Citrus Sinensis ID: 029109

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MLVKQPNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
ccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHcccccccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccc
cHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHcccEEEEEEEEcccccccccHcHcccHHHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHEEccccHcccccccccHHHHHHccccccccccEEccccccHHHHHHHHHHHcccccccHHHHHHcc
mlvkqpnksSYRESLKALEADIQHANTLAAalprdyggdfvqmrlsyspfapLVLFMIEWMdysctdtvpsyLGLLNILVYKVYvdgmpalssKERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrKRVEERRKLsdkdldrndecgicmenctkmvlpncghslcvncfhdwnarSQSCLFAVAAYRE
mlvkqpnksSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrkrveerrklsdkdldrndecGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
MLVKQPNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
********************DIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLR******************************************ECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAY**
***************KALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVD**********KATLREFYAIIYPSLRQLE***********************************DRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYR*
*************SLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESE********************************LDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
*****PNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRK*****RKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVA*Y**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVKQPNxxxxxxxxxxxxxxxxxxxxxAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSxxxxxxxxxxxxxxxxxxxxxEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
255547924253 protein binding protein, putative [Ricin 0.964 0.758 0.778 4e-85
359473694255 PREDICTED: uncharacterized protein LOC10 0.949 0.741 0.760 5e-85
297738323247 unnamed protein product [Vitis vinifera] 0.924 0.744 0.775 6e-84
224110810250 predicted protein [Populus trichocarpa] 0.959 0.764 0.755 2e-82
356567396243 PREDICTED: uncharacterized protein LOC10 0.924 0.757 0.635 8e-69
449435031243 PREDICTED: uncharacterized protein LOC10 0.924 0.757 0.630 2e-67
449512974243 PREDICTED: uncharacterized protein LOC10 0.924 0.757 0.625 3e-67
225425930254 PREDICTED: uncharacterized protein LOC10 0.944 0.740 0.542 9e-58
115471529253 Os07g0275300 [Oryza sativa Japonica Grou 0.904 0.711 0.585 2e-56
226505928253 RNA-binding protein [Zea mays] gi|195652 0.904 0.711 0.574 4e-56
>gi|255547924|ref|XP_002515019.1| protein binding protein, putative [Ricinus communis] gi|223546070|gb|EEF47573.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 151/194 (77%), Positives = 168/194 (86%), Gaps = 2/194 (1%)

Query: 1   MLVKQPNK--SSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMI 58
           M  KQPN   SS+RESLKALEADIQHANTLAAA+P DYGGD VQMRLSYSP AP +LF++
Sbjct: 1   MWQKQPNNKSSSFRESLKALEADIQHANTLAAAIPGDYGGDRVQMRLSYSPLAPFILFLV 60

Query: 59  EWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEF 118
           EWMDYSCTD +PSYLGLL+ILVYKVYVDGMP LSSKERKATLREFYA IYPSLR LE EF
Sbjct: 61  EWMDYSCTDALPSYLGLLHILVYKVYVDGMPTLSSKERKATLREFYATIYPSLRLLEGEF 120

Query: 119 SELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVN 178
            ELEDN +R Q +E  SRKRVE++RK SD D++R+DECGICME+  KMVLPNCGHSLC++
Sbjct: 121 IELEDNPRRSQWTEAFSRKRVEDKRKRSDYDIERDDECGICMEDSAKMVLPNCGHSLCIS 180

Query: 179 CFHDWNARSQSCLF 192
           CFHDWN RSQSC F
Sbjct: 181 CFHDWNTRSQSCPF 194

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359473694|ref|XP_002272517.2| PREDICTED: uncharacterized protein LOC100245965 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738323|emb|CBI27524.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110810|ref|XP_002315643.1| predicted protein [Populus trichocarpa] gi|222864683|gb|EEF01814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356567396|ref|XP_003551906.1| PREDICTED: uncharacterized protein LOC100805014 [Glycine max] Back     alignment and taxonomy information
>gi|449435031|ref|XP_004135299.1| PREDICTED: uncharacterized protein LOC101207887 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449512974|ref|XP_004164193.1| PREDICTED: uncharacterized protein LOC101223953 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225425930|ref|XP_002272699.1| PREDICTED: uncharacterized protein LOC100240870 [Vitis vinifera] gi|297738321|emb|CBI27522.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|115471529|ref|NP_001059363.1| Os07g0275300 [Oryza sativa Japonica Group] gi|113610899|dbj|BAF21277.1| Os07g0275300 [Oryza sativa Japonica Group] gi|222636824|gb|EEE66956.1| hypothetical protein OsJ_23829 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|226505928|ref|NP_001152052.1| RNA-binding protein [Zea mays] gi|195652155|gb|ACG45545.1| RNA-binding protein [Zea mays] gi|238014126|gb|ACR38098.1| unknown [Zea mays] gi|414884234|tpg|DAA60248.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
TAIR|locus:2149750242 AIRP2 "ABA Insensitive RING Pr 0.909 0.747 0.497 1.2e-47
TAIR|locus:505006703242 AT5G58787 "AT5G58787" [Arabido 0.894 0.735 0.497 3e-46
TAIR|locus:505006120260 AT1G13195 [Arabidopsis thalian 0.934 0.715 0.491 3.8e-46
TAIR|locus:2024026251 AT1G24440 [Arabidopsis thalian 0.934 0.741 0.484 4.4e-45
DICTYBASE|DDB_G0292408213 DDB_G0292408 "RING finger prot 0.527 0.492 0.272 2.5e-05
UNIPROTKB|I3LUY7135 I3LUY7 "Uncharacterized protei 0.336 0.496 0.304 0.00012
ZFIN|ZDB-GENE-040625-71222 rnf141 "ring finger protein 14 0.467 0.418 0.299 0.00031
POMBASE|SPBC17A3.10306 pas4 "peroxisomal ubiquitin-pr 0.673 0.437 0.223 0.00037
TAIR|locus:2149750 AIRP2 "ABA Insensitive RING Protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 498 (180.4 bits), Expect = 1.2e-47, P = 1.2e-47
 Identities = 92/185 (49%), Positives = 130/185 (70%)

Query:     8 KSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTD 67
             + S+++SLKALEADIQ ANTLA+  P +Y G +VQMRLSYSP A L LF+++W D  C  
Sbjct:     2 RKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAAHLFLFLLQWTD--CH- 58

Query:    68 TVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKR 127
                  LGLL IL+YK YVDG   +S  ERK ++REFY +++PSL QL    +++E+  ++
Sbjct:    59 -FAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQLHGGITDVEERKQK 117

Query:   128 DQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARS 187
             + C +   +K   ++ K+S+ DL+R +ECGIC+E   K+VLP C HS+C+NC+ +W ARS
Sbjct:   118 EICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKVVLPTCNHSMCINCYRNWRARS 177

Query:   188 QSCLF 192
             QSC F
Sbjct:   178 QSCPF 182
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
TAIR|locus:505006703 AT5G58787 "AT5G58787" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006120 AT1G13195 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024026 AT1G24440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292408 DDB_G0292408 "RING finger protein 141" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|I3LUY7 I3LUY7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-71 rnf141 "ring finger protein 141" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBC17A3.10 pas4 "peroxisomal ubiquitin-protein ligase E3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.X.5021.1
hypothetical protein (240 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-04
smart0018440 smart00184, RING, Ring finger 6e-04
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 8e-04
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information 
 Score = 40.5 bits (95), Expect = 2e-05
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 155 ECGICMENCTK-MVLPNCGHSLCVNCFHDW-NARSQSC 190
           EC IC+E   + +VL  CGH  C +C   W  +   +C
Sbjct: 1   ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTC 38

Length = 45
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 99.66
PHA02929238 N1R/p28-like protein; Provisional 99.29
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.29
PHA02926242 zinc finger-like protein; Provisional 99.27
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.26
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.23
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.14
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.12
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.09
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.09
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.05
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.04
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.03
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.97
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.94
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.89
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.88
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.87
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.87
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.82
PF1463444 zf-RING_5: zinc-RING finger domain 98.82
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.77
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.77
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.75
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.58
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.57
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.55
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.53
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.48
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.36
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.34
KOG1002 791 consensus Nucleotide excision repair protein RAD16 98.18
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 98.12
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.03
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.97
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.93
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.81
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.77
COG52191525 Uncharacterized conserved protein, contains RING Z 97.71
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.68
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.68
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.67
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.63
PHA03096284 p28-like protein; Provisional 97.55
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.53
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 97.53
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.52
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.43
COG5152259 Uncharacterized conserved protein, contains RING a 97.36
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.13
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 97.06
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.04
KOG2660 331 consensus Locus-specific chromosome binding protei 96.98
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.92
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 96.91
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.89
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.74
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.56
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.45
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.28
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.18
KOG3002 299 consensus Zn finger protein [General function pred 96.12
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.7
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.7
PHA02825 162 LAP/PHD finger-like protein; Provisional 95.51
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.09
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.85
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 94.68
PF04641260 Rtf2: Rtf2 RING-finger 94.53
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.53
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.5
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.14
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 94.07
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 93.82
KOG4445 368 consensus Uncharacterized conserved protein, conta 93.32
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.83
PF10272358 Tmpp129: Putative transmembrane protein precursor; 92.81
KOG1940276 consensus Zn-finger protein [General function pred 92.56
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 92.5
COG5222 427 Uncharacterized conserved protein, contains RING Z 92.35
COG5175 480 MOT2 Transcriptional repressor [Transcription] 91.49
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 91.17
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 90.93
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 90.69
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 90.51
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 90.26
KOG0298 1394 consensus DEAD box-containing helicase-like transc 89.34
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 88.77
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 87.95
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 87.23
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 86.39
KOG03091081 consensus Conserved WD40 repeat-containing protein 85.55
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 84.34
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 82.79
PHA02862 156 5L protein; Provisional 81.58
KOG3053 293 consensus Uncharacterized conserved protein [Funct 80.21
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.66  E-value=1.3e-17  Score=148.32  Aligned_cols=173  Identities=23%  Similarity=0.356  Sum_probs=119.0

Q ss_pred             HHHHHHHHHHhhCCCCCCCceEEEEeccCCc-chHHHHHHhhhcccCCCCcccccceeEEEEEEEe-ecCCCccchhhh-
Q 029109           20 ADIQHANTLAAALPRDYGGDFVQMRLSYSPF-APLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVY-VDGMPALSSKER-   96 (199)
Q Consensus        20 ~di~~~n~~~~~~~~~~~g~~~~~~l~y~~~-~~~~lf~v~~~~~~~~~~l~~~l~l~~il~yk~~-~dg~~~~s~~~r-   96 (199)
                      .+++++ |.+..+|+++.+.--+||++++.- .....+++.|+++.    .+. .++.+++++..+ .|+..+++...+ 
T Consensus         3 ~~~~~~-tic~~~~~g~c~~g~~cr~~h~~~~~~~~~~~~~~~s~~----~~~-~~~~~~~~~~~~~~~~s~~~s~~~~~   76 (344)
T KOG1039|consen    3 LSLSQE-TICKYYQKGNCKFGDLCRLSHSLPDEEFATLLTPTTSSA----AAS-TGLSQSLIWANAVADASATMSVSSRP   76 (344)
T ss_pred             cccccc-hhhhhcccccccccceeeeeccCchhhcccccccccccc----ccc-cccchhhcccchhhccccccchhccc
Confidence            467888 999999999999999999999998 88899999999877    333 577888888888 688888887777 


Q ss_pred             -hhhHHHHHHHHhhHHHHH---------HHhhhhhhhh----------hhccchhhhhhhhHHHHhhhccccCC------
Q 029109           97 -KATLREFYAIIYPSLRQL---------ESEFSELEDN----------SKRDQCSEISSRKRVEERRKLSDKDL------  150 (199)
Q Consensus        97 -~atl~efy~~I~psl~qL---------~~~~~~~e~~----------~~~~~~~~~~~k~~~~~~~~ls~~~~------  150 (199)
                       ....++++++.+|+-.++         +.+...+...          .+...+...++.............+.      
T Consensus        77 ~~~~~~~s~~~~~~s~~~~~~~~~~~~~~~g~~~~~~~~~~~~~c~l~~~~pi~~~~~~~~~~~~~~~~~~~~~e~~~a~  156 (344)
T KOG1039|consen   77 VLTAIRASSSISEPSSTQENPYSNHGQCRFGNGDVTLNGNNPESCGLGTQHPICKRQYKNSMKRGSSCALSSAMERSFAL  156 (344)
T ss_pred             chhhhhhhhccccccccccCccccccccccCCcccccccccccccccccccchhHHHHhhhhcccccccchHhhhhccCc
Confidence             678888998877772221         1111111111          01111111111111111001111222      


Q ss_pred             --CCCCccccccccCcCce--------ecCCCCcccHhhHHHHh--hc-----CCCCcCcccCcc
Q 029109          151 --DRNDECGICMENCTKMV--------LPNCGHSLCVNCFHDWN--AR-----SQSCLFAVAAYR  198 (199)
Q Consensus       151 --e~e~eC~IClE~~~~~v--------lp~CgH~FC~~Ci~~W~--~~-----s~~CP~CR~~lk  198 (199)
                        ..+.+|+||||.....+        +|||.|.||.+||+.|.  .+     +++||+||.+.+
T Consensus       157 ~~s~~k~CGICme~i~ek~~~~~rfgilpnC~H~~Cl~Cir~wr~~~q~~~~~sksCP~CRv~s~  221 (344)
T KOG1039|consen  157 QKSSEKECGICMETINEKAASERRFGILPNCNHSFCLNCIRKWRQATQFESKTSKSCPFCRVPSS  221 (344)
T ss_pred             CccccccceehhhhccccchhhhhcccCCCcchhhhhcHhHhhhhhhccccccccCCCcccCccc
Confidence              34889999998766544        59999999999999998  44     589999998865

>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 4e-17
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 7e-13
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-10
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 4e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 5e-06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 5e-06
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 8e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-05
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 7e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 9e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 4e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 4e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 5e-04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 7e-04
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 73.5 bits (180), Expect = 4e-17
 Identities = 28/109 (25%), Positives = 41/109 (37%), Gaps = 16/109 (14%)

Query: 87  GMPALSS-----KERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEE 141
           G P         +E   + ++F AII    ++LE    E E    +            EE
Sbjct: 4   GSPGFQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQK-----------EE 52

Query: 142 RRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSC 190
                +  L+   +C IC E   + V  NC HS C  C ++W  R   C
Sbjct: 53  VLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIEC 101
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.48
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.48
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.46
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.45
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.44
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.43
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.42
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.41
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.41
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.4
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.4
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.39
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.39
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.38
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.38
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.37
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.37
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.36
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.36
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.36
2ect_A78 Ring finger protein 126; metal binding protein, st 99.35
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.35
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.35
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.35
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.33
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.33
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.33
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.31
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.31
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.31
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.29
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.28
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.28
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.27
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.24
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.24
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.24
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.23
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.23
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.22
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.21
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.2
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.2
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.19
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.19
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.19
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.17
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.17
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.15
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.14
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.12
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.1
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.08
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.08
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.05
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 99.03
2ea5_A68 Cell growth regulator with ring finger domain prot 99.01
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.0
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.98
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.94
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.93
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.9
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.82
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.72
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.63
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.61
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.55
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.53
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.4
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.22
3nw0_A238 Non-structural maintenance of chromosomes element 97.46
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.13
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.4
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 90.22
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 89.1
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 87.73
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 81.75
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.48  E-value=1.9e-14  Score=93.83  Aligned_cols=48  Identities=25%  Similarity=0.689  Sum_probs=40.9

Q ss_pred             CCCCccccccccCcC----ceecCCCCcccHhhHHHHhhcCCCCcCcccCcc
Q 029109          151 DRNDECGICMENCTK----MVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYR  198 (199)
Q Consensus       151 e~e~eC~IClE~~~~----~vlp~CgH~FC~~Ci~~W~~~s~~CP~CR~~lk  198 (199)
                      +++.+|+||++....    .++|+|||.||..|+.+|+..+.+||+||.++.
T Consensus         3 ~~~~~C~IC~~~~~~~~~~~~~~~C~H~f~~~Ci~~w~~~~~~CP~Cr~~~~   54 (55)
T 1iym_A            3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCcCccCCccccCCCceEECCCCCCcccHHHHHHHHHcCCcCcCCCCEeE
Confidence            567899999976554    556679999999999999999999999999863
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 8e-07
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-06
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 5e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-04
d2ct7a173 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H 0.002
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 0.003
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 0.004
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 42.5 bits (100), Expect = 8e-07
 Identities = 12/45 (26%), Positives = 16/45 (35%), Gaps = 4/45 (8%)

Query: 150 LDRNDECGICME----NCTKMVLPNCGHSLCVNCFHDWNARSQSC 190
           +D   EC +C+           LP CGH     C   W     +C
Sbjct: 2   MDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTC 46
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.56
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.45
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.43
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.38
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.36
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.35
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.32
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.29
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.28
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.27
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.26
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.23
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.18
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.03
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.96
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.4
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 89.92
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 85.37
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 85.22
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 81.16
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 80.43
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.56  E-value=8.4e-16  Score=100.48  Aligned_cols=48  Identities=25%  Similarity=0.722  Sum_probs=40.6

Q ss_pred             CCCCCccccccccCcC----ceecCCCCcccHhhHHHHhhcCCCCcCcccCc
Q 029109          150 LDRNDECGICMENCTK----MVLPNCGHSLCVNCFHDWNARSQSCLFAVAAY  197 (199)
Q Consensus       150 ~e~e~eC~IClE~~~~----~vlp~CgH~FC~~Ci~~W~~~s~~CP~CR~~l  197 (199)
                      ++++.+|+||++....    .++|.|+|.||..||.+|++.+.+||+||.+|
T Consensus         2 ~ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           2 MDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence            3567789999966532    34678999999999999999999999999986
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure