQ   80 (88)
T ss_dssp             CCCCC-CEEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTSSEEEEEEEEESSHHHHHHHHHHHTTCEETTEECE
T ss_pred             CCCCCCCCEEEEeCCCCCCCHHHHHHHHHHcCCcccccccccccccccccceeEEECCHHHHHHHHHHcCCCEECCEEEE
Confidence            34456678999999999999999999999999999999999998999999999999999999999999999999999999


Q ss_pred             EeecccC
Q 028972          111 VEKAKRS  117 (201)
Q Consensus       111 V~~a~~~  117 (201)
                      |+||.++
T Consensus        81 V~~a~~k   87 (88)
T d1rk8a_          81 VDWCFVK   87 (88)
T ss_dssp             EEESEEC
T ss_pred             EEEecCC
Confidence            9999875



>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure